F402815

General Info

Members Datasets Scaffolds Average Seq Length
314 226 293 290

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0054244|Ga0466970_0054244_13_951
Length 312
Sequence MSARAKSHEVSSEKELSRVAATHTGIHERLAHQDAGRAPAFNPRRTLPLRVEFVRQLKRRRTQITFGLLLVLPIIIAIAFKVGGGAGSDAPQLVGLANSGGFNFALFTEFASVGFLLVVVVALFCGDTVASEAGWSSLRYLLAQPVPRARLLKQKLIVAGTLCVAANFLLPVWAFVVGGTFFGWHPARSPIGGSFGSGPSVQRLGIIVIYVCIQLLVVASLAFLLSVSVDNPLGAVGGAVMLHVVSSILDQITALDPYRKFLPTHFSYAWVDTLSTPIRWDDMFRGTGVALVYAAVFFGYAWLRFDRKDVTS

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
3 2687453737 Frankia sp. BMG5.36 Isolate Nodule
4 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
5 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
6 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
7 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
8 2867475112 Streptomyces sp. TM32 Isolate Unclassified
9 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
10 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
11 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
12 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
13 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
14 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
130 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 8002775197 Frankia nepalensis CN7 Isolate Nodule
221 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
222 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
223 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
224 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
225 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
226 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0
Isolates 6.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 1.59
Rhizoplane 6.69
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10023163 3300002067 Bacteria 1885
2 rootH1_10272836 3300003323 Bacteria 1353
3 Ga0070658_10030685 3300005327 Bacteria 4317
4 Ga0070683_100058149 3300005329 Bacteria 3593
5 Ga0068869_100023739 3300005334 Bacteria 4241
6 Ga0070666_10104436 3300005335 Bacteria 1955
7 Ga0068868_100005680 3300005338 Bacteria 8783
8 Ga0070660_100086197 3300005339 Bacteria 2471
9 Ga0070661_100368113 3300005344 Bacteria 1131
10 Ga0070674_100132062 3300005356 Bacteria 1863
11 Ga0070673_100105535 3300005364 Bacteria 2328
12 Ga0070688_100412036 3300005365 Bacteria 1002
13 Ga0070659_100020927 3300005366 Bacteria 4974
14 Ga0070667_100069536 3300005367 Bacteria 2996
15 Ga0070667_100212292 3300005367 Bacteria 1721
16 Ga0070709_10121111 3300005434 Bacteria 1773
17 Ga0070714_100000018 3300005435 Bacteria 173975
18 Ga0070714_100054831 3300005435 Bacteria 3406
19 Ga0070714_100085001 3300005435 Bacteria 2762
20 Ga0070714_100455621 3300005435 Bacteria 1215
21 Ga0070713_100150221 3300005436 Bacteria 2071
22 Ga0070711_100065082 3300005439 Bacteria 2548
23 Ga0070711_100261286 3300005439 Bacteria 1362
24 Ga0070694_100011216 3300005444 Bacteria 5549
25 Ga0070663_100011335 3300005455 Bacteria 5592
26 Ga0070678_100044442 3300005456 Bacteria 3172
27 Ga0070707_100343028 3300005468 Bacteria 1451
28 Ga0070679_100530746 3300005530 Bacteria 1121
29 Ga0068853_100092664 3300005539 Bacteria 2658
30 Ga0070672_100250117 3300005543 Bacteria 1493
31 Ga0070686_100012789 3300005544 Bacteria 4790
32 Ga0070695_100013451 3300005545 Bacteria 4918
33 Ga0070696_100023965 3300005546 Bacteria 4147
34 Ga0070693_100010482 3300005547 Bacteria 4645
35 Ga0070665_100360823 3300005548 Bacteria 1459
36 Ga0070704_100051836 3300005549 Bacteria 2892
37 Ga0068855_100013787 3300005563 Bacteria 9744
38 Ga0068855_100105095 3300005563 Bacteria 3247
39 Ga0068857_100084540 3300005577 Bacteria 2836
40 Ga0068856_100010978 3300005614 Bacteria 8795
41 Ga0068856_100033558 3300005614 Bacteria 5026
42 Ga0068856_100227069 3300005614 Bacteria 1882
43 Ga0068852_100014264 3300005616 Bacteria 6109
44 Ga0068852_100425645 3300005616 Bacteria 1310
45 Ga0068859_100131707 3300005617 Bacteria 2572
46 Ga0068866_10198203 3300005718 Bacteria 1198
47 Ga0068861_100399387 3300005719 Bacteria 1219
48 Ga0068851_10125556 3300005834 Bacteria 1383
49 Ga0068860_100249072 3300005843 Bacteria 1729
50 Ga0070717_10027692 3300006028 Bacteria 4530
51 Ga0070715_10012272 3300006163 Bacteria 3113
52 Ga0070716_100123144 3300006173 Bacteria 1627
53 Ga0070712_100015408 3300006175 Bacteria 4924
54 Ga0070712_100049471 3300006175 Bacteria 2919
55 Ga0070712_100139926 3300006175 Bacteria 1845
56 Ga0097621_100099176 3300006237 Bacteria 2448
57 Ga0075433_10149040 3300006852 Bacteria 2081
58 Ga0075434_100222913 3300006871 Bacteria 1905
59 Ga0097620_100131697 3300006931 Bacteria 2572
60 Ga0105240_10040929 3300009093 Bacteria 5920
61 Ga0105240_10083142 3300009093 Bacteria 3929
62 Ga0105240_10338775 3300009093 Bacteria 1709
63 Ga0111539_10179854 3300009094 Bacteria 2471
64 Ga0105245_10057999 3300009098 Bacteria 3484
65 Ga0105247_10018464 3300009101 Bacteria 4183
66 Ga0105243_10024631 3300009148 Bacteria 4591
67 Ga0105241_10047687 3300009174 Bacteria 3258
68 Ga0105241_10057288 3300009174 Bacteria 2989
69 Ga0105248_10253696 3300009177 Bacteria 1980
70 Ga0105237_10070102 3300009545 Bacteria 3501
71 Ga0105237_10102890 3300009545 Bacteria 2848
72 Ga0105237_10181646 3300009545 Bacteria 2104
73 Ga0105238_10064972 3300009551 Bacteria 3650
74 Ga0105238_10286101 3300009551 Bacteria 1630
75 Ga0105238_10310025 3300009551 Bacteria 1563
76 Ga0105249_10019303 3300009553 Bacteria 6079
77 Ga0105249_10035459 3300009553 Bacteria 4524
78 Ga0105239_10006071 3300010375 Bacteria 14067
79 Ga0105239_10074139 3300010375 Bacteria 3742
80 Ga0105239_10205381 3300010375 Bacteria 2208
81 Ga0157370_10016985 3300013104 Bacteria 7355
82 Ga0157369_10271215 3300013105 Bacteria 1768
83 Ga0157378_10081438 3300013297 Bacteria 2926
84 Ga0163162_10024677 3300013306 Bacteria 5938
85 Ga0157372_10116921 3300013307 Bacteria 3058
86 Ga0157380_10012958 3300014326 Bacteria 6060
87 Ga0157377_10005939 3300014745 Bacteria 5780
88 Ga0157379_10011013 3300014968 Bacteria 7885
89 Ga0157376_10107664 3300014969 Bacteria 2447
90 Ga0163161_10017589 3300017792 Bacteria 5005
91 Ga0207688_10000555 3300025901 Bacteria 18211
92 Ga0207680_10147112 3300025903 Bacteria 1567
93 Ga0207647_10026129 3300025904 Bacteria 3824
94 Ga0207647_10036174 3300025904 Bacteria 3139
95 Ga0207643_10027321 3300025908 Bacteria 3163
96 Ga0207705_10097488 3300025909 Bacteria 2159
97 Ga0207654_10107789 3300025911 Bacteria 1727
98 Ga0207695_10264830 3300025913 Bacteria 1615
99 Ga0207671_10059831 3300025914 Bacteria 2825
100 Ga0207693_10014077 3300025915 Bacteria 6440
101 Ga0207693_10072630 3300025915 Bacteria 2694
102 Ga0207662_10088653 3300025918 Bacteria 1900
103 Ga0207657_10003612 3300025919 Bacteria 16487
104 Ga0207694_10081272 3300025924 Bacteria 2545
105 Ga0207687_10010959 3300025927 Bacteria 5924
106 Ga0207700_10150883 3300025928 Bacteria 1920
107 Ga0207700_10242110 3300025928 Bacteria 1538
108 Ga0207664_10000003 3300025929 Bacteria 510966
109 Ga0207664_10006053 3300025929 Bacteria 8285
110 Ga0207704_10151124 3300025938 Bacteria 1638
111 Ga0207665_10000738 3300025939 Bacteria 22007
112 Ga0207665_10156646 3300025939 Bacteria 1635
113 Ga0207689_10009684 3300025942 Bacteria 8298
114 Ga0207661_10021475 3300025944 Bacteria 4837
115 Ga0207667_10050156 3300025949 Bacteria 4405
116 Ga0207667_10062966 3300025949 Bacteria 3877
117 Ga0207667_10126266 3300025949 Bacteria 2635
118 Ga0207651_10150455 3300025960 Bacteria 1811
119 Ga0207712_10017535 3300025961 Bacteria 4652
120 Ga0207712_10529991 3300025961 Bacteria 1011
121 Ga0207640_10071130 3300025981 Bacteria 2342
122 Ga0207658_10138816 3300025986 Bacteria 1964
123 Ga0207677_10064310 3300026023 Bacteria 2554
124 Ga0207639_10087656 3300026041 Bacteria 2482
125 Ga0207678_10006594 3300026067 Bacteria 10295
126 Ga0207702_10004368 3300026078 Bacteria 12604
127 Ga0207702_10196752 3300026078 Bacteria 1866
128 Ga0207702_10204584 3300026078 Bacteria 1832
129 Ga0207674_10043118 3300026116 Bacteria 4654
130 Ga0207675_100016686 3300026118 Bacteria 6857
131 Ga0207683_10003061 3300026121 Bacteria 14623
132 Ga0207698_10004406 3300026142 Bacteria 8577
133 Ga0207698_10073777 3300026142 Bacteria 2718
134 Ga0207698_10350934 3300026142 Bacteria 1393
135 Ga0268266_10200530 3300028379 Bacteria 1826
136 Ga0265337_1001006 3300028556 Bacteria 14694
137 Ga0265326_10000775 3300028558 Bacteria 11866
138 Ga0265334_10001171 3300028573 Bacteria 12838
139 Ga0265323_10021836 3300028653 Bacteria 2449
140 Ga0265336_10001306 3300028666 Bacteria 11657
141 Ga0265338_10001371 3300028800 Bacteria 39597
142 Ga0265338_10005138 3300028800 Bacteria 17234
143 Ga0265324_10002104 3300029957 Bacteria 10517
144 Ga0265332_10001400 3300031238 Bacteria 13603
145 Ga0265320_10002520 3300031240 Bacteria 12732
146 Ga0265325_10018211 3300031241 Bacteria 3893
147 Ga0265313_10005093 3300031595 Bacteria 9789
148 Ga0265314_10015544 3300031711 Bacteria 6038
149 Ga0316214_1001935 3300033545 Bacteria 2502
150 Ga0316212_1003204 3300033547 Bacteria 2354
151 Ga0373940_0002251 3300035088 Bacteria 3714
152 Ga0373951_0011157 3300035091 Bacteria 2016
153 Ga0373952_0003851 3300035092 Bacteria 2719
154 Ga0436364_0729892 3300037853 Bacteria 5184
155 Ga0466969_0008817 3300044656 Bacteria 5347
156 Ga0466972_0011748 3300044658 Bacteria 4398
157 Ga0466972_0155888 3300044658 Bacteria 1073
158 Ga0466966_0020481 3300044684 Bacteria 4348
159 Ga0466966_0036332 3300044684 Bacteria 3181
160 Ga0466966_0153770 3300044684 Bacteria 1402
161 Ga0466961_0025733 3300044693 Bacteria 3783
162 Ga0466961_0045034 3300044693 Bacteria 2823
163 Ga0466961_0080573 3300044693 Bacteria 2061
164 Ga0466961_0213923 3300044693 Bacteria 1189
165 Ga0466961_0233650 3300044693 Bacteria 1131
166 Ga0466963_0026471 3300044694 Bacteria 3710
167 Ga0466963_0037616 3300044694 Bacteria 3161
168 Ga0466963_0043801 3300044694 Bacteria 2944
169 Ga0466963_0172640 3300044694 Bacteria 1507
170 Ga0466963_0177193 3300044694 Bacteria 1488
171 Ga0466963_0257746 3300044694 Bacteria 1224
172 Ga0466963_0329099 3300044694 Bacteria 1075
173 Ga0466963_0332692 3300044694 Bacteria 1069
174 Ga0466971_0002877 3300044719 Bacteria 7301
175 Ga0466971_0008953 3300044719 Bacteria 4375
176 Ga0466971_0070774 3300044719 Bacteria 1584
177 Ga0466968_0041512 3300044735 Bacteria 1942
178 Ga0466970_0029491 3300044765 Bacteria 2888
179 Ga0466970_0054244 3300044765 Bacteria 2141
180 Ga0466957_0021527 3300044842 Bacteria 3800
181 Ga0466957_0068642 3300044842 Bacteria 2189
182 Ga0466957_0196833 3300044842 Bacteria 1322
183 Ga0466959_0144974 3300045049 Bacteria 1676
184 Ga0466959_0214853 3300045049 Bacteria 1335
185 Ga0466958_0038601 3300045836 Bacteria 2866
186 Ga0466967_0006625 3300045976 Bacteria 8233
187 Ga0466967_0026393 3300045976 Bacteria 4812
188 Ga0466967_0032872 3300045976 Bacteria 4386
189 Ga0466967_0054597 3300045976 Bacteria 3517
190 Ga0466967_0056253 3300045976 Bacteria 3468
191 Ga0466967_0073468 3300045976 Bacteria 3068
192 Ga0466967_0078915 3300045976 Bacteria 2967
193 Ga0466967_0084783 3300045976 Bacteria 2867
194 Ga0466967_0087452 3300045976 Bacteria 2825
195 Ga0466967_0103963 3300045976 Bacteria 2599
196 Ga0466967_0270795 3300045976 Bacteria 1627
197 Ga0466967_0716583 3300045976 Bacteria 991
198 Ga0495592_0000338 3300046454 Bacteria 38538
199 Ga0495641_0039192 3300046461 Bacteria 2211
200 Ga0495653_0009836 3300046463 Bacteria 7819
201 Ga0495580_0018856 3300046472 Bacteria 5133
202 Ga0495662_0004449 3300046476 Bacteria 7039
203 Ga0495662_0046548 3300046476 Bacteria 2095
204 Ga0495664_0052209 3300046477 Bacteria 2428
205 Ga0495608_0002874 3300046511 Bacteria 12327
206 Ga0495618_0196899 3300046514 Bacteria 1276
207 Ga0495628_0023303 3300046516 Bacteria 5082
208 Ga0495628_0041387 3300046516 Bacteria 3678
209 Ga0495648_0003388 3300046524 Bacteria 14013
210 Ga0495666_0001561 3300046526 Bacteria 11262
211 Ga0495652_0044895 3300046529 Bacteria 3803
212 Ga0495665_0001780 3300046531 Bacteria 11590
213 Ga0495640_0009593 3300046533 Bacteria 7527
214 Ga0495640_0019176 3300046533 Bacteria 5052
215 Ga0495586_0060455 3300046535 Bacteria 2060
216 Ga0495587_0232594 3300046536 Bacteria 1038
217 Ga0495645_0068091 3300046543 Bacteria 2570
218 Ga0495667_0001521 3300046559 Bacteria 15325
219 Ga0495667_0284402 3300046559 Bacteria 1050
220 Ga0495634_0123489 3300046642 Bacteria 1656
221 Ga0495611_0066943 3300046648 Bacteria 1639
222 Ga0495657_0023332 3300046675 Bacteria 4421
223 Ga0495646_0014330 3300046680 Bacteria 5044
224 Ga0495613_0026007 3300046689 Bacteria 4360
225 Ga0495581_0007687 3300047315 Bacteria 6236
226 Ga0495604_0004912 3300047317 Bacteria 10599
227 Ga0495604_0025914 3300047317 Bacteria 4669
228 Ga0495674_0018852 3300047319 Bacteria 6417
229 Ga0495675_0006296 3300047444 Bacteria 7267
230 Ga0495675_0226768 3300047444 Bacteria 1128
231 Ga0495593_0014505 3300047673 Bacteria 4479
232 Ga0495602_0174657 3300048088 Bacteria 1663
233 Ga0496100_0359812 3300048903 Bacteria 1101
234 Ga0496101_0129512 3300048904 Bacteria 1915
235 Ga0496102_0002945 3300048905 Bacteria 14442
236 Ga0496102_0027339 3300048905 Bacteria 5095
237 Ga0496102_0118285 3300048905 Bacteria 2473
238 Ga0496103_0033120 3300048906 Bacteria 3156
239 Ga0496103_0037287 3300048906 Bacteria 2978
240 Ga0496104_0094350 3300048907 Bacteria 2862
241 Ga0496105_0227314 3300048908 Bacteria 1517
242 Ga0496106_0014208 3300048909 Bacteria 5880
243 Ga0496107_0013942 3300048910 Bacteria 5622
244 Ga0496108_0012355 3300048911 Bacteria 6948
245 Ga0496108_0018475 3300048911 Bacteria 5708
246 Ga0496109_0030496 3300048912 Bacteria 4833
247 Ga0496109_0169852 3300048912 Bacteria 2045
248 Ga0496110_0203818 3300048913 Bacteria 1797
249 Ga0496111_0007235 3300048914 Bacteria 7260
250 Ga0496112_0030495 3300048915 Bacteria 5219
251 Ga0496113_0133662 3300048916 Bacteria 1948
252 Ga0496114_0026772 3300048917 Bacteria 4723
253 Ga0496115_0022198 3300048918 Bacteria 4914
254 Ga0496116_0000678 3300048919 Bacteria 44229
255 Ga0496117_0002351 3300048920 Bacteria 24169
256 Ga0496118_0010040 3300048921 Bacteria 9437
257 Ga0496119_0017418 3300048922 Bacteria 5404
258 Ga0496120_0003348 3300048923 Bacteria 14718
259 Ga0496121_0015520 3300048924 Bacteria 7972
260 Ga0496126_0000013 3300048929 Bacteria 690046
261 Ga0496126_0070176 3300048929 Bacteria 3122
262 Ga0496126_0231439 3300048929 Bacteria 1548
263 Ga0496126_0407593 3300048929 Bacteria 1101
264 Ga0501032_0147798 3300049569 Bacteria 1546
265 Ga0501033_0037687 3300049570 Bacteria 3618
266 Ga0501034_0027791 3300049571 Bacteria 5752
267 Ga0501034_0063066 3300049571 Bacteria 3720
268 Ga0501034_0098568 3300049571 Bacteria 2918
269 Ga0501036_0001729 3300049572 Bacteria 16972
270 Ga0501037_0021437 3300049573 Bacteria 4775
271 Ga0501038_0008863 3300049574 Bacteria 9232
272 Ga0501038_0017010 3300049574 Bacteria 6580
273 Ga0501042_0005531 3300049578 Bacteria 8142
274 Ga0501042_0080525 3300049578 Bacteria 2333
275 Ga0501043_0003702 3300049579 Bacteria 12561
276 Ga0501047_0000098 3300049581 Bacteria 106464
277 Ga0501047_0010487 3300049581 Bacteria 8771
278 Ga0501047_0066537 3300049581 Bacteria 3473
279 Ga0501048_0009101 3300049582 Bacteria 7475
280 Ga0501073_0195932 3300049589 Bacteria 1397
281 Ga0501074_0002292 3300049590 Bacteria 13306
282 Ga0501076_0272863 3300049592 Bacteria 1385
283 Ga0501035_0010240 3300049822 Bacteria 8699
284 Ga0501044_0007995 3300049823 Bacteria 11620
285 Ga0501044_0022473 3300049823 Bacteria 6719
286 Ga0501044_0247654 3300049823 Bacteria 1724
287 Ga0501044_0254886 3300049823 Bacteria 1694
288 nmdc:mga0n895_542892_c1 3300050512 Bacteria 1169
289 nmdc:mga08x19_36145_c1 3300050514 Bacteria 3127
290 Ga0495601_0002792 3300053077 Bacteria 9920
291 Ga0495619_0179596 3300053085 Bacteria 1464
292 Ga0500573_0267778 3300053140 Bacteria 871
293 Ga0466962_0009516 3300061719 Bacteria 4660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0147798 Ga0501032_0147798_754_1533 248
2 3300047444 Ga0495675_0226768 Ga0495675_0226768_321_1073 249
3 3300005435 Ga0070714_100085001 Ga0070714_1000850013 250
4 3300005435 Ga0070714_100455621 Ga0070714_1004556211 250
5 3300005436 Ga0070713_100150221 Ga0070713_1001502212 250
6 3300006173 Ga0070716_100123144 Ga0070716_1001231441 250
7 3300006175 Ga0070712_100049471 Ga0070712_1000494712 250
8 3300006175 Ga0070712_100139926 Ga0070712_1001399262 250
9 3300025915 Ga0207693_10072630 Ga0207693_100726302 250
10 3300025929 Ga0207664_10006053 Ga0207664_100060532 250
11 3300025939 Ga0207665_10156646 Ga0207665_101566462 250
12 3300053140 Ga0500573_0267778 Ga0500573_0267778_42_839 255
13 3300046559 Ga0495667_0284402 Ga0495667_0284402_134_1012 259
14 3300005548 Ga0070665_100360823 Ga0070665_1003608232 260
15 3300046463 Ga0495653_0009836 Ga0495653_0009836_4065_4955 260
16 3300046472 Ga0495580_0018856 Ga0495580_0018856_4133_5023 260
17 3300046531 Ga0495665_0001780 Ga0495665_0001780_7102_7992 260
18 3300046533 Ga0495640_0019176 Ga0495640_0019176_2778_3668 260
19 3300046675 Ga0495657_0023332 Ga0495657_0023332_1038_1928 260
20 3300046689 Ga0495613_0026007 Ga0495613_0026007_910_1800 260
21 3300047315 Ga0495581_0007687 Ga0495581_0007687_4027_4917 260
22 3300046454 Ga0495592_0000338 Ga0495592_0000338_128_1018 261
23 3300046476 Ga0495662_0004449 Ga0495662_0004449_2977_3867 261
24 3300046477 Ga0495664_0052209 Ga0495664_0052209_154_1044 261
25 3300046511 Ga0495608_0002874 Ga0495608_0002874_6358_7248 261
26 3300046514 Ga0495618_0196899 Ga0495618_0196899_273_1163 261
27 3300046516 Ga0495628_0023303 Ga0495628_0023303_4062_4952 261
28 3300046526 Ga0495666_0001561 Ga0495666_0001561_5656_6546 261
29 3300046535 Ga0495586_0060455 Ga0495586_0060455_110_1000 261
30 3300046536 Ga0495587_0232594 Ga0495587_0232594_11_901 261
31 3300046543 Ga0495645_0068091 Ga0495645_0068091_1422_2312 261
32 3300046559 Ga0495667_0001521 Ga0495667_0001521_12413_13303 261
33 3300046642 Ga0495634_0123489 Ga0495634_0123489_138_1028 261
34 3300046680 Ga0495646_0014330 Ga0495646_0014330_1474_2364 261
35 3300047317 Ga0495604_0004912 Ga0495604_0004912_5929_6819 261
36 3300047319 Ga0495674_0018852 Ga0495674_0018852_909_1799 261
37 3300047673 Ga0495593_0014505 Ga0495593_0014505_3096_3986 261
38 3300048088 Ga0495602_0174657 Ga0495602_0174657_636_1526 261
39 3300053077 Ga0495601_0002792 Ga0495601_0002792_3441_4331 261
40 3300053085 Ga0495619_0179596 Ga0495619_0179596_127_1017 261
41 3300045976 Ga0466967_0078915 Ga0466967_0078915_1104_1979 262
42 3300048903 Ga0496100_0359812 Ga0496100_0359812_41_955 264
43 3300048905 Ga0496102_0027339 Ga0496102_0027339_4087_5001 264
44 3300048906 Ga0496103_0037287 Ga0496103_0037287_913_1827 264
45 3300048924 Ga0496121_0015520 Ga0496121_0015520_5420_6334 264
46 3300049570 Ga0501033_0037687 Ga0501033_0037687_309_1316 265
47 3300049571 Ga0501034_0098568 Ga0501034_0098568_777_1784 265
48 3300049574 Ga0501038_0017010 Ga0501038_0017010_5442_6449 265
49 3300049581 Ga0501047_0010487 Ga0501047_0010487_5612_6619 265
50 3300049823 Ga0501044_0007995 Ga0501044_0007995_10001_11008 265
51 3300049822 Ga0501035_0010240 Ga0501035_0010240_102_998 267
52 3300049578 Ga0501042_0080525 Ga0501042_0080525_1139_2017 268
53 3300049581 Ga0501047_0000098 Ga0501047_0000098_49347_50225 268
54 3300047444 Ga0495675_0006296 Ga0495675_0006296_2948_3850 269
55 3300010375 Ga0105239_10205381 Ga0105239_102053812 270
56 3300005439 Ga0070711_100261286 Ga0070711_1002612861 271
57 3300005563 Ga0068855_100105095 Ga0068855_1001050952 272
58 3300005614 Ga0068856_100033558 Ga0068856_1000335582 272
59 3300025928 Ga0207700_10242110 Ga0207700_102421102 272
60 3300025949 Ga0207667_10126266 Ga0207667_101262663 272
61 3300026078 Ga0207702_10204584 Ga0207702_102045841 272
62 3300044719 Ga0466971_0008953 Ga0466971_0008953_3186_4094 272
63 3300044842 Ga0466957_0196833 Ga0466957_0196833_110_1018 272
64 3300045836 Ga0466958_0038601 Ga0466958_0038601_647_1555 272
65 3300045976 Ga0466967_0056253 Ga0466967_0056253_370_1278 272
66 3300048919 Ga0496116_0000678 Ga0496116_0000678_7240_8112 272
67 3300048920 Ga0496117_0002351 Ga0496117_0002351_598_1470 272
68 3300048921 Ga0496118_0010040 Ga0496118_0010040_7240_8112 272
69 3300048922 Ga0496119_0017418 Ga0496119_0017418_1314_2186 272
70 3300046476 Ga0495662_0046548 Ga0495662_0046548_692_1564 274
71 3300046516 Ga0495628_0041387 Ga0495628_0041387_911_1783 274
72 3300046529 Ga0495652_0044895 Ga0495652_0044895_1476_2348 274
73 3300046533 Ga0495640_0009593 Ga0495640_0009593_3277_4149 274
74 3300047317 Ga0495604_0025914 Ga0495604_0025914_3379_4251 274
75 3300044842 Ga0466957_0068642 Ga0466957_0068642_322_1158 278
76 3300046524 Ga0495648_0003388 Ga0495648_0003388_1182_2129 278
77 3300046648 Ga0495611_0066943 Ga0495611_0066943_308_1255 278
78 iso_pu_bacteria 2867346516 2867351744 279
79 iso_pu_bacteria 2990088156 2990088164 279
80 3300044684 Ga0466966_0020481 Ga0466966_0020481_2787_3695 281
81 3300044693 Ga0466961_0045034 Ga0466961_0045034_1605_2513 281
82 3300044693 Ga0466961_0233650 Ga0466961_0233650_31_939 281
83 3300044735 Ga0466968_0041512 Ga0466968_0041512_711_1619 281
84 3300045049 Ga0466959_0214853 Ga0466959_0214853_374_1282 281
85 iso_pu_bacteria 2867475112 2867480504 281
86 iso_pu_bacteria 8003830390 8003831228 281
87 3300003323 rootH1_10272836 rootH1_102728361 282
88 3300044656 Ga0466969_0008817 Ga0466969_0008817_3796_4740 282
89 3300044693 Ga0466961_0213923 Ga0466961_0213923_193_1122 282
90 iso_pu_bacteria 3006393351 3006394193 282
91 3300005530 Ga0070679_100530746 Ga0070679_1005307462 284
92 3300009553 Ga0105249_10035459 Ga0105249_100354594 284
93 iso_pu_bacteria 2687453737 2689957097 284
94 3300028800 Ga0265338_10001371 Ga0265338_1000137126 285
95 3300044694 Ga0466963_0043801 Ga0466963_0043801_1665_2597 285
96 3300044719 Ga0466971_0002877 Ga0466971_0002877_5297_6229 285
97 3300045976 Ga0466967_0084783 Ga0466967_0084783_761_1693 285
98 3300061719 Ga0466962_0009516 Ga0466962_0009516_916_1848 285
99 iso_pu_bacteria 8025478263 8025479549 285
100 3300009093 Ga0105240_10338775 Ga0105240_103387751 286
101 3300025913 Ga0207695_10264830 Ga0207695_102648302 286
102 iso_pu_bacteria 2767802112 2768644925 286
103 3300044658 Ga0466972_0155888 Ga0466972_0155888_176_1039 287
104 3300044684 Ga0466966_0153770 Ga0466966_0153770_71_934 287
105 3300044842 Ga0466957_0021527 Ga0466957_0021527_1445_2308 287
106 3300045976 Ga0466967_0026393 Ga0466967_0026393_1996_2859 287
107 3300048929 Ga0496126_0231439 Ga0496126_0231439_520_1386 287
108 iso_pu_bacteria 2990044586 2990047159 287
109 iso_pu_bacteria 2862705112 2862708524 288
110 iso_pu_bacteria 8008485437 8008486762 288
111 iso_pu_bacteria 8025524527 8025525948 288
112 3300009551 Ga0105238_10310025 Ga0105238_103100251 289
113 3300025908 Ga0207643_10027321 Ga0207643_100273213 289
114 3300025924 Ga0207694_10081272 Ga0207694_100812722 289
115 3300045976 Ga0466967_0073468 Ga0466967_0073468_165_1076 289
116 3300048929 Ga0496126_0407593 Ga0496126_0407593_217_1089 289
117 3300048929 Ga0496126_0000013 Ga0496126_0000013_133697_134626 290
118 iso_pu_bacteria 8053945823 8053948545 290
119 iso_pu_bacteria 8056447290 8056454341 290
120 3300028556 Ga0265337_1001006 Ga0265337_10010065 292
121 3300028558 Ga0265326_10000775 Ga0265326_100007757 292
122 3300028573 Ga0265334_10001171 Ga0265334_100011715 292
123 3300028653 Ga0265323_10021836 Ga0265323_100218362 292
124 3300028666 Ga0265336_10001306 Ga0265336_100013066 292
125 3300028800 Ga0265338_10005138 Ga0265338_100051388 292
126 3300029957 Ga0265324_10002104 Ga0265324_100021046 292
127 3300031238 Ga0265332_10001400 Ga0265332_100014006 292
128 3300031240 Ga0265320_10002520 Ga0265320_100025208 292
129 3300031241 Ga0265325_10018211 Ga0265325_100182112 292
130 3300031595 Ga0265313_10005093 Ga0265313_100050933 292
131 3300031711 Ga0265314_10015544 Ga0265314_100155442 292
132 3300033545 Ga0316214_1001935 Ga0316214_10019353 292
133 3300033547 Ga0316212_1003204 Ga0316212_10032042 292
134 3300049571 Ga0501034_0063066 Ga0501034_0063066_1989_2873 292
135 3300049572 Ga0501036_0001729 Ga0501036_0001729_13273_14157 292
136 3300049573 Ga0501037_0021437 Ga0501037_0021437_3547_4431 292
137 3300049574 Ga0501038_0008863 Ga0501038_0008863_7242_8126 292
138 3300049578 Ga0501042_0005531 Ga0501042_0005531_1149_2033 292
139 3300049579 Ga0501043_0003702 Ga0501043_0003702_9871_10755 292
140 3300049581 Ga0501047_0066537 Ga0501047_0066537_1265_2149 292
141 3300049582 Ga0501048_0009101 Ga0501048_0009101_4198_5082 292
142 3300049589 Ga0501073_0195932 Ga0501073_0195932_269_1153 292
143 3300049590 Ga0501074_0002292 Ga0501074_0002292_348_1232 292
144 3300049592 Ga0501076_0272863 Ga0501076_0272863_17_901 292
145 3300049823 Ga0501044_0022473 Ga0501044_0022473_5499_6383 292
146 3300049823 Ga0501044_0254886 Ga0501044_0254886_42_926 292
147 iso_pu_bacteria 3002998708 3003000753 292
148 3300005367 Ga0070667_100212292 Ga0070667_1002122921 294
149 3300025986 Ga0207658_10138816 Ga0207658_101388162 294
150 3300048908 Ga0496105_0227314 Ga0496105_0227314_42_926 294
151 3300048929 Ga0496126_0070176 Ga0496126_0070176_674_1582 294
152 3300044693 Ga0466961_0080573 Ga0466961_0080573_1120_2007 295
153 3300044694 Ga0466963_0172640 Ga0466963_0172640_510_1397 295
154 3300044694 Ga0466963_0329099 Ga0466963_0329099_29_916 295
155 3300044694 Ga0466963_0332692 Ga0466963_0332692_163_1050 295
156 3300045976 Ga0466967_0270795 Ga0466967_0270795_47_934 295
157 iso_pu_bacteria 2997451912 2997456647 295
158 3300049571 Ga0501034_0027791 Ga0501034_0027791_4836_5729 296
159 3300005327 Ga0070658_10030685 Ga0070658_100306855 297
160 3300005329 Ga0070683_100058149 Ga0070683_1000581492 297
161 3300005435 Ga0070714_100000018 Ga0070714_10000001852 297
162 3300025904 Ga0207647_10036174 Ga0207647_100361742 297
163 3300025909 Ga0207705_10097488 Ga0207705_100974882 297
164 3300025944 Ga0207661_10021475 Ga0207661_100214752 297
165 3300045976 Ga0466967_0054597 Ga0466967_0054597_1012_1959 297
166 3300048905 Ga0496102_0002945 Ga0496102_0002945_1203_2096 297
167 3300048906 Ga0496103_0033120 Ga0496103_0033120_584_1477 297
168 3300005334 Ga0068869_100023739 Ga0068869_1000237392 298
169 3300005335 Ga0070666_10104436 Ga0070666_101044362 298
170 3300005338 Ga0068868_100005680 Ga0068868_1000056805 298
171 3300005339 Ga0070660_100086197 Ga0070660_1000861972 298
172 3300005344 Ga0070661_100368113 Ga0070661_1003681132 298
173 3300005356 Ga0070674_100132062 Ga0070674_1001320621 298
174 3300005364 Ga0070673_100105535 Ga0070673_1001055352 298
175 3300005365 Ga0070688_100412036 Ga0070688_1004120361 298
176 3300005366 Ga0070659_100020927 Ga0070659_1000209272 298
177 3300005434 Ga0070709_10121111 Ga0070709_101211112 298
178 3300005435 Ga0070714_100054831 Ga0070714_1000548312 298
179 3300005439 Ga0070711_100065082 Ga0070711_1000650822 298
180 3300005444 Ga0070694_100011216 Ga0070694_1000112162 298
181 3300005455 Ga0070663_100011335 Ga0070663_1000113352 298
182 3300005456 Ga0070678_100044442 Ga0070678_1000444423 298
183 3300005539 Ga0068853_100092664 Ga0068853_1000926642 298
184 3300005543 Ga0070672_100250117 Ga0070672_1002501172 298
185 3300005544 Ga0070686_100012789 Ga0070686_1000127893 298
186 3300005545 Ga0070695_100013451 Ga0070695_1000134513 298
187 3300005546 Ga0070696_100023965 Ga0070696_1000239652 298
188 3300005547 Ga0070693_100010482 Ga0070693_1000104823 298
189 3300005549 Ga0070704_100051836 Ga0070704_1000518362 298
190 3300005577 Ga0068857_100084540 Ga0068857_1000845402 298
191 3300005616 Ga0068852_100014264 Ga0068852_1000142642 298
192 3300005616 Ga0068852_100425645 Ga0068852_1004256451 298
193 3300005617 Ga0068859_100131707 Ga0068859_1001317072 298
194 3300005718 Ga0068866_10198203 Ga0068866_101982032 298
195 3300005719 Ga0068861_100399387 Ga0068861_1003993872 298
196 3300005834 Ga0068851_10125556 Ga0068851_101255562 298
197 3300005843 Ga0068860_100249072 Ga0068860_1002490722 298
198 3300006028 Ga0070717_10027692 Ga0070717_100276922 298
199 3300006163 Ga0070715_10012272 Ga0070715_100122722 298
200 3300006175 Ga0070712_100015408 Ga0070712_1000154082 298
201 3300006237 Ga0097621_100099176 Ga0097621_1000991761 298
202 3300006852 Ga0075433_10149040 Ga0075433_101490402 298
203 3300006871 Ga0075434_100222913 Ga0075434_1002229132 298
204 3300006931 Ga0097620_100131697 Ga0097620_1001316972 298
205 3300009093 Ga0105240_10040929 Ga0105240_100409295 298
206 3300009094 Ga0111539_10179854 Ga0111539_101798542 298
207 3300009098 Ga0105245_10057999 Ga0105245_100579992 298
208 3300009101 Ga0105247_10018464 Ga0105247_100184642 298
209 3300009148 Ga0105243_10024631 Ga0105243_100246314 298
210 3300009174 Ga0105241_10047687 Ga0105241_100476872 298
211 3300009177 Ga0105248_10253696 Ga0105248_102536962 298
212 3300009545 Ga0105237_10181646 Ga0105237_101816462 298
213 3300009551 Ga0105238_10064972 Ga0105238_100649722 298
214 3300009553 Ga0105249_10019303 Ga0105249_100193034 298
215 3300010375 Ga0105239_10074139 Ga0105239_100741393 298
216 3300013104 Ga0157370_10016985 Ga0157370_100169854 298
217 3300013105 Ga0157369_10271215 Ga0157369_102712152 298
218 3300013297 Ga0157378_10081438 Ga0157378_100814381 298
219 3300013306 Ga0163162_10024677 Ga0163162_100246773 298
220 3300013307 Ga0157372_10116921 Ga0157372_101169212 298
221 3300014326 Ga0157380_10012958 Ga0157380_100129582 298
222 3300014745 Ga0157377_10005939 Ga0157377_100059393 298
223 3300014968 Ga0157379_10011013 Ga0157379_100110136 298
224 3300014969 Ga0157376_10107664 Ga0157376_101076642 298
225 3300017792 Ga0163161_10017589 Ga0163161_100175893 298
226 3300025901 Ga0207688_10000555 Ga0207688_1000055517 298
227 3300025903 Ga0207680_10147112 Ga0207680_101471121 298
228 3300025915 Ga0207693_10014077 Ga0207693_100140772 298
229 3300025918 Ga0207662_10088653 Ga0207662_100886532 298
230 3300025919 Ga0207657_10003612 Ga0207657_100036122 298
231 3300025927 Ga0207687_10010959 Ga0207687_100109594 298
232 3300025928 Ga0207700_10150883 Ga0207700_101508832 298
233 3300025939 Ga0207665_10000738 Ga0207665_1000073811 298
234 3300025942 Ga0207689_10009684 Ga0207689_100096842 298
235 3300025949 Ga0207667_10050156 Ga0207667_100501562 298
236 3300025960 Ga0207651_10150455 Ga0207651_101504551 298
237 3300025961 Ga0207712_10017535 Ga0207712_100175354 298
238 3300026023 Ga0207677_10064310 Ga0207677_100643102 298
239 3300026041 Ga0207639_10087656 Ga0207639_100876562 298
240 3300026067 Ga0207678_10006594 Ga0207678_100065947 298
241 3300026116 Ga0207674_10043118 Ga0207674_100431183 298
242 3300026118 Ga0207675_100016686 Ga0207675_1000166866 298
243 3300026121 Ga0207683_10003061 Ga0207683_100030614 298
244 3300026142 Ga0207698_10004406 Ga0207698_100044068 298
245 3300026142 Ga0207698_10073777 Ga0207698_100737772 298
246 3300028379 Ga0268266_10200530 Ga0268266_102005302 298
247 3300035088 Ga0373940_0002251 Ga0373940_0002251_342_1256 298
248 3300035091 Ga0373951_0011157 Ga0373951_0011157_999_1913 298
249 3300035092 Ga0373952_0003851 Ga0373952_0003851_856_1770 298
250 3300046461 Ga0495641_0039192 Ga0495641_0039192_1157_2071 298
251 3300048904 Ga0496101_0129512 Ga0496101_0129512_301_1215 298
252 3300048905 Ga0496102_0118285 Ga0496102_0118285_1294_2208 298
253 3300048907 Ga0496104_0094350 Ga0496104_0094350_1585_2499 298
254 3300048909 Ga0496106_0014208 Ga0496106_0014208_819_1733 298
255 3300048910 Ga0496107_0013942 Ga0496107_0013942_461_1375 298
256 3300048911 Ga0496108_0012355 Ga0496108_0012355_700_1614 298
257 3300048912 Ga0496109_0169852 Ga0496109_0169852_831_1745 298
258 3300048913 Ga0496110_0203818 Ga0496110_0203818_826_1740 298
259 3300048914 Ga0496111_0007235 Ga0496111_0007235_208_1122 298
260 3300048915 Ga0496112_0030495 Ga0496112_0030495_4157_5071 298
261 3300048916 Ga0496113_0133662 Ga0496113_0133662_97_1011 298
262 3300048917 Ga0496114_0026772 Ga0496114_0026772_129_1043 298
263 3300048918 Ga0496115_0022198 Ga0496115_0022198_2327_3241 298
264 3300048923 Ga0496120_0003348 Ga0496120_0003348_9935_10831 298
265 3300050512 nmdc:mga0n895_542892_c1 nmdc:mga0n895_542892_c1_104_1018 298
266 3300050514 nmdc:mga08x19_36145_c1 nmdc:mga08x19_36145_c1_2124_3038 298
267 3300005614 Ga0068856_100010978 Ga0068856_1000109782 300
268 3300009093 Ga0105240_10083142 Ga0105240_100831422 300
269 3300009545 Ga0105237_10070102 Ga0105237_100701022 300
270 3300010375 Ga0105239_10006071 Ga0105239_100060715 300
271 3300025914 Ga0207671_10059831 Ga0207671_100598312 300
272 3300025981 Ga0207640_10071130 Ga0207640_100711302 300
273 3300026078 Ga0207702_10004368 Ga0207702_100043687 300
274 3300005468 Ga0070707_100343028 Ga0070707_1003430282 302
275 3300005563 Ga0068855_100013787 Ga0068855_1000137872 302
276 3300005614 Ga0068856_100227069 Ga0068856_1002270692 302
277 3300009174 Ga0105241_10057288 Ga0105241_100572882 302
278 3300009545 Ga0105237_10102890 Ga0105237_101028902 302
279 3300009551 Ga0105238_10286101 Ga0105238_102861011 302
280 3300025904 Ga0207647_10026129 Ga0207647_100261292 302
281 3300025911 Ga0207654_10107789 Ga0207654_101077891 302
282 3300025949 Ga0207667_10062966 Ga0207667_100629663 302
283 3300026078 Ga0207702_10196752 Ga0207702_101967522 302
284 3300026142 Ga0207698_10350934 Ga0207698_103509342 302
285 3300044658 Ga0466972_0011748 Ga0466972_0011748_1857_2765 302
286 3300044684 Ga0466966_0036332 Ga0466966_0036332_504_1433 302
287 3300044693 Ga0466961_0025733 Ga0466961_0025733_297_1226 302
288 3300044694 Ga0466963_0037616 Ga0466963_0037616_10_918 302
289 3300044694 Ga0466963_0177193 Ga0466963_0177193_191_1120 302
290 3300044694 Ga0466963_0257746 Ga0466963_0257746_196_1104 302
291 3300044765 Ga0466970_0029491 Ga0466970_0029491_106_1014 302
292 3300044765 Ga0466970_0054244 Ga0466970_0054244_13_951 302
293 3300045049 Ga0466959_0144974 Ga0466959_0144974_398_1306 302
294 3300045976 Ga0466967_0006625 Ga0466967_0006625_2521_3429 302
295 3300045976 Ga0466967_0087452 Ga0466967_0087452_1142_2071 302
296 3300045976 Ga0466967_0103963 Ga0466967_0103963_1078_1986 302
297 3300049823 Ga0501044_0247654 Ga0501044_0247654_62_991 302
298 3300037853 Ga0436364_0729892 Ga0436364_0729892_3877_4821 303
299 3300048911 Ga0496108_0018475 Ga0496108_0018475_1775_2695 303
300 3300048912 Ga0496109_0030496 Ga0496109_0030496_3643_4563 303
301 3300044694 Ga0466963_0026471 Ga0466963_0026471_967_1881 304
302 3300044719 Ga0466971_0070774 Ga0466971_0070774_71_985 304
303 3300045976 Ga0466967_0032872 Ga0466967_0032872_1834_2748 304
304 3300045976 Ga0466967_0716583 Ga0466967_0716583_32_946 304
305 iso_pu_bacteria 2675902999 2676205124 305
306 iso_pu_bacteria 2773857921 2774849699 305
307 iso_pu_bacteria 8002775197 8002782666 305
308 3300025929 Ga0207664_10000003 Ga0207664_10000003404 307
309 3300025938 Ga0207704_10151124 Ga0207704_101511242 308
310 3300025961 Ga0207712_10529991 Ga0207712_105299911 308
311 iso_pu_bacteria 2517572101 2517764102 310
312 3300002067 JGI24735J21928_10023163 JGI24735J21928_100231631 313
313 3300005367 Ga0070667_100069536 Ga0070667_1000695362 313
314 iso_pu_bacteria 3006425503 3006426846 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

49

310

0.76

PF12730

ABC2_membrane_4

ABC-2 family transporter protein

49

246

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.703 48 309
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.6865 48 309
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.676 48 309
7znq-assembly1.cif.gz_y abc transporter complex nosdfyl in gdn 0.6702 48 310
7o17-assembly1.cif.gz_E abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.6606 48 309
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6648 108 305 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5793 94 305 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4433 108 305 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.398 94 305 3.40.1710.10
af_A0A0R0L9H2_4_217_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3304 60 304 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A6B3HHE6-F1-model_v4 ABC transporter permease 0.9605 193 313 GO:0016020
AF-A0A3M2MD51-F1-model_v4 ABC transporter permease 0.9576 38 313 GO:0005886
GO:0140359
AF-A0A2H5AX16-F1-model_v4 ABC transporter permease 0.9519 67 313 GO:0005886
GO:0140359
AF-A0A5B7UTE0-F1-model_v4 ABC-2 family transporter protein 0.9458 36 313 GO:0016020
AF-A0A536LXN7-F1-model_v4 ABC transporter permease 0.9452 102 313 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.32 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map