F402827

General Info

Members Datasets Scaffolds Average Seq Length
314 171 314 113

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0596100|Ga0466967_0596100_93_482
Length 129
Sequence VRNEDVRLSLVEFPADDPERALRFWSGVLGTELDDRSQAEGRGWQTHADDQPAAAGPAIGVHRRGTGPGDRVSLPYFAVADLEAALERVVQLGGTVIHPGSRWAICRDSEGSPFGLAVNDDGPHGGGPS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
48 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
66 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.96
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100113241 3300005329 Bacteria 2560
2 Ga0070687_101117044 3300005343 Bacteria 577
3 Ga0070714_100018177 3300005435 Bacteria 5704
4 Ga0070714_100072626 3300005435 Bacteria 2979
5 Ga0070714_100155833 3300005435 Bacteria 2062
6 Ga0070714_100177299 3300005435 Bacteria 1937
7 Ga0070714_100488906 3300005435 Bacteria 1172
8 Ga0070714_100730433 3300005435 Unclassified 956
9 Ga0070713_100147422 3300005436 Bacteria 2090
10 Ga0070713_100495175 3300005436 Bacteria 1153
11 Ga0070713_100786486 3300005436 Bacteria 912
12 Ga0070710_10005285 3300005437 Bacteria 6121
13 Ga0070711_100214754 3300005439 Bacteria 1492
14 Ga0070681_10512632 3300005458 Bacteria 1113
15 Ga0068867_100673082 3300005459 Bacteria 910
16 Ga0070707_100968237 3300005468 Bacteria 816
17 Ga0070707_101020013 3300005468 Bacteria 793
18 Ga0070679_100052095 3300005530 Bacteria 4078
19 Ga0070684_100107483 3300005535 Bacteria 2499
20 Ga0070696_100049262 3300005546 Unclassified 2926
21 Ga0070696_100500239 3300005546 Bacteria 967
22 Ga0068857_100401119 3300005577 Bacteria 1276
23 Ga0068861_102186353 3300005719 Bacteria 554
24 Ga0068863_100003581 3300005841 Bacteria 15326
25 Ga0081538_10001542 3300005981 Bacteria 23627
26 Ga0081538_10023782 3300005981 Bacteria 4391
27 Ga0081538_10049655 3300005981 Bacteria 2543
28 Ga0081538_10180461 3300005981 Bacteria 904
29 Ga0070717_10007807 3300006028 Bacteria 7961
30 Ga0070717_10010637 3300006028 Bacteria 6954
31 Ga0070717_10011098 3300006028 Bacteria 6829
32 Ga0070717_10011541 3300006028 Bacteria 6711
33 Ga0070717_10523177 3300006028 Unclassified 1073
34 Ga0070712_100035945 3300006175 Bacteria 3366
35 Ga0075428_100137354 3300006844 Bacteria 2658
36 Ga0075428_100735109 3300006844 Bacteria 1050
37 Ga0075430_100000782 3300006846 Bacteria 24618
38 Ga0075431_100175321 3300006847 Unclassified 2202
39 Ga0075433_10002679 3300006852 Bacteria 13596
40 Ga0075434_100013469 3300006871 Bacteria 7785
41 Ga0075429_101976569 3300006880 Bacteria 505
42 Ga0075436_100068083 3300006914 Bacteria 2460
43 Ga0075435_100002096 3300007076 Bacteria 13104
44 Ga0105245_10389894 3300009098 Bacteria 1389
45 Ga0105243_11412754 3300009148 Unclassified 717
46 Ga0105242_10143718 3300009176 Unclassified 2073
47 Ga0105238_11452118 3300009551 Unclassified 714
48 Ga0157369_10815858 3300013105 Bacteria 958
49 Ga0157374_10965618 3300013296 Bacteria 871
50 Ga0157375_12444711 3300013308 Unclassified 624
51 Ga0206353_10058633 3300020082 Unclassified 682
52 Ga0207692_10026581 3300025898 Unclassified 2716
53 Ga0207693_10003811 3300025915 Bacteria 12836
54 Ga0207700_10076884 3300025928 Bacteria 2592
55 Ga0207700_10375101 3300025928 Bacteria 1243
56 Ga0207664_10000737 3300025929 Bacteria 22232
57 Ga0207664_10035349 3300025929 Unclassified 3855
58 Ga0207664_10063976 3300025929 Bacteria 2941
59 Ga0207664_10172379 3300025929 Bacteria 1852
60 Ga0207664_10667495 3300025929 Unclassified 935
61 Ga0207661_10093610 3300025944 Bacteria 2508
62 Ga0207678_11320317 3300026067 Unclassified 638
63 Ga0207641_10002678 3300026088 Bacteria 16262
64 Ga0207648_10607456 3300026089 Unclassified 1008
65 Ga0265338_10760725 3300028800 Unclassified 666
66 Ga0265327_10026016 3300031251 Bacteria 3398
67 Ga0307410_11192002 3300031852 Bacteria 663
68 Ga0307409_101313111 3300031995 Bacteria 749
69 Ga0373954_0182328 3300035118 Bacteria 1030
70 Ga0373943_0088563 3300035170 Unclassified 1599
71 Ga0373946_0044035 3300035171 Unclassified 1842
72 Ga0373924_0064608 3300035410 Bacteria 1537
73 Ga0373935_0380866 3300035692 Unclassified 1010
74 Ga0373947_0033175 3300035725 Bacteria 3046
75 Ga0373937_0153294 3300036401 Bacteria 2159
76 Ga0373925_0126650 3300037068 Unclassified 1988
77 Ga0395900_0810940 3300037418 Bacteria 863
78 Ga0395898_0026435 3300037466 Bacteria 5839
79 Ga0395905_0286718 3300037471 Bacteria 1533
80 Ga0395905_0832519 3300037471 Bacteria 826
81 Ga0436364_1084351 3300037853 Bacteria 991
82 Ga0395901_0591349 3300038443 Bacteria 1120
83 Ga0436365_0726297 3300039437 Bacteria 1320
84 Ga0436360_1080122 3300039438 Unclassified 552
85 Ga0436363_0392609 3300039450 Unclassified 630
86 Ga0436363_1544713 3300039450 Bacteria 1467
87 Ga0451789_0161492 3300041443 Unclassified 637
88 Ga0451853_3329988 3300041512 Bacteria 844
89 Ga0450923_170693 3300042125 Bacteria 533
90 Ga0439435_0265825 3300042436 Bacteria 581
91 Ga0466969_0536310 3300044656 Unclassified 535
92 Ga0466961_0228752 3300044693 Bacteria 1145
93 Ga0466963_0000919 3300044694 Bacteria 15004
94 Ga0466957_0002191 3300044842 Bacteria 10469
95 Ga0466959_0005650 3300045049 Bacteria 8605
96 Ga0466967_0008945 3300045976 Bacteria 7393
97 Ga0466967_0455482 3300045976 Archaea 1251
98 Ga0466967_0596100 3300045976 Bacteria 1090
99 Ga0466967_2237055 3300045976 Bacteria 543
100 Ga0495592_0152498 3300046454 Bacteria 1597
101 Ga0495603_0256188 3300046455 Unclassified 1007
102 Ga0495629_0001428 3300046459 Bacteria 18839
103 Ga0495629_0013037 3300046459 Bacteria 6006
104 Ga0495629_0323961 3300046459 Bacteria 1053
105 Ga0495629_0813275 3300046459 Bacteria 616
106 Ga0495638_0013500 3300046460 Bacteria 5557
107 Ga0495641_0058622 3300046461 Bacteria 1742
108 Ga0495651_0109794 3300046462 Bacteria 2041
109 Ga0495653_0150449 3300046463 Bacteria 1627
110 Ga0495653_0319392 3300046463 Bacteria 1007
111 Ga0495580_0719856 3300046472 Bacteria 652
112 Ga0495664_0094450 3300046477 Bacteria 1800
113 Ga0495664_0290290 3300046477 Bacteria 988
114 Ga0495618_0081778 3300046514 Bacteria 2063
115 Ga0495618_0448692 3300046514 Bacteria 783
116 Ga0495620_0220919 3300046515 Unclassified 725
117 Ga0495628_0127147 3300046516 Unclassified 1952
118 Ga0495630_0043112 3300046517 Bacteria 3370
119 Ga0495630_0106915 3300046517 Bacteria 2119
120 Ga0495630_0124197 3300046517 Bacteria 1959
121 Ga0495630_0218998 3300046517 Bacteria 1453
122 Ga0495630_0256300 3300046517 Unclassified 1337
123 Ga0495630_0440840 3300046517 Unclassified 998
124 Ga0495652_0084649 3300046529 Bacteria 2607
125 Ga0495652_0196276 3300046529 Unclassified 1536
126 Ga0495652_0460850 3300046529 Bacteria 888
127 Ga0495640_0142367 3300046533 Unclassified 1545
128 Ga0495640_0770562 3300046533 Bacteria 575
129 Ga0495586_0016722 3300046535 Bacteria 3902
130 Ga0495586_0038953 3300046535 Unclassified 2554
131 Ga0495587_0308816 3300046536 Unclassified 884
132 Ga0495587_0435309 3300046536 Bacteria 727
133 Ga0495587_0655632 3300046536 Bacteria 576
134 Ga0495634_0023496 3300046642 Bacteria 4332
135 Ga0495635_0097844 3300046663 Bacteria 2006
136 Ga0495659_0494514 3300046664 Unclassified 536
137 Ga0495588_0257306 3300046674 Unclassified 920
138 Ga0495657_0047853 3300046675 Bacteria 2888
139 Ga0495657_0389387 3300046675 Bacteria 821
140 Ga0495599_0348395 3300046678 Bacteria 888
141 Ga0495599_0585739 3300046678 Bacteria 651
142 Ga0495623_0347288 3300046679 Bacteria 809
143 Ga0495646_0072753 3300046680 Bacteria 2021
144 Ga0495647_0123022 3300046681 Unclassified 1093
145 Ga0495658_0013836 3300046683 Bacteria 4113
146 Ga0495658_0019056 3300046683 Bacteria 3577
147 Ga0495613_0004187 3300046689 Bacteria 10794
148 Ga0495613_0022211 3300046689 Bacteria 4728
149 Ga0495613_0269615 3300046689 Bacteria 1184
150 Ga0495613_0614042 3300046689 Bacteria 722
151 Ga0495624_0715585 3300046690 Bacteria 594
152 Ga0495600_0055275 3300046809 Bacteria 2593
153 Ga0495581_0329387 3300047315 Bacteria 892
154 Ga0495604_0047342 3300047317 Bacteria 3349
155 Ga0495604_0309399 3300047317 Unclassified 1059
156 Ga0495674_0069338 3300047319 Bacteria 3049
157 Ga0495674_0259723 3300047319 Bacteria 1427
158 Ga0495674_0647495 3300047319 Bacteria 833
159 Ga0495680_0036257 3300047322 Bacteria 3961
160 Ga0495680_0668380 3300047322 Bacteria 689
161 Ga0495675_0740731 3300047444 Bacteria 548
162 Ga0495684_0007446 3300047471 Bacteria 8479
163 Ga0495684_0354792 3300047471 Bacteria 1040
164 Ga0495684_0704613 3300047471 Unclassified 669
165 Ga0495686_0096186 3300047472 Unclassified 1793
166 Ga0495593_0251654 3300047673 Bacteria 885
167 Ga0495602_0113007 3300048088 Bacteria 2202
168 Ga0495614_0333180 3300048089 Bacteria 705
169 Ga0496102_0000075 3300048905 Bacteria 147013
170 Ga0496102_0906830 3300048905 Unclassified 803
171 Ga0496103_0000107 3300048906 Bacteria 91213
172 Ga0496104_0127538 3300048907 Bacteria 2443
173 Ga0496104_0199469 3300048907 Unclassified 1913
174 Ga0496104_1635488 3300048907 Unclassified 547
175 Ga0496105_0108670 3300048908 Unclassified 2290
176 Ga0496105_0246986 3300048908 Bacteria 1447
177 Ga0496105_0643783 3300048908 Unclassified 818
178 Ga0496108_0335856 3300048911 Bacteria 1318
179 Ga0496109_0051306 3300048912 Bacteria 3758
180 Ga0496109_0211749 3300048912 Unclassified 1823
181 Ga0496109_0336329 3300048912 Bacteria 1426
182 Ga0496110_0171543 3300048913 Unclassified 1968
183 Ga0496110_0225249 3300048913 Unclassified 1705
184 Ga0496111_0206928 3300048914 Bacteria 1458
185 Ga0496111_0540126 3300048914 Unclassified 856
186 Ga0496112_0044372 3300048915 Bacteria 4355
187 Ga0496112_0243879 3300048915 Bacteria 1749
188 Ga0496113_0136041 3300048916 Unclassified 1931
189 Ga0496114_0144595 3300048917 Bacteria 2061
190 Ga0496115_0032886 3300048918 Bacteria 4094
191 Ga0496115_0520370 3300048918 Bacteria 954
192 Ga0496115_0631338 3300048918 Bacteria 849
193 Ga0501031_0000215 3300049568 Bacteria 33032
194 Ga0501031_0054370 3300049568 Bacteria 2609
195 Ga0501031_0103962 3300049568 Archaea 1853
196 Ga0501031_0371234 3300049568 Bacteria 926
197 Ga0501032_0000714 3300049569 Bacteria 27059
198 Ga0501032_0414479 3300049569 Archaea 864
199 Ga0501033_0002383 3300049570 Bacteria 16006
200 Ga0501033_1077051 3300049570 Unclassified 535
201 Ga0501034_0010936 3300049571 Bacteria 9430
202 Ga0501036_0002396 3300049572 Bacteria 14666
203 Ga0501036_0006318 3300049572 Bacteria 9614
204 Ga0501036_0204294 3300049572 Bacteria 1661
205 Ga0501037_0002296 3300049573 Bacteria 13801
206 Ga0501037_0275364 3300049573 Archaea 1173
207 Ga0501038_0011145 3300049574 Bacteria 8210
208 Ga0501038_0067167 3300049574 Bacteria 3051
209 Ga0501038_0100505 3300049574 Bacteria 2409
210 Ga0501039_0004235 3300049575 Bacteria 10801
211 Ga0501039_0023512 3300049575 Bacteria 4728
212 Ga0501039_0099232 3300049575 Bacteria 2272
213 Ga0501040_0003372 3300049576 Bacteria 10315
214 Ga0501040_0011353 3300049576 Bacteria 5830
215 Ga0501040_0024868 3300049576 Bacteria 4023
216 Ga0501041_0004234 3300049577 Bacteria 8307
217 Ga0501041_0005737 3300049577 Bacteria 7253
218 Ga0501041_0061939 3300049577 Bacteria 2290
219 Ga0501042_0003132 3300049578 Bacteria 10305
220 Ga0501042_0017351 3300049578 Bacteria 4963
221 Ga0501043_0037519 3300049579 Bacteria 3811
222 Ga0501043_0056725 3300049579 Bacteria 3076
223 Ga0501043_0106275 3300049579 Bacteria 2205
224 Ga0501046_0010543 3300049580 Bacteria 7928
225 Ga0501046_0029178 3300049580 Bacteria 4486
226 Ga0501046_0182511 3300049580 Bacteria 1568
227 Ga0501046_0281366 3300049580 Unclassified 1218
228 Ga0501047_0008997 3300049581 Bacteria 9427
229 Ga0501047_0187816 3300049581 Bacteria 1931
230 Ga0501047_0327149 3300049581 Archaea 1371
231 Ga0501048_0004781 3300049582 Bacteria 10323
232 Ga0501048_0050093 3300049582 Bacteria 2974
233 Ga0501048_0147582 3300049582 Bacteria 1663
234 Ga0501067_0029617 3300049583 Bacteria 3034
235 Ga0501068_0001944 3300049584 Bacteria 10989
236 Ga0501068_0113572 3300049584 Archaea 1685
237 Ga0501069_0001044 3300049585 Bacteria 13242
238 Ga0501069_0086909 3300049585 Archaea 1765
239 Ga0501070_0003850 3300049586 Bacteria 12944
240 Ga0501070_0221948 3300049586 Bacteria 1550
241 Ga0501071_0000003 3300049587 Bacteria 84019
242 Ga0501071_0005459 3300049587 Bacteria 8175
243 Ga0501071_0105663 3300049587 Bacteria 2078
244 Ga0501072_0004779 3300049588 Bacteria 10315
245 Ga0501072_0009778 3300049588 Bacteria 7290
246 Ga0501072_0029682 3300049588 Bacteria 4272
247 Ga0501072_0117478 3300049588 Bacteria 2119
248 Ga0501072_0326583 3300049588 Bacteria 1219
249 Ga0501073_0005166 3300049589 Bacteria 9788
250 Ga0501073_0335022 3300049589 Archaea 1044
251 Ga0501074_0006167 3300049590 Bacteria 8652
252 Ga0501074_0135065 3300049590 Bacteria 1764
253 Ga0501074_0655442 3300049590 Bacteria 742
254 Ga0501075_0001762 3300049591 Bacteria 14224
255 Ga0501075_0020727 3300049591 Bacteria 4784
256 Ga0501075_0036374 3300049591 Bacteria 3674
257 Ga0501076_0006203 3300049592 Bacteria 8652
258 Ga0501076_0024337 3300049592 Bacteria 4679
259 Ga0501076_0026194 3300049592 Bacteria 4513
260 Ga0501076_0569858 3300049592 Bacteria 934
261 Ga0501076_1200152 3300049592 Bacteria 624
262 Ga0501077_0000093 3300049593 Bacteria 46165
263 Ga0501077_0001987 3300049593 Bacteria 12342
264 Ga0501077_0109310 3300049593 Unclassified 1752
265 Ga0501077_0887483 3300049593 Unclassified 573
266 Ga0501079_0002401 3300049741 Bacteria 13573
267 Ga0501079_0015747 3300049741 Bacteria 5776
268 Ga0501079_0097792 3300049741 Bacteria 2275
269 Ga0501079_0470407 3300049741 Unclassified 987
270 Ga0501080_0006731 3300049742 Bacteria 10352
271 Ga0501080_0220572 3300049742 Archaea 1735
272 Ga0501080_0340413 3300049742 Bacteria 1355
273 Ga0501081_0003356 3300049743 Bacteria 10187
274 Ga0501081_0019800 3300049743 Bacteria 4483
275 Ga0501081_0881572 3300049743 Bacteria 674
276 Ga0501081_1000884 3300049743 Bacteria 632
277 Ga0501083_0000171 3300049744 Bacteria 42410
278 Ga0501083_0148200 3300049744 Archaea 1536
279 Ga0501035_0026530 3300049822 Bacteria 5299
280 Ga0501035_1115635 3300049822 Bacteria 615
281 Ga0501044_0001853 3300049823 Bacteria 24562
282 Ga0501044_0101685 3300049823 Bacteria 2891
283 Ga0501045_0007023 3300049824 Bacteria 7808
284 Ga0501045_0009092 3300049824 Bacteria 6941
285 Ga0501045_0142310 3300049824 Bacteria 1783
286 nmdc:mga05p37_1472238_c1 3300050507 Unclassified 680
287 nmdc:mga0qj67_257382_c1 3300050509 Bacteria 1416
288 nmdc:mga0qj67_93979_c1 3300050509 Bacteria 2412
289 nmdc:mga0n895_8670_c1 3300050512 Bacteria 8829
290 nmdc:mga0rr50_2136_c1 3300050513 Bacteria 11049
291 nmdc:mga0rr50_229036_c1 3300050513 Unclassified 1537
292 nmdc:mga08x19_12256_c1 3300050514 Bacteria 5161
293 nmdc:mga0a205_660_c1 3300050515 Bacteria 27450
294 Ga0495601_0345679 3300053077 Bacteria 967
295 Ga0495612_0073697 3300053078 Bacteria 1427
296 Ga0495612_0100219 3300053078 Unclassified 1233
297 Ga0495612_0146724 3300053078 Bacteria 1025
298 Ga0495612_0329377 3300053078 Unclassified 688
299 Ga0495612_0375599 3300053078 Bacteria 644
300 Ga0495595_0031057 3300053084 Bacteria 2399
301 Ga0495595_0075005 3300053084 Bacteria 1604
302 Ga0495595_0617133 3300053084 Bacteria 555
303 Ga0495619_0281319 3300053085 Bacteria 1153
304 Ga0501084_0000126 3300054114 Bacteria 57470
305 Ga0501084_0000493 3300054114 Bacteria 30265
306 Ga0501084_0012868 3300054114 Bacteria 6931
307 Ga0501082_0001850 3300060353 Bacteria 18632
308 Ga0501082_0005903 3300060353 Bacteria 10618
309 Ga0501082_0010582 3300060353 Bacteria 7939
310 Ga0501082_0342992 3300060353 Bacteria 1302
311 Ga0466962_0210813 3300061719 Unclassified 950
312 Ga0530510_0000611 3300061734 Bacteria 23027
313 Ga0530510_0008054 3300061734 Bacteria 7350
314 Ga0530510_0099500 3300061734 Bacteria 2126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_11412754 Ga0105243_114127542 98
2 3300026067 Ga0207678_11320317 Ga0207678_113203172 98
3 3300005436 Ga0070713_100147422 Ga0070713_1001474222 99
4 3300046517 Ga0495630_0256300 Ga0495630_0256300_835_1191 99
5 3300005435 Ga0070714_100018177 Ga0070714_1000181774 100
6 3300005437 Ga0070710_10005285 Ga0070710_100052854 100
7 3300005439 Ga0070711_100214754 Ga0070711_1002147542 100
8 3300006175 Ga0070712_100035945 Ga0070712_1000359454 100
9 3300025898 Ga0207692_10026581 Ga0207692_100265814 100
10 3300025915 Ga0207693_10003811 Ga0207693_100038117 100
11 3300025929 Ga0207664_10063976 Ga0207664_100639762 100
12 3300035118 Ga0373954_0182328 Ga0373954_0182328_636_995 100
13 3300035410 Ga0373924_0064608 Ga0373924_0064608_470_829 100
14 3300036401 Ga0373937_0153294 Ga0373937_0153294_733_1092 100
15 3300046454 Ga0495592_0152498 Ga0495592_0152498_267_626 100
16 3300046462 Ga0495651_0109794 Ga0495651_0109794_602_961 100
17 3300046463 Ga0495653_0150449 Ga0495653_0150449_1193_1552 100
18 3300046514 Ga0495618_0448692 Ga0495618_0448692_151_510 100
19 3300046516 Ga0495628_0127147 Ga0495628_0127147_1551_1910 100
20 3300046529 Ga0495652_0084649 Ga0495652_0084649_1271_1630 100
21 3300046536 Ga0495587_0655632 Ga0495587_0655632_160_519 100
22 3300046663 Ga0495635_0097844 Ga0495635_0097844_1101_1460 100
23 3300046675 Ga0495657_0047853 Ga0495657_0047853_964_1323 100
24 3300046678 Ga0495599_0348395 Ga0495599_0348395_485_844 100
25 3300046679 Ga0495623_0347288 Ga0495623_0347288_304_663 100
26 3300046680 Ga0495646_0072753 Ga0495646_0072753_211_570 100
27 3300046689 Ga0495613_0614042 Ga0495613_0614042_76_435 100
28 3300046809 Ga0495600_0055275 Ga0495600_0055275_328_687 100
29 3300047317 Ga0495604_0047342 Ga0495604_0047342_2397_2756 100
30 3300047319 Ga0495674_0259723 Ga0495674_0259723_563_922 100
31 3300047322 Ga0495680_0036257 Ga0495680_0036257_2740_3099 100
32 3300047444 Ga0495675_0740731 Ga0495675_0740731_71_430 100
33 3300047673 Ga0495593_0251654 Ga0495593_0251654_300_659 100
34 3300048088 Ga0495602_0113007 Ga0495602_0113007_200_559 100
35 3300053078 Ga0495612_0073697 Ga0495612_0073697_896_1255 100
36 3300053084 Ga0495595_0031057 Ga0495595_0031057_794_1153 100
37 3300046533 Ga0495640_0142367 Ga0495640_0142367_365_724 101
38 3300009098 Ga0105245_10389894 Ga0105245_103898942 105
39 3300009176 Ga0105242_10143718 Ga0105242_101437182 105
40 3300006028 Ga0070717_10011541 Ga0070717_100115418 106
41 3300049568 Ga0501031_0371234 Ga0501031_0371234_136_456 106
42 3300005546 Ga0070696_100500239 Ga0070696_1005002391 107
43 3300039450 Ga0436363_1544713 Ga0436363_1544713_346_696 107
44 3300046460 Ga0495638_0013500 Ga0495638_0013500_3748_4071 107
45 3300005468 Ga0070707_101020013 Ga0070707_1010200131 108
46 3300005719 Ga0068861_102186353 Ga0068861_1021863531 108
47 3300006880 Ga0075429_101976569 Ga0075429_1019765691 108
48 3300009551 Ga0105238_11452118 Ga0105238_114521182 108
49 3300037418 Ga0395900_0810940 Ga0395900_0810940_230_586 108
50 3300037466 Ga0395898_0026435 Ga0395898_0026435_3872_4228 108
51 3300037471 Ga0395905_0286718 Ga0395905_0286718_990_1346 108
52 3300041512 Ga0451853_3329988 Ga0451853_3329988_381_713 108
53 3300042125 Ga0450923_170693 Ga0450923_170693_121_450 108
54 3300042436 Ga0439435_0265825 Ga0439435_0265825_13_342 108
55 3300045976 Ga0466967_0455482 Ga0466967_0455482_78_410 108
56 3300045976 Ga0466967_2237055 Ga0466967_2237055_106_432 108
57 3300047472 Ga0495686_0096186 Ga0495686_0096186_198_524 108
58 3300049568 Ga0501031_0000215 Ga0501031_0000215_4079_4408 108
59 3300049568 Ga0501031_0103962 Ga0501031_0103962_183_548 108
60 3300049569 Ga0501032_0000714 Ga0501032_0000714_13869_14198 108
61 3300049569 Ga0501032_0414479 Ga0501032_0414479_317_682 108
62 3300049570 Ga0501033_0002383 Ga0501033_0002383_12413_12742 108
63 3300049571 Ga0501034_0010936 Ga0501034_0010936_2941_3270 108
64 3300049572 Ga0501036_0002396 Ga0501036_0002396_10305_10670 108
65 3300049572 Ga0501036_0006318 Ga0501036_0006318_3277_3606 108
66 3300049573 Ga0501037_0002296 Ga0501037_0002296_3258_3587 108
67 3300049573 Ga0501037_0275364 Ga0501037_0275364_183_548 108
68 3300049574 Ga0501038_0011145 Ga0501038_0011145_3277_3606 108
69 3300049574 Ga0501038_0100505 Ga0501038_0100505_1548_1913 108
70 3300049575 Ga0501039_0004235 Ga0501039_0004235_6394_6723 108
71 3300049575 Ga0501039_0023512 Ga0501039_0023512_547_912 108
72 3300049576 Ga0501040_0003372 Ga0501040_0003372_6710_7039 108
73 3300049576 Ga0501040_0011353 Ga0501040_0011353_1818_2183 108
74 3300049577 Ga0501041_0004234 Ga0501041_0004234_1583_1948 108
75 3300049577 Ga0501041_0005737 Ga0501041_0005737_4313_4642 108
76 3300049578 Ga0501042_0003132 Ga0501042_0003132_6710_7039 108
77 3300049578 Ga0501042_0017351 Ga0501042_0017351_3016_3381 108
78 3300049579 Ga0501043_0037519 Ga0501043_0037519_2612_2941 108
79 3300049579 Ga0501043_0056725 Ga0501043_0056725_1492_1857 108
80 3300049580 Ga0501046_0010543 Ga0501046_0010543_3277_3606 108
81 3300049580 Ga0501046_0029178 Ga0501046_0029178_311_676 108
82 3300049581 Ga0501047_0008997 Ga0501047_0008997_5822_6151 108
83 3300049581 Ga0501047_0327149 Ga0501047_0327149_824_1189 108
84 3300049582 Ga0501048_0004781 Ga0501048_0004781_6710_7039 108
85 3300049582 Ga0501048_0050093 Ga0501048_0050093_1306_1671 108
86 3300049583 Ga0501067_0029617 Ga0501067_0029617_2550_2915 108
87 3300049584 Ga0501068_0001944 Ga0501068_0001944_4079_4408 108
88 3300049584 Ga0501068_0113572 Ga0501068_0113572_824_1189 108
89 3300049585 Ga0501069_0001044 Ga0501069_0001044_3249_3578 108
90 3300049585 Ga0501069_0086909 Ga0501069_0086909_944_1309 108
91 3300049586 Ga0501070_0003850 Ga0501070_0003850_9339_9668 108
92 3300049587 Ga0501071_0000003 Ga0501071_0000003_78690_79019 108
93 3300049587 Ga0501071_0105663 Ga0501071_0105663_131_496 108
94 3300049588 Ga0501072_0004779 Ga0501072_0004779_6710_7039 108
95 3300049588 Ga0501072_0029682 Ga0501072_0029682_1306_1671 108
96 3300049589 Ga0501073_0005166 Ga0501073_0005166_6198_6527 108
97 3300049589 Ga0501073_0335022 Ga0501073_0335022_497_862 108
98 3300049590 Ga0501074_0006167 Ga0501074_0006167_3277_3606 108
99 3300049590 Ga0501074_0135065 Ga0501074_0135065_94_459 108
100 3300049591 Ga0501075_0001762 Ga0501075_0001762_10619_10948 108
101 3300049591 Ga0501075_0020727 Ga0501075_0020727_2602_2967 108
102 3300049592 Ga0501076_0006203 Ga0501076_0006203_3277_3606 108
103 3300049592 Ga0501076_0026194 Ga0501076_0026194_2929_3294 108
104 3300049593 Ga0501077_0000093 Ga0501077_0000093_42560_42889 108
105 3300049593 Ga0501077_0001987 Ga0501077_0001987_10672_11037 108
106 3300049741 Ga0501079_0002401 Ga0501079_0002401_9968_10297 108
107 3300049741 Ga0501079_0015747 Ga0501079_0015747_3648_4013 108
108 3300049742 Ga0501080_0006731 Ga0501080_0006731_5424_5753 108
109 3300049742 Ga0501080_0220572 Ga0501080_0220572_547_912 108
110 3300049743 Ga0501081_0003356 Ga0501081_0003356_6582_6911 108
111 3300049743 Ga0501081_0019800 Ga0501081_0019800_3802_4167 108
112 3300049744 Ga0501083_0000171 Ga0501083_0000171_3559_3888 108
113 3300049744 Ga0501083_0148200 Ga0501083_0148200_675_1040 108
114 3300049822 Ga0501035_0026530 Ga0501035_0026530_2231_2560 108
115 3300049823 Ga0501044_0001853 Ga0501044_0001853_4973_5302 108
116 3300049823 Ga0501044_0101685 Ga0501044_0101685_944_1309 108
117 3300049824 Ga0501045_0007023 Ga0501045_0007023_3277_3606 108
118 3300049824 Ga0501045_0009092 Ga0501045_0009092_2929_3294 108
119 3300050509 nmdc:mga0qj67_257382_c1 nmdc:mga0qj67_257382_c1_40_369 108
120 3300050513 nmdc:mga0rr50_229036_c1 nmdc:mga0rr50_229036_c1_786_1160 108
121 3300054114 Ga0501084_0000126 Ga0501084_0000126_53865_54194 108
122 3300054114 Ga0501084_0000493 Ga0501084_0000493_15298_15663 108
123 3300060353 Ga0501082_0001850 Ga0501082_0001850_14034_14399 108
124 3300060353 Ga0501082_0005903 Ga0501082_0005903_6582_6911 108
125 3300061734 Ga0530510_0000611 Ga0530510_0000611_3277_3606 108
126 3300061734 Ga0530510_0008054 Ga0530510_0008054_6360_6725 108
127 3300005435 Ga0070714_100730433 Ga0070714_1007304331 109
128 3300005981 Ga0081538_10023782 Ga0081538_100237822 109
129 3300025929 Ga0207664_10667495 Ga0207664_106674952 109
130 3300046477 Ga0495664_0094450 Ga0495664_0094450_218_547 109
131 3300046514 Ga0495618_0081778 Ga0495618_0081778_1124_1453 109
132 3300046675 Ga0495657_0389387 Ga0495657_0389387_57_386 109
133 3300046678 Ga0495599_0585739 Ga0495599_0585739_133_462 109
134 3300047319 Ga0495674_0647495 Ga0495674_0647495_44_373 109
135 3300047471 Ga0495684_0354792 Ga0495684_0354792_685_1014 109
136 3300049568 Ga0501031_0054370 Ga0501031_0054370_1317_1649 109
137 3300049570 Ga0501033_1077051 Ga0501033_1077051_25_357 109
138 3300049572 Ga0501036_0204294 Ga0501036_0204294_148_480 109
139 3300049574 Ga0501038_0067167 Ga0501038_0067167_1034_1366 109
140 3300049575 Ga0501039_0099232 Ga0501039_0099232_408_740 109
141 3300049576 Ga0501040_0024868 Ga0501040_0024868_326_658 109
142 3300049577 Ga0501041_0061939 Ga0501041_0061939_688_1020 109
143 3300049579 Ga0501043_0106275 Ga0501043_0106275_1618_1950 109
144 3300049580 Ga0501046_0182511 Ga0501046_0182511_337_669 109
145 3300049580 Ga0501046_0281366 Ga0501046_0281366_25_357 109
146 3300049581 Ga0501047_0187816 Ga0501047_0187816_435_767 109
147 3300049582 Ga0501048_0147582 Ga0501048_0147582_282_614 109
148 3300049587 Ga0501071_0005459 Ga0501071_0005459_4529_4861 109
149 3300049588 Ga0501072_0009778 Ga0501072_0009778_2425_2757 109
150 3300049590 Ga0501074_0655442 Ga0501074_0655442_281_613 109
151 3300049591 Ga0501075_0036374 Ga0501075_0036374_3318_3650 109
152 3300049592 Ga0501076_0024337 Ga0501076_0024337_3218_3550 109
153 3300049593 Ga0501077_0887483 Ga0501077_0887483_16_348 109
154 3300049741 Ga0501079_0097792 Ga0501079_0097792_1549_1881 109
155 3300049741 Ga0501079_0470407 Ga0501079_0470407_640_972 109
156 3300049742 Ga0501080_0340413 Ga0501080_0340413_121_453 109
157 3300049743 Ga0501081_0881572 Ga0501081_0881572_229_561 109
158 3300049822 Ga0501035_1115635 Ga0501035_1115635_167_499 109
159 3300049824 Ga0501045_0142310 Ga0501045_0142310_1350_1682 109
160 3300053077 Ga0495601_0345679 Ga0495601_0345679_383_712 109
161 3300053078 Ga0495612_0146724 Ga0495612_0146724_68_397 109
162 3300053084 Ga0495595_0075005 Ga0495595_0075005_478_807 109
163 3300053085 Ga0495619_0281319 Ga0495619_0281319_471_800 109
164 3300054114 Ga0501084_0012868 Ga0501084_0012868_436_768 109
165 3300060353 Ga0501082_0010582 Ga0501082_0010582_3214_3546 109
166 3300005343 Ga0070687_101117044 Ga0070687_1011170441 110
167 3300005459 Ga0068867_100673082 Ga0068867_1006730822 110
168 3300005468 Ga0070707_100968237 Ga0070707_1009682371 110
169 3300005546 Ga0070696_100049262 Ga0070696_1000492622 110
170 3300005577 Ga0068857_100401119 Ga0068857_1004011192 110
171 3300005841 Ga0068863_100003581 Ga0068863_1000035814 110
172 3300006852 Ga0075433_10002679 Ga0075433_1000267910 110
173 3300006871 Ga0075434_100013469 Ga0075434_1000134697 110
174 3300006914 Ga0075436_100068083 Ga0075436_1000680832 110
175 3300007076 Ga0075435_100002096 Ga0075435_1000020967 110
176 3300013296 Ga0157374_10965618 Ga0157374_109656182 110
177 3300026088 Ga0207641_10002678 Ga0207641_1000267821 110
178 3300026089 Ga0207648_10607456 Ga0207648_106074561 110
179 3300035171 Ga0373946_0044035 Ga0373946_0044035_671_1006 110
180 3300039450 Ga0436363_0392609 Ga0436363_0392609_252_590 110
181 3300044693 Ga0466961_0228752 Ga0466961_0228752_694_1074 110
182 3300044694 Ga0466963_0000919 Ga0466963_0000919_4927_5307 110
183 3300044842 Ga0466957_0002191 Ga0466957_0002191_4332_4712 110
184 3300045049 Ga0466959_0005650 Ga0466959_0005650_6802_7182 110
185 3300045976 Ga0466967_0008945 Ga0466967_0008945_1743_2123 110
186 3300046459 Ga0495629_0001428 Ga0495629_0001428_16955_17287 110
187 3300046459 Ga0495629_0813275 Ga0495629_0813275_69_401 110
188 3300046517 Ga0495630_0043112 Ga0495630_0043112_864_1196 110
189 3300046517 Ga0495630_0124197 Ga0495630_0124197_1123_1458 110
190 3300046517 Ga0495630_0218998 Ga0495630_0218998_443_775 110
191 3300046533 Ga0495640_0770562 Ga0495640_0770562_53_385 110
192 3300046535 Ga0495586_0038953 Ga0495586_0038953_587_919 110
193 3300046536 Ga0495587_0435309 Ga0495587_0435309_136_468 110
194 3300046642 Ga0495634_0023496 Ga0495634_0023496_2815_3147 110
195 3300046664 Ga0495659_0494514 Ga0495659_0494514_98_436 110
196 3300046674 Ga0495588_0257306 Ga0495588_0257306_301_639 110
197 3300046681 Ga0495647_0123022 Ga0495647_0123022_652_984 110
198 3300046683 Ga0495658_0013836 Ga0495658_0013836_1611_1943 110
199 3300046689 Ga0495613_0022211 Ga0495613_0022211_3193_3525 110
200 3300048089 Ga0495614_0333180 Ga0495614_0333180_275_607 110
201 3300048905 Ga0496102_0000075 Ga0496102_0000075_43956_44288 110
202 3300048906 Ga0496103_0000107 Ga0496103_0000107_738_1070 110
203 3300049588 Ga0501072_0326583 Ga0501072_0326583_500_835 110
204 3300049743 Ga0501081_1000884 Ga0501081_1000884_39_374 110
205 3300050512 nmdc:mga0n895_8670_c1 nmdc:mga0n895_8670_c1_2478_2810 110
206 3300050513 nmdc:mga0rr50_2136_c1 nmdc:mga0rr50_2136_c1_5227_5559 110
207 3300050514 nmdc:mga08x19_12256_c1 nmdc:mga08x19_12256_c1_656_988 110
208 3300050515 nmdc:mga0a205_660_c1 nmdc:mga0a205_660_c1_8212_8544 110
209 3300053078 Ga0495612_0100219 Ga0495612_0100219_43_375 110
210 3300061719 Ga0466962_0210813 Ga0466962_0210813_529_909 110
211 3300005329 Ga0070683_100113241 Ga0070683_1001132414 111
212 3300005435 Ga0070714_100072626 Ga0070714_1000726261 111
213 3300005435 Ga0070714_100155833 Ga0070714_1001558332 111
214 3300005435 Ga0070714_100177299 Ga0070714_1001772992 111
215 3300005435 Ga0070714_100488906 Ga0070714_1004889061 111
216 3300005436 Ga0070713_100495175 Ga0070713_1004951751 111
217 3300005436 Ga0070713_100786486 Ga0070713_1007864862 111
218 3300005458 Ga0070681_10512632 Ga0070681_105126322 111
219 3300005530 Ga0070679_100052095 Ga0070679_1000520953 111
220 3300005535 Ga0070684_100107483 Ga0070684_1001074833 111
221 3300005981 Ga0081538_10001542 Ga0081538_1000154235 111
222 3300005981 Ga0081538_10049655 Ga0081538_100496555 111
223 3300005981 Ga0081538_10180461 Ga0081538_101804611 111
224 3300006028 Ga0070717_10007807 Ga0070717_100078079 111
225 3300006028 Ga0070717_10010637 Ga0070717_100106373 111
226 3300006028 Ga0070717_10011098 Ga0070717_100110988 111
227 3300006028 Ga0070717_10523177 Ga0070717_105231772 111
228 3300006844 Ga0075428_100137354 Ga0075428_1001373542 111
229 3300006844 Ga0075428_100735109 Ga0075428_1007351092 111
230 3300006846 Ga0075430_100000782 Ga0075430_10000078221 111
231 3300006847 Ga0075431_100175321 Ga0075431_1001753212 111
232 3300013105 Ga0157369_10815858 Ga0157369_108158583 111
233 3300013308 Ga0157375_12444711 Ga0157375_124447111 111
234 3300020082 Ga0206353_10058633 Ga0206353_100586332 111
235 3300025928 Ga0207700_10076884 Ga0207700_100768843 111
236 3300025928 Ga0207700_10375101 Ga0207700_103751012 111
237 3300025929 Ga0207664_10000737 Ga0207664_100007375 111
238 3300025929 Ga0207664_10035349 Ga0207664_100353492 111
239 3300025929 Ga0207664_10172379 Ga0207664_101723792 111
240 3300025944 Ga0207661_10093610 Ga0207661_100936103 111
241 3300028800 Ga0265338_10760725 Ga0265338_107607251 111
242 3300031251 Ga0265327_10026016 Ga0265327_100260163 111
243 3300031852 Ga0307410_11192002 Ga0307410_111920022 111
244 3300031995 Ga0307409_101313111 Ga0307409_1013131112 111
245 3300035170 Ga0373943_0088563 Ga0373943_0088563_184_522 111
246 3300035692 Ga0373935_0380866 Ga0373935_0380866_603_941 111
247 3300035725 Ga0373947_0033175 Ga0373947_0033175_2079_2417 111
248 3300037068 Ga0373925_0126650 Ga0373925_0126650_1175_1513 111
249 3300037471 Ga0395905_0832519 Ga0395905_0832519_210_545 111
250 3300037853 Ga0436364_1084351 Ga0436364_1084351_307_654 111
251 3300038443 Ga0395901_0591349 Ga0395901_0591349_714_1049 111
252 3300039437 Ga0436365_0726297 Ga0436365_0726297_654_1001 111
253 3300039438 Ga0436360_1080122 Ga0436360_1080122_30_371 111
254 3300041443 Ga0451789_0161492 Ga0451789_0161492_188_538 111
255 3300044656 Ga0466969_0536310 Ga0466969_0536310_12_359 111
256 3300045976 Ga0466967_0596100 Ga0466967_0596100_93_482 111
257 3300046455 Ga0495603_0256188 Ga0495603_0256188_223_561 111
258 3300046459 Ga0495629_0013037 Ga0495629_0013037_5648_5995 111
259 3300046459 Ga0495629_0323961 Ga0495629_0323961_361_699 111
260 3300046461 Ga0495641_0058622 Ga0495641_0058622_932_1279 111
261 3300046463 Ga0495653_0319392 Ga0495653_0319392_474_830 111
262 3300046472 Ga0495580_0719856 Ga0495580_0719856_64_402 111
263 3300046477 Ga0495664_0290290 Ga0495664_0290290_14_355 111
264 3300046515 Ga0495620_0220919 Ga0495620_0220919_350_712 111
265 3300046517 Ga0495630_0106915 Ga0495630_0106915_456_803 111
266 3300046517 Ga0495630_0440840 Ga0495630_0440840_281_619 111
267 3300046529 Ga0495652_0196276 Ga0495652_0196276_764_1123 111
268 3300046529 Ga0495652_0460850 Ga0495652_0460850_27_371 111
269 3300046535 Ga0495586_0016722 Ga0495586_0016722_274_636 111
270 3300046536 Ga0495587_0308816 Ga0495587_0308816_305_664 111
271 3300046683 Ga0495658_0019056 Ga0495658_0019056_2648_2995 111
272 3300046689 Ga0495613_0004187 Ga0495613_0004187_6562_6909 111
273 3300046689 Ga0495613_0269615 Ga0495613_0269615_623_985 111
274 3300046690 Ga0495624_0715585 Ga0495624_0715585_73_411 111
275 3300047315 Ga0495581_0329387 Ga0495581_0329387_134_487 111
276 3300047317 Ga0495604_0309399 Ga0495604_0309399_626_985 111
277 3300047319 Ga0495674_0069338 Ga0495674_0069338_2302_2661 111
278 3300047322 Ga0495680_0668380 Ga0495680_0668380_241_579 111
279 3300047471 Ga0495684_0007446 Ga0495684_0007446_2434_2781 111
280 3300047471 Ga0495684_0704613 Ga0495684_0704613_198_557 111
281 3300048905 Ga0496102_0906830 Ga0496102_0906830_109_456 111
282 3300048907 Ga0496104_0127538 Ga0496104_0127538_833_1192 111
283 3300048907 Ga0496104_0199469 Ga0496104_0199469_390_770 111
284 3300048907 Ga0496104_1635488 Ga0496104_1635488_85_441 111
285 3300048908 Ga0496105_0108670 Ga0496105_0108670_531_890 111
286 3300048908 Ga0496105_0246986 Ga0496105_0246986_282_662 111
287 3300048908 Ga0496105_0643783 Ga0496105_0643783_311_655 111
288 3300048911 Ga0496108_0335856 Ga0496108_0335856_298_678 111
289 3300048912 Ga0496109_0051306 Ga0496109_0051306_227_571 111
290 3300048912 Ga0496109_0211749 Ga0496109_0211749_1285_1665 111
291 3300048912 Ga0496109_0336329 Ga0496109_0336329_60_419 111
292 3300048913 Ga0496110_0171543 Ga0496110_0171543_40_420 111
293 3300048913 Ga0496110_0225249 Ga0496110_0225249_1191_1538 111
294 3300048914 Ga0496111_0206928 Ga0496111_0206928_134_514 111
295 3300048914 Ga0496111_0540126 Ga0496111_0540126_173_520 111
296 3300048915 Ga0496112_0044372 Ga0496112_0044372_1181_1540 111
297 3300048915 Ga0496112_0243879 Ga0496112_0243879_539_886 111
298 3300048916 Ga0496113_0136041 Ga0496113_0136041_1075_1434 111
299 3300048917 Ga0496114_0144595 Ga0496114_0144595_1219_1566 111
300 3300048918 Ga0496115_0032886 Ga0496115_0032886_3400_3747 111
301 3300048918 Ga0496115_0520370 Ga0496115_0520370_147_506 111
302 3300048918 Ga0496115_0631338 Ga0496115_0631338_334_714 111
303 3300049586 Ga0501070_0221948 Ga0501070_0221948_680_1042 111
304 3300049588 Ga0501072_0117478 Ga0501072_0117478_401_742 111
305 3300049592 Ga0501076_0569858 Ga0501076_0569858_536_892 111
306 3300049592 Ga0501076_1200152 Ga0501076_1200152_152_493 111
307 3300049593 Ga0501077_0109310 Ga0501077_0109310_1176_1517 111
308 3300050507 nmdc:mga05p37_1472238_c1 nmdc:mga05p37_1472238_c1_106_447 111
309 3300050509 nmdc:mga0qj67_93979_c1 nmdc:mga0qj67_93979_c1_273_614 111
310 3300053078 Ga0495612_0329377 Ga0495612_0329377_201_560 111
311 3300053078 Ga0495612_0375599 Ga0495612_0375599_285_626 111
312 3300053084 Ga0495595_0617133 Ga0495595_0617133_129_467 111
313 3300060353 Ga0501082_0342992 Ga0501082_0342992_403_744 111
314 3300061734 Ga0530510_0099500 Ga0530510_0099500_1742_2083 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

116

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

10

117

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.7912 5 109
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7856 5 109
7muy-assembly1.cif.gz_KF reconstruction of the legionella pneumophila dot/icm t4ss 3dva map 5 0.7814 83 106
5qu1-assembly2.cif.gz_B crystal structure of the monomeric human nck sh3.1 domain, triclinic, 1.08a 0.7801 83 106
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.78 4 108
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8442 62 111 3.30.720.110
4rt5B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8119 65 107 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8068 63 107 3.30.720.110
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.788 1 108 3.10.180.10
2rbbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7735 5 109 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A835LPB9-F1-model_v4 Lactoylglutathione lyase 0.8641 62 110 GO:0004462
GO:0005737
GO:0019243
AF-A0A1F3Q5J0-F1-model_v4 deleted 0.864 3 109
AF-A0A534AGY9-F1-model_v4 VOC family protein 0.8572 64 110
AF-A0A2E0USP6-F1-model_v4 VOC domain-containing protein 0.8481 6 107
AF-A0A518DVM0-F1-model_v4 Glyoxalase-like domain protein 0.8459 5 107

Feature Viewer

pLDDT pTM Quality
90.44 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map