F402815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 226 | 293 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0054244|Ga0466970_0054244_13_951 |
| Length | 312 |
| Sequence | MSARAKSHEVSSEKELSRVAATHTGIHERLAHQDAGRAPAFNPRRTLPLRVEFVRQLKRRRTQITFGLLLVLPIIIAIAFKVGGGAGSDAPQLVGLANSGGFNFALFTEFASVGFLLVVVVALFCGDTVASEAGWSSLRYLLAQPVPRARLLKQKLIVAGTLCVAANFLLPVWAFVVGGTFFGWHPARSPIGGSFGSGPSVQRLGIIVIYVCIQLLVVASLAFLLSVSVDNPLGAVGGAVMLHVVSSILDQITALDPYRKFLPTHFSYAWVDTLSTPIRWDDMFRGTGVALVYAAVFFGYAWLRFDRKDVTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 2 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 3 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 4 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 5 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 6 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 7 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 8 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 9 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 10 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 11 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 12 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 13 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 14 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 130 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 131 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 193 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 194 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 195 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 196 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 219 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 220 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 221 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 222 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 223 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 224 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 225 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 226 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.31 |
| Metatranscriptomes | 0 |
| Isolates | 6.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 1.59 |
| Rhizoplane | 6.69 |
| Rhizosphere | 84.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10023163 | 3300002067 | Bacteria | 1885 |
| 2 | rootH1_10272836 | 3300003323 | Bacteria | 1353 |
| 3 | Ga0070658_10030685 | 3300005327 | Bacteria | 4317 |
| 4 | Ga0070683_100058149 | 3300005329 | Bacteria | 3593 |
| 5 | Ga0068869_100023739 | 3300005334 | Bacteria | 4241 |
| 6 | Ga0070666_10104436 | 3300005335 | Bacteria | 1955 |
| 7 | Ga0068868_100005680 | 3300005338 | Bacteria | 8783 |
| 8 | Ga0070660_100086197 | 3300005339 | Bacteria | 2471 |
| 9 | Ga0070661_100368113 | 3300005344 | Bacteria | 1131 |
| 10 | Ga0070674_100132062 | 3300005356 | Bacteria | 1863 |
| 11 | Ga0070673_100105535 | 3300005364 | Bacteria | 2328 |
| 12 | Ga0070688_100412036 | 3300005365 | Bacteria | 1002 |
| 13 | Ga0070659_100020927 | 3300005366 | Bacteria | 4974 |
| 14 | Ga0070667_100069536 | 3300005367 | Bacteria | 2996 |
| 15 | Ga0070667_100212292 | 3300005367 | Bacteria | 1721 |
| 16 | Ga0070709_10121111 | 3300005434 | Bacteria | 1773 |
| 17 | Ga0070714_100000018 | 3300005435 | Bacteria | 173975 |
| 18 | Ga0070714_100054831 | 3300005435 | Bacteria | 3406 |
| 19 | Ga0070714_100085001 | 3300005435 | Bacteria | 2762 |
| 20 | Ga0070714_100455621 | 3300005435 | Bacteria | 1215 |
| 21 | Ga0070713_100150221 | 3300005436 | Bacteria | 2071 |
| 22 | Ga0070711_100065082 | 3300005439 | Bacteria | 2548 |
| 23 | Ga0070711_100261286 | 3300005439 | Bacteria | 1362 |
| 24 | Ga0070694_100011216 | 3300005444 | Bacteria | 5549 |
| 25 | Ga0070663_100011335 | 3300005455 | Bacteria | 5592 |
| 26 | Ga0070678_100044442 | 3300005456 | Bacteria | 3172 |
| 27 | Ga0070707_100343028 | 3300005468 | Bacteria | 1451 |
| 28 | Ga0070679_100530746 | 3300005530 | Bacteria | 1121 |
| 29 | Ga0068853_100092664 | 3300005539 | Bacteria | 2658 |
| 30 | Ga0070672_100250117 | 3300005543 | Bacteria | 1493 |
| 31 | Ga0070686_100012789 | 3300005544 | Bacteria | 4790 |
| 32 | Ga0070695_100013451 | 3300005545 | Bacteria | 4918 |
| 33 | Ga0070696_100023965 | 3300005546 | Bacteria | 4147 |
| 34 | Ga0070693_100010482 | 3300005547 | Bacteria | 4645 |
| 35 | Ga0070665_100360823 | 3300005548 | Bacteria | 1459 |
| 36 | Ga0070704_100051836 | 3300005549 | Bacteria | 2892 |
| 37 | Ga0068855_100013787 | 3300005563 | Bacteria | 9744 |
| 38 | Ga0068855_100105095 | 3300005563 | Bacteria | 3247 |
| 39 | Ga0068857_100084540 | 3300005577 | Bacteria | 2836 |
| 40 | Ga0068856_100010978 | 3300005614 | Bacteria | 8795 |
| 41 | Ga0068856_100033558 | 3300005614 | Bacteria | 5026 |
| 42 | Ga0068856_100227069 | 3300005614 | Bacteria | 1882 |
| 43 | Ga0068852_100014264 | 3300005616 | Bacteria | 6109 |
| 44 | Ga0068852_100425645 | 3300005616 | Bacteria | 1310 |
| 45 | Ga0068859_100131707 | 3300005617 | Bacteria | 2572 |
| 46 | Ga0068866_10198203 | 3300005718 | Bacteria | 1198 |
| 47 | Ga0068861_100399387 | 3300005719 | Bacteria | 1219 |
| 48 | Ga0068851_10125556 | 3300005834 | Bacteria | 1383 |
| 49 | Ga0068860_100249072 | 3300005843 | Bacteria | 1729 |
| 50 | Ga0070717_10027692 | 3300006028 | Bacteria | 4530 |
| 51 | Ga0070715_10012272 | 3300006163 | Bacteria | 3113 |
| 52 | Ga0070716_100123144 | 3300006173 | Bacteria | 1627 |
| 53 | Ga0070712_100015408 | 3300006175 | Bacteria | 4924 |
| 54 | Ga0070712_100049471 | 3300006175 | Bacteria | 2919 |
| 55 | Ga0070712_100139926 | 3300006175 | Bacteria | 1845 |
| 56 | Ga0097621_100099176 | 3300006237 | Bacteria | 2448 |
| 57 | Ga0075433_10149040 | 3300006852 | Bacteria | 2081 |
| 58 | Ga0075434_100222913 | 3300006871 | Bacteria | 1905 |
| 59 | Ga0097620_100131697 | 3300006931 | Bacteria | 2572 |
| 60 | Ga0105240_10040929 | 3300009093 | Bacteria | 5920 |
| 61 | Ga0105240_10083142 | 3300009093 | Bacteria | 3929 |
| 62 | Ga0105240_10338775 | 3300009093 | Bacteria | 1709 |
| 63 | Ga0111539_10179854 | 3300009094 | Bacteria | 2471 |
| 64 | Ga0105245_10057999 | 3300009098 | Bacteria | 3484 |
| 65 | Ga0105247_10018464 | 3300009101 | Bacteria | 4183 |
| 66 | Ga0105243_10024631 | 3300009148 | Bacteria | 4591 |
| 67 | Ga0105241_10047687 | 3300009174 | Bacteria | 3258 |
| 68 | Ga0105241_10057288 | 3300009174 | Bacteria | 2989 |
| 69 | Ga0105248_10253696 | 3300009177 | Bacteria | 1980 |
| 70 | Ga0105237_10070102 | 3300009545 | Bacteria | 3501 |
| 71 | Ga0105237_10102890 | 3300009545 | Bacteria | 2848 |
| 72 | Ga0105237_10181646 | 3300009545 | Bacteria | 2104 |
| 73 | Ga0105238_10064972 | 3300009551 | Bacteria | 3650 |
| 74 | Ga0105238_10286101 | 3300009551 | Bacteria | 1630 |
| 75 | Ga0105238_10310025 | 3300009551 | Bacteria | 1563 |
| 76 | Ga0105249_10019303 | 3300009553 | Bacteria | 6079 |
| 77 | Ga0105249_10035459 | 3300009553 | Bacteria | 4524 |
| 78 | Ga0105239_10006071 | 3300010375 | Bacteria | 14067 |
| 79 | Ga0105239_10074139 | 3300010375 | Bacteria | 3742 |
| 80 | Ga0105239_10205381 | 3300010375 | Bacteria | 2208 |
| 81 | Ga0157370_10016985 | 3300013104 | Bacteria | 7355 |
| 82 | Ga0157369_10271215 | 3300013105 | Bacteria | 1768 |
| 83 | Ga0157378_10081438 | 3300013297 | Bacteria | 2926 |
| 84 | Ga0163162_10024677 | 3300013306 | Bacteria | 5938 |
| 85 | Ga0157372_10116921 | 3300013307 | Bacteria | 3058 |
| 86 | Ga0157380_10012958 | 3300014326 | Bacteria | 6060 |
| 87 | Ga0157377_10005939 | 3300014745 | Bacteria | 5780 |
| 88 | Ga0157379_10011013 | 3300014968 | Bacteria | 7885 |
| 89 | Ga0157376_10107664 | 3300014969 | Bacteria | 2447 |
| 90 | Ga0163161_10017589 | 3300017792 | Bacteria | 5005 |
| 91 | Ga0207688_10000555 | 3300025901 | Bacteria | 18211 |
| 92 | Ga0207680_10147112 | 3300025903 | Bacteria | 1567 |
| 93 | Ga0207647_10026129 | 3300025904 | Bacteria | 3824 |
| 94 | Ga0207647_10036174 | 3300025904 | Bacteria | 3139 |
| 95 | Ga0207643_10027321 | 3300025908 | Bacteria | 3163 |
| 96 | Ga0207705_10097488 | 3300025909 | Bacteria | 2159 |
| 97 | Ga0207654_10107789 | 3300025911 | Bacteria | 1727 |
| 98 | Ga0207695_10264830 | 3300025913 | Bacteria | 1615 |
| 99 | Ga0207671_10059831 | 3300025914 | Bacteria | 2825 |
| 100 | Ga0207693_10014077 | 3300025915 | Bacteria | 6440 |
| 101 | Ga0207693_10072630 | 3300025915 | Bacteria | 2694 |
| 102 | Ga0207662_10088653 | 3300025918 | Bacteria | 1900 |
| 103 | Ga0207657_10003612 | 3300025919 | Bacteria | 16487 |
| 104 | Ga0207694_10081272 | 3300025924 | Bacteria | 2545 |
| 105 | Ga0207687_10010959 | 3300025927 | Bacteria | 5924 |
| 106 | Ga0207700_10150883 | 3300025928 | Bacteria | 1920 |
| 107 | Ga0207700_10242110 | 3300025928 | Bacteria | 1538 |
| 108 | Ga0207664_10000003 | 3300025929 | Bacteria | 510966 |
| 109 | Ga0207664_10006053 | 3300025929 | Bacteria | 8285 |
| 110 | Ga0207704_10151124 | 3300025938 | Bacteria | 1638 |
| 111 | Ga0207665_10000738 | 3300025939 | Bacteria | 22007 |
| 112 | Ga0207665_10156646 | 3300025939 | Bacteria | 1635 |
| 113 | Ga0207689_10009684 | 3300025942 | Bacteria | 8298 |
| 114 | Ga0207661_10021475 | 3300025944 | Bacteria | 4837 |
| 115 | Ga0207667_10050156 | 3300025949 | Bacteria | 4405 |
| 116 | Ga0207667_10062966 | 3300025949 | Bacteria | 3877 |
| 117 | Ga0207667_10126266 | 3300025949 | Bacteria | 2635 |
| 118 | Ga0207651_10150455 | 3300025960 | Bacteria | 1811 |
| 119 | Ga0207712_10017535 | 3300025961 | Bacteria | 4652 |
| 120 | Ga0207712_10529991 | 3300025961 | Bacteria | 1011 |
| 121 | Ga0207640_10071130 | 3300025981 | Bacteria | 2342 |
| 122 | Ga0207658_10138816 | 3300025986 | Bacteria | 1964 |
| 123 | Ga0207677_10064310 | 3300026023 | Bacteria | 2554 |
| 124 | Ga0207639_10087656 | 3300026041 | Bacteria | 2482 |
| 125 | Ga0207678_10006594 | 3300026067 | Bacteria | 10295 |
| 126 | Ga0207702_10004368 | 3300026078 | Bacteria | 12604 |
| 127 | Ga0207702_10196752 | 3300026078 | Bacteria | 1866 |
| 128 | Ga0207702_10204584 | 3300026078 | Bacteria | 1832 |
| 129 | Ga0207674_10043118 | 3300026116 | Bacteria | 4654 |
| 130 | Ga0207675_100016686 | 3300026118 | Bacteria | 6857 |
| 131 | Ga0207683_10003061 | 3300026121 | Bacteria | 14623 |
| 132 | Ga0207698_10004406 | 3300026142 | Bacteria | 8577 |
| 133 | Ga0207698_10073777 | 3300026142 | Bacteria | 2718 |
| 134 | Ga0207698_10350934 | 3300026142 | Bacteria | 1393 |
| 135 | Ga0268266_10200530 | 3300028379 | Bacteria | 1826 |
| 136 | Ga0265337_1001006 | 3300028556 | Bacteria | 14694 |
| 137 | Ga0265326_10000775 | 3300028558 | Bacteria | 11866 |
| 138 | Ga0265334_10001171 | 3300028573 | Bacteria | 12838 |
| 139 | Ga0265323_10021836 | 3300028653 | Bacteria | 2449 |
| 140 | Ga0265336_10001306 | 3300028666 | Bacteria | 11657 |
| 141 | Ga0265338_10001371 | 3300028800 | Bacteria | 39597 |
| 142 | Ga0265338_10005138 | 3300028800 | Bacteria | 17234 |
| 143 | Ga0265324_10002104 | 3300029957 | Bacteria | 10517 |
| 144 | Ga0265332_10001400 | 3300031238 | Bacteria | 13603 |
| 145 | Ga0265320_10002520 | 3300031240 | Bacteria | 12732 |
| 146 | Ga0265325_10018211 | 3300031241 | Bacteria | 3893 |
| 147 | Ga0265313_10005093 | 3300031595 | Bacteria | 9789 |
| 148 | Ga0265314_10015544 | 3300031711 | Bacteria | 6038 |
| 149 | Ga0316214_1001935 | 3300033545 | Bacteria | 2502 |
| 150 | Ga0316212_1003204 | 3300033547 | Bacteria | 2354 |
| 151 | Ga0373940_0002251 | 3300035088 | Bacteria | 3714 |
| 152 | Ga0373951_0011157 | 3300035091 | Bacteria | 2016 |
| 153 | Ga0373952_0003851 | 3300035092 | Bacteria | 2719 |
| 154 | Ga0436364_0729892 | 3300037853 | Bacteria | 5184 |
| 155 | Ga0466969_0008817 | 3300044656 | Bacteria | 5347 |
| 156 | Ga0466972_0011748 | 3300044658 | Bacteria | 4398 |
| 157 | Ga0466972_0155888 | 3300044658 | Bacteria | 1073 |
| 158 | Ga0466966_0020481 | 3300044684 | Bacteria | 4348 |
| 159 | Ga0466966_0036332 | 3300044684 | Bacteria | 3181 |
| 160 | Ga0466966_0153770 | 3300044684 | Bacteria | 1402 |
| 161 | Ga0466961_0025733 | 3300044693 | Bacteria | 3783 |
| 162 | Ga0466961_0045034 | 3300044693 | Bacteria | 2823 |
| 163 | Ga0466961_0080573 | 3300044693 | Bacteria | 2061 |
| 164 | Ga0466961_0213923 | 3300044693 | Bacteria | 1189 |
| 165 | Ga0466961_0233650 | 3300044693 | Bacteria | 1131 |
| 166 | Ga0466963_0026471 | 3300044694 | Bacteria | 3710 |
| 167 | Ga0466963_0037616 | 3300044694 | Bacteria | 3161 |
| 168 | Ga0466963_0043801 | 3300044694 | Bacteria | 2944 |
| 169 | Ga0466963_0172640 | 3300044694 | Bacteria | 1507 |
| 170 | Ga0466963_0177193 | 3300044694 | Bacteria | 1488 |
| 171 | Ga0466963_0257746 | 3300044694 | Bacteria | 1224 |
| 172 | Ga0466963_0329099 | 3300044694 | Bacteria | 1075 |
| 173 | Ga0466963_0332692 | 3300044694 | Bacteria | 1069 |
| 174 | Ga0466971_0002877 | 3300044719 | Bacteria | 7301 |
| 175 | Ga0466971_0008953 | 3300044719 | Bacteria | 4375 |
| 176 | Ga0466971_0070774 | 3300044719 | Bacteria | 1584 |
| 177 | Ga0466968_0041512 | 3300044735 | Bacteria | 1942 |
| 178 | Ga0466970_0029491 | 3300044765 | Bacteria | 2888 |
| 179 | Ga0466970_0054244 | 3300044765 | Bacteria | 2141 |
| 180 | Ga0466957_0021527 | 3300044842 | Bacteria | 3800 |
| 181 | Ga0466957_0068642 | 3300044842 | Bacteria | 2189 |
| 182 | Ga0466957_0196833 | 3300044842 | Bacteria | 1322 |
| 183 | Ga0466959_0144974 | 3300045049 | Bacteria | 1676 |
| 184 | Ga0466959_0214853 | 3300045049 | Bacteria | 1335 |
| 185 | Ga0466958_0038601 | 3300045836 | Bacteria | 2866 |
| 186 | Ga0466967_0006625 | 3300045976 | Bacteria | 8233 |
| 187 | Ga0466967_0026393 | 3300045976 | Bacteria | 4812 |
| 188 | Ga0466967_0032872 | 3300045976 | Bacteria | 4386 |
| 189 | Ga0466967_0054597 | 3300045976 | Bacteria | 3517 |
| 190 | Ga0466967_0056253 | 3300045976 | Bacteria | 3468 |
| 191 | Ga0466967_0073468 | 3300045976 | Bacteria | 3068 |
| 192 | Ga0466967_0078915 | 3300045976 | Bacteria | 2967 |
| 193 | Ga0466967_0084783 | 3300045976 | Bacteria | 2867 |
| 194 | Ga0466967_0087452 | 3300045976 | Bacteria | 2825 |
| 195 | Ga0466967_0103963 | 3300045976 | Bacteria | 2599 |
| 196 | Ga0466967_0270795 | 3300045976 | Bacteria | 1627 |
| 197 | Ga0466967_0716583 | 3300045976 | Bacteria | 991 |
| 198 | Ga0495592_0000338 | 3300046454 | Bacteria | 38538 |
| 199 | Ga0495641_0039192 | 3300046461 | Bacteria | 2211 |
| 200 | Ga0495653_0009836 | 3300046463 | Bacteria | 7819 |
| 201 | Ga0495580_0018856 | 3300046472 | Bacteria | 5133 |
| 202 | Ga0495662_0004449 | 3300046476 | Bacteria | 7039 |
| 203 | Ga0495662_0046548 | 3300046476 | Bacteria | 2095 |
| 204 | Ga0495664_0052209 | 3300046477 | Bacteria | 2428 |
| 205 | Ga0495608_0002874 | 3300046511 | Bacteria | 12327 |
| 206 | Ga0495618_0196899 | 3300046514 | Bacteria | 1276 |
| 207 | Ga0495628_0023303 | 3300046516 | Bacteria | 5082 |
| 208 | Ga0495628_0041387 | 3300046516 | Bacteria | 3678 |
| 209 | Ga0495648_0003388 | 3300046524 | Bacteria | 14013 |
| 210 | Ga0495666_0001561 | 3300046526 | Bacteria | 11262 |
| 211 | Ga0495652_0044895 | 3300046529 | Bacteria | 3803 |
| 212 | Ga0495665_0001780 | 3300046531 | Bacteria | 11590 |
| 213 | Ga0495640_0009593 | 3300046533 | Bacteria | 7527 |
| 214 | Ga0495640_0019176 | 3300046533 | Bacteria | 5052 |
| 215 | Ga0495586_0060455 | 3300046535 | Bacteria | 2060 |
| 216 | Ga0495587_0232594 | 3300046536 | Bacteria | 1038 |
| 217 | Ga0495645_0068091 | 3300046543 | Bacteria | 2570 |
| 218 | Ga0495667_0001521 | 3300046559 | Bacteria | 15325 |
| 219 | Ga0495667_0284402 | 3300046559 | Bacteria | 1050 |
| 220 | Ga0495634_0123489 | 3300046642 | Bacteria | 1656 |
| 221 | Ga0495611_0066943 | 3300046648 | Bacteria | 1639 |
| 222 | Ga0495657_0023332 | 3300046675 | Bacteria | 4421 |
| 223 | Ga0495646_0014330 | 3300046680 | Bacteria | 5044 |
| 224 | Ga0495613_0026007 | 3300046689 | Bacteria | 4360 |
| 225 | Ga0495581_0007687 | 3300047315 | Bacteria | 6236 |
| 226 | Ga0495604_0004912 | 3300047317 | Bacteria | 10599 |
| 227 | Ga0495604_0025914 | 3300047317 | Bacteria | 4669 |
| 228 | Ga0495674_0018852 | 3300047319 | Bacteria | 6417 |
| 229 | Ga0495675_0006296 | 3300047444 | Bacteria | 7267 |
| 230 | Ga0495675_0226768 | 3300047444 | Bacteria | 1128 |
| 231 | Ga0495593_0014505 | 3300047673 | Bacteria | 4479 |
| 232 | Ga0495602_0174657 | 3300048088 | Bacteria | 1663 |
| 233 | Ga0496100_0359812 | 3300048903 | Bacteria | 1101 |
| 234 | Ga0496101_0129512 | 3300048904 | Bacteria | 1915 |
| 235 | Ga0496102_0002945 | 3300048905 | Bacteria | 14442 |
| 236 | Ga0496102_0027339 | 3300048905 | Bacteria | 5095 |
| 237 | Ga0496102_0118285 | 3300048905 | Bacteria | 2473 |
| 238 | Ga0496103_0033120 | 3300048906 | Bacteria | 3156 |
| 239 | Ga0496103_0037287 | 3300048906 | Bacteria | 2978 |
| 240 | Ga0496104_0094350 | 3300048907 | Bacteria | 2862 |
| 241 | Ga0496105_0227314 | 3300048908 | Bacteria | 1517 |
| 242 | Ga0496106_0014208 | 3300048909 | Bacteria | 5880 |
| 243 | Ga0496107_0013942 | 3300048910 | Bacteria | 5622 |
| 244 | Ga0496108_0012355 | 3300048911 | Bacteria | 6948 |
| 245 | Ga0496108_0018475 | 3300048911 | Bacteria | 5708 |
| 246 | Ga0496109_0030496 | 3300048912 | Bacteria | 4833 |
| 247 | Ga0496109_0169852 | 3300048912 | Bacteria | 2045 |
| 248 | Ga0496110_0203818 | 3300048913 | Bacteria | 1797 |
| 249 | Ga0496111_0007235 | 3300048914 | Bacteria | 7260 |
| 250 | Ga0496112_0030495 | 3300048915 | Bacteria | 5219 |
| 251 | Ga0496113_0133662 | 3300048916 | Bacteria | 1948 |
| 252 | Ga0496114_0026772 | 3300048917 | Bacteria | 4723 |
| 253 | Ga0496115_0022198 | 3300048918 | Bacteria | 4914 |
| 254 | Ga0496116_0000678 | 3300048919 | Bacteria | 44229 |
| 255 | Ga0496117_0002351 | 3300048920 | Bacteria | 24169 |
| 256 | Ga0496118_0010040 | 3300048921 | Bacteria | 9437 |
| 257 | Ga0496119_0017418 | 3300048922 | Bacteria | 5404 |
| 258 | Ga0496120_0003348 | 3300048923 | Bacteria | 14718 |
| 259 | Ga0496121_0015520 | 3300048924 | Bacteria | 7972 |
| 260 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 261 | Ga0496126_0070176 | 3300048929 | Bacteria | 3122 |
| 262 | Ga0496126_0231439 | 3300048929 | Bacteria | 1548 |
| 263 | Ga0496126_0407593 | 3300048929 | Bacteria | 1101 |
| 264 | Ga0501032_0147798 | 3300049569 | Bacteria | 1546 |
| 265 | Ga0501033_0037687 | 3300049570 | Bacteria | 3618 |
| 266 | Ga0501034_0027791 | 3300049571 | Bacteria | 5752 |
| 267 | Ga0501034_0063066 | 3300049571 | Bacteria | 3720 |
| 268 | Ga0501034_0098568 | 3300049571 | Bacteria | 2918 |
| 269 | Ga0501036_0001729 | 3300049572 | Bacteria | 16972 |
| 270 | Ga0501037_0021437 | 3300049573 | Bacteria | 4775 |
| 271 | Ga0501038_0008863 | 3300049574 | Bacteria | 9232 |
| 272 | Ga0501038_0017010 | 3300049574 | Bacteria | 6580 |
| 273 | Ga0501042_0005531 | 3300049578 | Bacteria | 8142 |
| 274 | Ga0501042_0080525 | 3300049578 | Bacteria | 2333 |
| 275 | Ga0501043_0003702 | 3300049579 | Bacteria | 12561 |
| 276 | Ga0501047_0000098 | 3300049581 | Bacteria | 106464 |
| 277 | Ga0501047_0010487 | 3300049581 | Bacteria | 8771 |
| 278 | Ga0501047_0066537 | 3300049581 | Bacteria | 3473 |
| 279 | Ga0501048_0009101 | 3300049582 | Bacteria | 7475 |
| 280 | Ga0501073_0195932 | 3300049589 | Bacteria | 1397 |
| 281 | Ga0501074_0002292 | 3300049590 | Bacteria | 13306 |
| 282 | Ga0501076_0272863 | 3300049592 | Bacteria | 1385 |
| 283 | Ga0501035_0010240 | 3300049822 | Bacteria | 8699 |
| 284 | Ga0501044_0007995 | 3300049823 | Bacteria | 11620 |
| 285 | Ga0501044_0022473 | 3300049823 | Bacteria | 6719 |
| 286 | Ga0501044_0247654 | 3300049823 | Bacteria | 1724 |
| 287 | Ga0501044_0254886 | 3300049823 | Bacteria | 1694 |
| 288 | nmdc:mga0n895_542892_c1 | 3300050512 | Bacteria | 1169 |
| 289 | nmdc:mga08x19_36145_c1 | 3300050514 | Bacteria | 3127 |
| 290 | Ga0495601_0002792 | 3300053077 | Bacteria | 9920 |
| 291 | Ga0495619_0179596 | 3300053085 | Bacteria | 1464 |
| 292 | Ga0500573_0267778 | 3300053140 | Bacteria | 871 |
| 293 | Ga0466962_0009516 | 3300061719 | Bacteria | 4660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0147798 | Ga0501032_0147798_754_1533 | 248 |
| 2 | 3300047444 | Ga0495675_0226768 | Ga0495675_0226768_321_1073 | 249 |
| 3 | 3300005435 | Ga0070714_100085001 | Ga0070714_1000850013 | 250 |
| 4 | 3300005435 | Ga0070714_100455621 | Ga0070714_1004556211 | 250 |
| 5 | 3300005436 | Ga0070713_100150221 | Ga0070713_1001502212 | 250 |
| 6 | 3300006173 | Ga0070716_100123144 | Ga0070716_1001231441 | 250 |
| 7 | 3300006175 | Ga0070712_100049471 | Ga0070712_1000494712 | 250 |
| 8 | 3300006175 | Ga0070712_100139926 | Ga0070712_1001399262 | 250 |
| 9 | 3300025915 | Ga0207693_10072630 | Ga0207693_100726302 | 250 |
| 10 | 3300025929 | Ga0207664_10006053 | Ga0207664_100060532 | 250 |
| 11 | 3300025939 | Ga0207665_10156646 | Ga0207665_101566462 | 250 |
| 12 | 3300053140 | Ga0500573_0267778 | Ga0500573_0267778_42_839 | 255 |
| 13 | 3300046559 | Ga0495667_0284402 | Ga0495667_0284402_134_1012 | 259 |
| 14 | 3300005548 | Ga0070665_100360823 | Ga0070665_1003608232 | 260 |
| 15 | 3300046463 | Ga0495653_0009836 | Ga0495653_0009836_4065_4955 | 260 |
| 16 | 3300046472 | Ga0495580_0018856 | Ga0495580_0018856_4133_5023 | 260 |
| 17 | 3300046531 | Ga0495665_0001780 | Ga0495665_0001780_7102_7992 | 260 |
| 18 | 3300046533 | Ga0495640_0019176 | Ga0495640_0019176_2778_3668 | 260 |
| 19 | 3300046675 | Ga0495657_0023332 | Ga0495657_0023332_1038_1928 | 260 |
| 20 | 3300046689 | Ga0495613_0026007 | Ga0495613_0026007_910_1800 | 260 |
| 21 | 3300047315 | Ga0495581_0007687 | Ga0495581_0007687_4027_4917 | 260 |
| 22 | 3300046454 | Ga0495592_0000338 | Ga0495592_0000338_128_1018 | 261 |
| 23 | 3300046476 | Ga0495662_0004449 | Ga0495662_0004449_2977_3867 | 261 |
| 24 | 3300046477 | Ga0495664_0052209 | Ga0495664_0052209_154_1044 | 261 |
| 25 | 3300046511 | Ga0495608_0002874 | Ga0495608_0002874_6358_7248 | 261 |
| 26 | 3300046514 | Ga0495618_0196899 | Ga0495618_0196899_273_1163 | 261 |
| 27 | 3300046516 | Ga0495628_0023303 | Ga0495628_0023303_4062_4952 | 261 |
| 28 | 3300046526 | Ga0495666_0001561 | Ga0495666_0001561_5656_6546 | 261 |
| 29 | 3300046535 | Ga0495586_0060455 | Ga0495586_0060455_110_1000 | 261 |
| 30 | 3300046536 | Ga0495587_0232594 | Ga0495587_0232594_11_901 | 261 |
| 31 | 3300046543 | Ga0495645_0068091 | Ga0495645_0068091_1422_2312 | 261 |
| 32 | 3300046559 | Ga0495667_0001521 | Ga0495667_0001521_12413_13303 | 261 |
| 33 | 3300046642 | Ga0495634_0123489 | Ga0495634_0123489_138_1028 | 261 |
| 34 | 3300046680 | Ga0495646_0014330 | Ga0495646_0014330_1474_2364 | 261 |
| 35 | 3300047317 | Ga0495604_0004912 | Ga0495604_0004912_5929_6819 | 261 |
| 36 | 3300047319 | Ga0495674_0018852 | Ga0495674_0018852_909_1799 | 261 |
| 37 | 3300047673 | Ga0495593_0014505 | Ga0495593_0014505_3096_3986 | 261 |
| 38 | 3300048088 | Ga0495602_0174657 | Ga0495602_0174657_636_1526 | 261 |
| 39 | 3300053077 | Ga0495601_0002792 | Ga0495601_0002792_3441_4331 | 261 |
| 40 | 3300053085 | Ga0495619_0179596 | Ga0495619_0179596_127_1017 | 261 |
| 41 | 3300045976 | Ga0466967_0078915 | Ga0466967_0078915_1104_1979 | 262 |
| 42 | 3300048903 | Ga0496100_0359812 | Ga0496100_0359812_41_955 | 264 |
| 43 | 3300048905 | Ga0496102_0027339 | Ga0496102_0027339_4087_5001 | 264 |
| 44 | 3300048906 | Ga0496103_0037287 | Ga0496103_0037287_913_1827 | 264 |
| 45 | 3300048924 | Ga0496121_0015520 | Ga0496121_0015520_5420_6334 | 264 |
| 46 | 3300049570 | Ga0501033_0037687 | Ga0501033_0037687_309_1316 | 265 |
| 47 | 3300049571 | Ga0501034_0098568 | Ga0501034_0098568_777_1784 | 265 |
| 48 | 3300049574 | Ga0501038_0017010 | Ga0501038_0017010_5442_6449 | 265 |
| 49 | 3300049581 | Ga0501047_0010487 | Ga0501047_0010487_5612_6619 | 265 |
| 50 | 3300049823 | Ga0501044_0007995 | Ga0501044_0007995_10001_11008 | 265 |
| 51 | 3300049822 | Ga0501035_0010240 | Ga0501035_0010240_102_998 | 267 |
| 52 | 3300049578 | Ga0501042_0080525 | Ga0501042_0080525_1139_2017 | 268 |
| 53 | 3300049581 | Ga0501047_0000098 | Ga0501047_0000098_49347_50225 | 268 |
| 54 | 3300047444 | Ga0495675_0006296 | Ga0495675_0006296_2948_3850 | 269 |
| 55 | 3300010375 | Ga0105239_10205381 | Ga0105239_102053812 | 270 |
| 56 | 3300005439 | Ga0070711_100261286 | Ga0070711_1002612861 | 271 |
| 57 | 3300005563 | Ga0068855_100105095 | Ga0068855_1001050952 | 272 |
| 58 | 3300005614 | Ga0068856_100033558 | Ga0068856_1000335582 | 272 |
| 59 | 3300025928 | Ga0207700_10242110 | Ga0207700_102421102 | 272 |
| 60 | 3300025949 | Ga0207667_10126266 | Ga0207667_101262663 | 272 |
| 61 | 3300026078 | Ga0207702_10204584 | Ga0207702_102045841 | 272 |
| 62 | 3300044719 | Ga0466971_0008953 | Ga0466971_0008953_3186_4094 | 272 |
| 63 | 3300044842 | Ga0466957_0196833 | Ga0466957_0196833_110_1018 | 272 |
| 64 | 3300045836 | Ga0466958_0038601 | Ga0466958_0038601_647_1555 | 272 |
| 65 | 3300045976 | Ga0466967_0056253 | Ga0466967_0056253_370_1278 | 272 |
| 66 | 3300048919 | Ga0496116_0000678 | Ga0496116_0000678_7240_8112 | 272 |
| 67 | 3300048920 | Ga0496117_0002351 | Ga0496117_0002351_598_1470 | 272 |
| 68 | 3300048921 | Ga0496118_0010040 | Ga0496118_0010040_7240_8112 | 272 |
| 69 | 3300048922 | Ga0496119_0017418 | Ga0496119_0017418_1314_2186 | 272 |
| 70 | 3300046476 | Ga0495662_0046548 | Ga0495662_0046548_692_1564 | 274 |
| 71 | 3300046516 | Ga0495628_0041387 | Ga0495628_0041387_911_1783 | 274 |
| 72 | 3300046529 | Ga0495652_0044895 | Ga0495652_0044895_1476_2348 | 274 |
| 73 | 3300046533 | Ga0495640_0009593 | Ga0495640_0009593_3277_4149 | 274 |
| 74 | 3300047317 | Ga0495604_0025914 | Ga0495604_0025914_3379_4251 | 274 |
| 75 | 3300044842 | Ga0466957_0068642 | Ga0466957_0068642_322_1158 | 278 |
| 76 | 3300046524 | Ga0495648_0003388 | Ga0495648_0003388_1182_2129 | 278 |
| 77 | 3300046648 | Ga0495611_0066943 | Ga0495611_0066943_308_1255 | 278 |
| 78 | iso_pu_bacteria | 2867346516 | 2867351744 | 279 |
| 79 | iso_pu_bacteria | 2990088156 | 2990088164 | 279 |
| 80 | 3300044684 | Ga0466966_0020481 | Ga0466966_0020481_2787_3695 | 281 |
| 81 | 3300044693 | Ga0466961_0045034 | Ga0466961_0045034_1605_2513 | 281 |
| 82 | 3300044693 | Ga0466961_0233650 | Ga0466961_0233650_31_939 | 281 |
| 83 | 3300044735 | Ga0466968_0041512 | Ga0466968_0041512_711_1619 | 281 |
| 84 | 3300045049 | Ga0466959_0214853 | Ga0466959_0214853_374_1282 | 281 |
| 85 | iso_pu_bacteria | 2867475112 | 2867480504 | 281 |
| 86 | iso_pu_bacteria | 8003830390 | 8003831228 | 281 |
| 87 | 3300003323 | rootH1_10272836 | rootH1_102728361 | 282 |
| 88 | 3300044656 | Ga0466969_0008817 | Ga0466969_0008817_3796_4740 | 282 |
| 89 | 3300044693 | Ga0466961_0213923 | Ga0466961_0213923_193_1122 | 282 |
| 90 | iso_pu_bacteria | 3006393351 | 3006394193 | 282 |
| 91 | 3300005530 | Ga0070679_100530746 | Ga0070679_1005307462 | 284 |
| 92 | 3300009553 | Ga0105249_10035459 | Ga0105249_100354594 | 284 |
| 93 | iso_pu_bacteria | 2687453737 | 2689957097 | 284 |
| 94 | 3300028800 | Ga0265338_10001371 | Ga0265338_1000137126 | 285 |
| 95 | 3300044694 | Ga0466963_0043801 | Ga0466963_0043801_1665_2597 | 285 |
| 96 | 3300044719 | Ga0466971_0002877 | Ga0466971_0002877_5297_6229 | 285 |
| 97 | 3300045976 | Ga0466967_0084783 | Ga0466967_0084783_761_1693 | 285 |
| 98 | 3300061719 | Ga0466962_0009516 | Ga0466962_0009516_916_1848 | 285 |
| 99 | iso_pu_bacteria | 8025478263 | 8025479549 | 285 |
| 100 | 3300009093 | Ga0105240_10338775 | Ga0105240_103387751 | 286 |
| 101 | 3300025913 | Ga0207695_10264830 | Ga0207695_102648302 | 286 |
| 102 | iso_pu_bacteria | 2767802112 | 2768644925 | 286 |
| 103 | 3300044658 | Ga0466972_0155888 | Ga0466972_0155888_176_1039 | 287 |
| 104 | 3300044684 | Ga0466966_0153770 | Ga0466966_0153770_71_934 | 287 |
| 105 | 3300044842 | Ga0466957_0021527 | Ga0466957_0021527_1445_2308 | 287 |
| 106 | 3300045976 | Ga0466967_0026393 | Ga0466967_0026393_1996_2859 | 287 |
| 107 | 3300048929 | Ga0496126_0231439 | Ga0496126_0231439_520_1386 | 287 |
| 108 | iso_pu_bacteria | 2990044586 | 2990047159 | 287 |
| 109 | iso_pu_bacteria | 2862705112 | 2862708524 | 288 |
| 110 | iso_pu_bacteria | 8008485437 | 8008486762 | 288 |
| 111 | iso_pu_bacteria | 8025524527 | 8025525948 | 288 |
| 112 | 3300009551 | Ga0105238_10310025 | Ga0105238_103100251 | 289 |
| 113 | 3300025908 | Ga0207643_10027321 | Ga0207643_100273213 | 289 |
| 114 | 3300025924 | Ga0207694_10081272 | Ga0207694_100812722 | 289 |
| 115 | 3300045976 | Ga0466967_0073468 | Ga0466967_0073468_165_1076 | 289 |
| 116 | 3300048929 | Ga0496126_0407593 | Ga0496126_0407593_217_1089 | 289 |
| 117 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_133697_134626 | 290 |
| 118 | iso_pu_bacteria | 8053945823 | 8053948545 | 290 |
| 119 | iso_pu_bacteria | 8056447290 | 8056454341 | 290 |
| 120 | 3300028556 | Ga0265337_1001006 | Ga0265337_10010065 | 292 |
| 121 | 3300028558 | Ga0265326_10000775 | Ga0265326_100007757 | 292 |
| 122 | 3300028573 | Ga0265334_10001171 | Ga0265334_100011715 | 292 |
| 123 | 3300028653 | Ga0265323_10021836 | Ga0265323_100218362 | 292 |
| 124 | 3300028666 | Ga0265336_10001306 | Ga0265336_100013066 | 292 |
| 125 | 3300028800 | Ga0265338_10005138 | Ga0265338_100051388 | 292 |
| 126 | 3300029957 | Ga0265324_10002104 | Ga0265324_100021046 | 292 |
| 127 | 3300031238 | Ga0265332_10001400 | Ga0265332_100014006 | 292 |
| 128 | 3300031240 | Ga0265320_10002520 | Ga0265320_100025208 | 292 |
| 129 | 3300031241 | Ga0265325_10018211 | Ga0265325_100182112 | 292 |
| 130 | 3300031595 | Ga0265313_10005093 | Ga0265313_100050933 | 292 |
| 131 | 3300031711 | Ga0265314_10015544 | Ga0265314_100155442 | 292 |
| 132 | 3300033545 | Ga0316214_1001935 | Ga0316214_10019353 | 292 |
| 133 | 3300033547 | Ga0316212_1003204 | Ga0316212_10032042 | 292 |
| 134 | 3300049571 | Ga0501034_0063066 | Ga0501034_0063066_1989_2873 | 292 |
| 135 | 3300049572 | Ga0501036_0001729 | Ga0501036_0001729_13273_14157 | 292 |
| 136 | 3300049573 | Ga0501037_0021437 | Ga0501037_0021437_3547_4431 | 292 |
| 137 | 3300049574 | Ga0501038_0008863 | Ga0501038_0008863_7242_8126 | 292 |
| 138 | 3300049578 | Ga0501042_0005531 | Ga0501042_0005531_1149_2033 | 292 |
| 139 | 3300049579 | Ga0501043_0003702 | Ga0501043_0003702_9871_10755 | 292 |
| 140 | 3300049581 | Ga0501047_0066537 | Ga0501047_0066537_1265_2149 | 292 |
| 141 | 3300049582 | Ga0501048_0009101 | Ga0501048_0009101_4198_5082 | 292 |
| 142 | 3300049589 | Ga0501073_0195932 | Ga0501073_0195932_269_1153 | 292 |
| 143 | 3300049590 | Ga0501074_0002292 | Ga0501074_0002292_348_1232 | 292 |
| 144 | 3300049592 | Ga0501076_0272863 | Ga0501076_0272863_17_901 | 292 |
| 145 | 3300049823 | Ga0501044_0022473 | Ga0501044_0022473_5499_6383 | 292 |
| 146 | 3300049823 | Ga0501044_0254886 | Ga0501044_0254886_42_926 | 292 |
| 147 | iso_pu_bacteria | 3002998708 | 3003000753 | 292 |
| 148 | 3300005367 | Ga0070667_100212292 | Ga0070667_1002122921 | 294 |
| 149 | 3300025986 | Ga0207658_10138816 | Ga0207658_101388162 | 294 |
| 150 | 3300048908 | Ga0496105_0227314 | Ga0496105_0227314_42_926 | 294 |
| 151 | 3300048929 | Ga0496126_0070176 | Ga0496126_0070176_674_1582 | 294 |
| 152 | 3300044693 | Ga0466961_0080573 | Ga0466961_0080573_1120_2007 | 295 |
| 153 | 3300044694 | Ga0466963_0172640 | Ga0466963_0172640_510_1397 | 295 |
| 154 | 3300044694 | Ga0466963_0329099 | Ga0466963_0329099_29_916 | 295 |
| 155 | 3300044694 | Ga0466963_0332692 | Ga0466963_0332692_163_1050 | 295 |
| 156 | 3300045976 | Ga0466967_0270795 | Ga0466967_0270795_47_934 | 295 |
| 157 | iso_pu_bacteria | 2997451912 | 2997456647 | 295 |
| 158 | 3300049571 | Ga0501034_0027791 | Ga0501034_0027791_4836_5729 | 296 |
| 159 | 3300005327 | Ga0070658_10030685 | Ga0070658_100306855 | 297 |
| 160 | 3300005329 | Ga0070683_100058149 | Ga0070683_1000581492 | 297 |
| 161 | 3300005435 | Ga0070714_100000018 | Ga0070714_10000001852 | 297 |
| 162 | 3300025904 | Ga0207647_10036174 | Ga0207647_100361742 | 297 |
| 163 | 3300025909 | Ga0207705_10097488 | Ga0207705_100974882 | 297 |
| 164 | 3300025944 | Ga0207661_10021475 | Ga0207661_100214752 | 297 |
| 165 | 3300045976 | Ga0466967_0054597 | Ga0466967_0054597_1012_1959 | 297 |
| 166 | 3300048905 | Ga0496102_0002945 | Ga0496102_0002945_1203_2096 | 297 |
| 167 | 3300048906 | Ga0496103_0033120 | Ga0496103_0033120_584_1477 | 297 |
| 168 | 3300005334 | Ga0068869_100023739 | Ga0068869_1000237392 | 298 |
| 169 | 3300005335 | Ga0070666_10104436 | Ga0070666_101044362 | 298 |
| 170 | 3300005338 | Ga0068868_100005680 | Ga0068868_1000056805 | 298 |
| 171 | 3300005339 | Ga0070660_100086197 | Ga0070660_1000861972 | 298 |
| 172 | 3300005344 | Ga0070661_100368113 | Ga0070661_1003681132 | 298 |
| 173 | 3300005356 | Ga0070674_100132062 | Ga0070674_1001320621 | 298 |
| 174 | 3300005364 | Ga0070673_100105535 | Ga0070673_1001055352 | 298 |
| 175 | 3300005365 | Ga0070688_100412036 | Ga0070688_1004120361 | 298 |
| 176 | 3300005366 | Ga0070659_100020927 | Ga0070659_1000209272 | 298 |
| 177 | 3300005434 | Ga0070709_10121111 | Ga0070709_101211112 | 298 |
| 178 | 3300005435 | Ga0070714_100054831 | Ga0070714_1000548312 | 298 |
| 179 | 3300005439 | Ga0070711_100065082 | Ga0070711_1000650822 | 298 |
| 180 | 3300005444 | Ga0070694_100011216 | Ga0070694_1000112162 | 298 |
| 181 | 3300005455 | Ga0070663_100011335 | Ga0070663_1000113352 | 298 |
| 182 | 3300005456 | Ga0070678_100044442 | Ga0070678_1000444423 | 298 |
| 183 | 3300005539 | Ga0068853_100092664 | Ga0068853_1000926642 | 298 |
| 184 | 3300005543 | Ga0070672_100250117 | Ga0070672_1002501172 | 298 |
| 185 | 3300005544 | Ga0070686_100012789 | Ga0070686_1000127893 | 298 |
| 186 | 3300005545 | Ga0070695_100013451 | Ga0070695_1000134513 | 298 |
| 187 | 3300005546 | Ga0070696_100023965 | Ga0070696_1000239652 | 298 |
| 188 | 3300005547 | Ga0070693_100010482 | Ga0070693_1000104823 | 298 |
| 189 | 3300005549 | Ga0070704_100051836 | Ga0070704_1000518362 | 298 |
| 190 | 3300005577 | Ga0068857_100084540 | Ga0068857_1000845402 | 298 |
| 191 | 3300005616 | Ga0068852_100014264 | Ga0068852_1000142642 | 298 |
| 192 | 3300005616 | Ga0068852_100425645 | Ga0068852_1004256451 | 298 |
| 193 | 3300005617 | Ga0068859_100131707 | Ga0068859_1001317072 | 298 |
| 194 | 3300005718 | Ga0068866_10198203 | Ga0068866_101982032 | 298 |
| 195 | 3300005719 | Ga0068861_100399387 | Ga0068861_1003993872 | 298 |
| 196 | 3300005834 | Ga0068851_10125556 | Ga0068851_101255562 | 298 |
| 197 | 3300005843 | Ga0068860_100249072 | Ga0068860_1002490722 | 298 |
| 198 | 3300006028 | Ga0070717_10027692 | Ga0070717_100276922 | 298 |
| 199 | 3300006163 | Ga0070715_10012272 | Ga0070715_100122722 | 298 |
| 200 | 3300006175 | Ga0070712_100015408 | Ga0070712_1000154082 | 298 |
| 201 | 3300006237 | Ga0097621_100099176 | Ga0097621_1000991761 | 298 |
| 202 | 3300006852 | Ga0075433_10149040 | Ga0075433_101490402 | 298 |
| 203 | 3300006871 | Ga0075434_100222913 | Ga0075434_1002229132 | 298 |
| 204 | 3300006931 | Ga0097620_100131697 | Ga0097620_1001316972 | 298 |
| 205 | 3300009093 | Ga0105240_10040929 | Ga0105240_100409295 | 298 |
| 206 | 3300009094 | Ga0111539_10179854 | Ga0111539_101798542 | 298 |
| 207 | 3300009098 | Ga0105245_10057999 | Ga0105245_100579992 | 298 |
| 208 | 3300009101 | Ga0105247_10018464 | Ga0105247_100184642 | 298 |
| 209 | 3300009148 | Ga0105243_10024631 | Ga0105243_100246314 | 298 |
| 210 | 3300009174 | Ga0105241_10047687 | Ga0105241_100476872 | 298 |
| 211 | 3300009177 | Ga0105248_10253696 | Ga0105248_102536962 | 298 |
| 212 | 3300009545 | Ga0105237_10181646 | Ga0105237_101816462 | 298 |
| 213 | 3300009551 | Ga0105238_10064972 | Ga0105238_100649722 | 298 |
| 214 | 3300009553 | Ga0105249_10019303 | Ga0105249_100193034 | 298 |
| 215 | 3300010375 | Ga0105239_10074139 | Ga0105239_100741393 | 298 |
| 216 | 3300013104 | Ga0157370_10016985 | Ga0157370_100169854 | 298 |
| 217 | 3300013105 | Ga0157369_10271215 | Ga0157369_102712152 | 298 |
| 218 | 3300013297 | Ga0157378_10081438 | Ga0157378_100814381 | 298 |
| 219 | 3300013306 | Ga0163162_10024677 | Ga0163162_100246773 | 298 |
| 220 | 3300013307 | Ga0157372_10116921 | Ga0157372_101169212 | 298 |
| 221 | 3300014326 | Ga0157380_10012958 | Ga0157380_100129582 | 298 |
| 222 | 3300014745 | Ga0157377_10005939 | Ga0157377_100059393 | 298 |
| 223 | 3300014968 | Ga0157379_10011013 | Ga0157379_100110136 | 298 |
| 224 | 3300014969 | Ga0157376_10107664 | Ga0157376_101076642 | 298 |
| 225 | 3300017792 | Ga0163161_10017589 | Ga0163161_100175893 | 298 |
| 226 | 3300025901 | Ga0207688_10000555 | Ga0207688_1000055517 | 298 |
| 227 | 3300025903 | Ga0207680_10147112 | Ga0207680_101471121 | 298 |
| 228 | 3300025915 | Ga0207693_10014077 | Ga0207693_100140772 | 298 |
| 229 | 3300025918 | Ga0207662_10088653 | Ga0207662_100886532 | 298 |
| 230 | 3300025919 | Ga0207657_10003612 | Ga0207657_100036122 | 298 |
| 231 | 3300025927 | Ga0207687_10010959 | Ga0207687_100109594 | 298 |
| 232 | 3300025928 | Ga0207700_10150883 | Ga0207700_101508832 | 298 |
| 233 | 3300025939 | Ga0207665_10000738 | Ga0207665_1000073811 | 298 |
| 234 | 3300025942 | Ga0207689_10009684 | Ga0207689_100096842 | 298 |
| 235 | 3300025949 | Ga0207667_10050156 | Ga0207667_100501562 | 298 |
| 236 | 3300025960 | Ga0207651_10150455 | Ga0207651_101504551 | 298 |
| 237 | 3300025961 | Ga0207712_10017535 | Ga0207712_100175354 | 298 |
| 238 | 3300026023 | Ga0207677_10064310 | Ga0207677_100643102 | 298 |
| 239 | 3300026041 | Ga0207639_10087656 | Ga0207639_100876562 | 298 |
| 240 | 3300026067 | Ga0207678_10006594 | Ga0207678_100065947 | 298 |
| 241 | 3300026116 | Ga0207674_10043118 | Ga0207674_100431183 | 298 |
| 242 | 3300026118 | Ga0207675_100016686 | Ga0207675_1000166866 | 298 |
| 243 | 3300026121 | Ga0207683_10003061 | Ga0207683_100030614 | 298 |
| 244 | 3300026142 | Ga0207698_10004406 | Ga0207698_100044068 | 298 |
| 245 | 3300026142 | Ga0207698_10073777 | Ga0207698_100737772 | 298 |
| 246 | 3300028379 | Ga0268266_10200530 | Ga0268266_102005302 | 298 |
| 247 | 3300035088 | Ga0373940_0002251 | Ga0373940_0002251_342_1256 | 298 |
| 248 | 3300035091 | Ga0373951_0011157 | Ga0373951_0011157_999_1913 | 298 |
| 249 | 3300035092 | Ga0373952_0003851 | Ga0373952_0003851_856_1770 | 298 |
| 250 | 3300046461 | Ga0495641_0039192 | Ga0495641_0039192_1157_2071 | 298 |
| 251 | 3300048904 | Ga0496101_0129512 | Ga0496101_0129512_301_1215 | 298 |
| 252 | 3300048905 | Ga0496102_0118285 | Ga0496102_0118285_1294_2208 | 298 |
| 253 | 3300048907 | Ga0496104_0094350 | Ga0496104_0094350_1585_2499 | 298 |
| 254 | 3300048909 | Ga0496106_0014208 | Ga0496106_0014208_819_1733 | 298 |
| 255 | 3300048910 | Ga0496107_0013942 | Ga0496107_0013942_461_1375 | 298 |
| 256 | 3300048911 | Ga0496108_0012355 | Ga0496108_0012355_700_1614 | 298 |
| 257 | 3300048912 | Ga0496109_0169852 | Ga0496109_0169852_831_1745 | 298 |
| 258 | 3300048913 | Ga0496110_0203818 | Ga0496110_0203818_826_1740 | 298 |
| 259 | 3300048914 | Ga0496111_0007235 | Ga0496111_0007235_208_1122 | 298 |
| 260 | 3300048915 | Ga0496112_0030495 | Ga0496112_0030495_4157_5071 | 298 |
| 261 | 3300048916 | Ga0496113_0133662 | Ga0496113_0133662_97_1011 | 298 |
| 262 | 3300048917 | Ga0496114_0026772 | Ga0496114_0026772_129_1043 | 298 |
| 263 | 3300048918 | Ga0496115_0022198 | Ga0496115_0022198_2327_3241 | 298 |
| 264 | 3300048923 | Ga0496120_0003348 | Ga0496120_0003348_9935_10831 | 298 |
| 265 | 3300050512 | nmdc:mga0n895_542892_c1 | nmdc:mga0n895_542892_c1_104_1018 | 298 |
| 266 | 3300050514 | nmdc:mga08x19_36145_c1 | nmdc:mga08x19_36145_c1_2124_3038 | 298 |
| 267 | 3300005614 | Ga0068856_100010978 | Ga0068856_1000109782 | 300 |
| 268 | 3300009093 | Ga0105240_10083142 | Ga0105240_100831422 | 300 |
| 269 | 3300009545 | Ga0105237_10070102 | Ga0105237_100701022 | 300 |
| 270 | 3300010375 | Ga0105239_10006071 | Ga0105239_100060715 | 300 |
| 271 | 3300025914 | Ga0207671_10059831 | Ga0207671_100598312 | 300 |
| 272 | 3300025981 | Ga0207640_10071130 | Ga0207640_100711302 | 300 |
| 273 | 3300026078 | Ga0207702_10004368 | Ga0207702_100043687 | 300 |
| 274 | 3300005468 | Ga0070707_100343028 | Ga0070707_1003430282 | 302 |
| 275 | 3300005563 | Ga0068855_100013787 | Ga0068855_1000137872 | 302 |
| 276 | 3300005614 | Ga0068856_100227069 | Ga0068856_1002270692 | 302 |
| 277 | 3300009174 | Ga0105241_10057288 | Ga0105241_100572882 | 302 |
| 278 | 3300009545 | Ga0105237_10102890 | Ga0105237_101028902 | 302 |
| 279 | 3300009551 | Ga0105238_10286101 | Ga0105238_102861011 | 302 |
| 280 | 3300025904 | Ga0207647_10026129 | Ga0207647_100261292 | 302 |
| 281 | 3300025911 | Ga0207654_10107789 | Ga0207654_101077891 | 302 |
| 282 | 3300025949 | Ga0207667_10062966 | Ga0207667_100629663 | 302 |
| 283 | 3300026078 | Ga0207702_10196752 | Ga0207702_101967522 | 302 |
| 284 | 3300026142 | Ga0207698_10350934 | Ga0207698_103509342 | 302 |
| 285 | 3300044658 | Ga0466972_0011748 | Ga0466972_0011748_1857_2765 | 302 |
| 286 | 3300044684 | Ga0466966_0036332 | Ga0466966_0036332_504_1433 | 302 |
| 287 | 3300044693 | Ga0466961_0025733 | Ga0466961_0025733_297_1226 | 302 |
| 288 | 3300044694 | Ga0466963_0037616 | Ga0466963_0037616_10_918 | 302 |
| 289 | 3300044694 | Ga0466963_0177193 | Ga0466963_0177193_191_1120 | 302 |
| 290 | 3300044694 | Ga0466963_0257746 | Ga0466963_0257746_196_1104 | 302 |
| 291 | 3300044765 | Ga0466970_0029491 | Ga0466970_0029491_106_1014 | 302 |
| 292 | 3300044765 | Ga0466970_0054244 | Ga0466970_0054244_13_951 | 302 |
| 293 | 3300045049 | Ga0466959_0144974 | Ga0466959_0144974_398_1306 | 302 |
| 294 | 3300045976 | Ga0466967_0006625 | Ga0466967_0006625_2521_3429 | 302 |
| 295 | 3300045976 | Ga0466967_0087452 | Ga0466967_0087452_1142_2071 | 302 |
| 296 | 3300045976 | Ga0466967_0103963 | Ga0466967_0103963_1078_1986 | 302 |
| 297 | 3300049823 | Ga0501044_0247654 | Ga0501044_0247654_62_991 | 302 |
| 298 | 3300037853 | Ga0436364_0729892 | Ga0436364_0729892_3877_4821 | 303 |
| 299 | 3300048911 | Ga0496108_0018475 | Ga0496108_0018475_1775_2695 | 303 |
| 300 | 3300048912 | Ga0496109_0030496 | Ga0496109_0030496_3643_4563 | 303 |
| 301 | 3300044694 | Ga0466963_0026471 | Ga0466963_0026471_967_1881 | 304 |
| 302 | 3300044719 | Ga0466971_0070774 | Ga0466971_0070774_71_985 | 304 |
| 303 | 3300045976 | Ga0466967_0032872 | Ga0466967_0032872_1834_2748 | 304 |
| 304 | 3300045976 | Ga0466967_0716583 | Ga0466967_0716583_32_946 | 304 |
| 305 | iso_pu_bacteria | 2675902999 | 2676205124 | 305 |
| 306 | iso_pu_bacteria | 2773857921 | 2774849699 | 305 |
| 307 | iso_pu_bacteria | 8002775197 | 8002782666 | 305 |
| 308 | 3300025929 | Ga0207664_10000003 | Ga0207664_10000003404 | 307 |
| 309 | 3300025938 | Ga0207704_10151124 | Ga0207704_101511242 | 308 |
| 310 | 3300025961 | Ga0207712_10529991 | Ga0207712_105299911 | 308 |
| 311 | iso_pu_bacteria | 2517572101 | 2517764102 | 310 |
| 312 | 3300002067 | JGI24735J21928_10023163 | JGI24735J21928_100231631 | 313 |
| 313 | 3300005367 | Ga0070667_100069536 | Ga0070667_1000695362 | 313 |
| 314 | iso_pu_bacteria | 3006425503 | 3006426846 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7osf-assembly1.cif.gz_E | abc transporter complex nosdfyl, r-domain 1 | 0.703 | 48 | 309 |
| 7osf-assembly1.cif.gz_E | abc transporter complex nosdfyl, r-domain 1 | 0.6865 | 48 | 309 |
| 7o12-assembly1.cif.gz_E | abc transporter nosdfy, amppnp-bound in gdn | 0.676 | 48 | 309 |
| 7znq-assembly1.cif.gz_y | abc transporter complex nosdfyl in gdn | 0.6702 | 48 | 310 |
| 7o17-assembly1.cif.gz_E | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.6606 | 48 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6648 | 108 | 305 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5793 | 94 | 305 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4433 | 108 | 305 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.398 | 94 | 305 | 3.40.1710.10 |
| af_A0A0R0L9H2_4_217_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3304 | 60 | 304 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3HHE6-F1-model_v4 | ABC transporter permease | 0.9605 | 193 | 313 |
GO:0016020
|
| AF-A0A3M2MD51-F1-model_v4 | ABC transporter permease | 0.9576 | 38 | 313 |
GO:0005886
GO:0140359 |
| AF-A0A2H5AX16-F1-model_v4 | ABC transporter permease | 0.9519 | 67 | 313 |
GO:0005886
GO:0140359 |
| AF-A0A5B7UTE0-F1-model_v4 | ABC-2 family transporter protein | 0.9458 | 36 | 313 |
GO:0016020
|
| AF-A0A536LXN7-F1-model_v4 | ABC transporter permease | 0.9452 | 102 | 313 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar