F402811

General Info

Members Datasets Scaffolds Average Seq Length
314 154 628 245

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0075907|Ga0466963_0075907_1074_1847
Length 257
Sequence MVVTASYGSGAMELGLRDKVCLVTGSTAGIGLRVAEQLREEGAHVVTTGRRDDGIGDLHVAADLTRHGEPERVVAAVLERFGRLDGLVNNAGGTDIRKLDELTDDDWQRSFELNLMSAVRTTRAALPSMRRGSAIVNVSSSAGKRPSATMPDYSVMKAALLSYSRLVADLHAKDGIRCNAVTPGPTATDAWLGAGGLAEQQGDRDEVLAKVGAGRPLGRLAEPDEIAAVIVFLLSERASFVTGAAWSTDGGTVAIII

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.24
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0075907 3300044694 Bacteria 2269
2 rootH1_10022582 3300003323 Unclassified 1544
3 Ga0070658_10020135 3300005327 Bacteria 5344
4 Ga0070683_100359484 3300005329 Bacteria 1387
5 Ga0070683_100532828 3300005329 Bacteria 1122
6 Ga0070680_100007599 3300005336 Bacteria 8268
7 Ga0070680_100207653 3300005336 Bacteria 1652
8 Ga0070680_100388932 3300005336 Bacteria 1188
9 Ga0070682_100057173 3300005337 Bacteria 2456
10 Ga0070660_100011474 3300005339 Bacteria 6298
11 Ga0070660_100011767 3300005339 Bacteria 6231
12 Ga0070660_100187542 3300005339 Bacteria 1675
13 Ga0070661_100037926 3300005344 Bacteria 3507
14 Ga0070661_100201081 3300005344 Bacteria 1522
15 Ga0070659_100008726 3300005366 Bacteria 7417
16 Ga0070659_100558018 3300005366 Bacteria 981
17 Ga0070709_10106388 3300005434 Bacteria 1878
18 Ga0070714_100214845 3300005435 Bacteria 1765
19 Ga0070713_100021458 3300005436 Bacteria 4969
20 Ga0070713_100053970 3300005436 Bacteria 3332
21 Ga0070710_10045339 3300005437 Bacteria 2444
22 Ga0070711_100027428 3300005439 Bacteria 3739
23 Ga0070694_100040379 3300005444 Bacteria 3111
24 Ga0070678_100317641 3300005456 Bacteria 1329
25 Ga0070681_10017938 3300005458 Bacteria 7075
26 Ga0070681_10040916 3300005458 Bacteria 4643
27 Ga0070681_10048466 3300005458 Bacteria 4245
28 Ga0070681_10059486 3300005458 Bacteria 3801
29 Ga0070681_10438813 3300005458 Bacteria 1218
30 Ga0070706_100429726 3300005467 Bacteria 1229
31 Ga0070707_100159767 3300005468 Bacteria 2196
32 Ga0070707_100376098 3300005468 Bacteria 1380
33 Ga0070679_100030208 3300005530 Bacteria 5349
34 Ga0070679_100049177 3300005530 Bacteria 4199
35 Ga0070679_100065344 3300005530 Bacteria 3626
36 Ga0070679_100287314 3300005530 Bacteria 1596
37 Ga0070679_100296662 3300005530 Bacteria 1567
38 Ga0070679_100882914 3300005530 Bacteria 837
39 Ga0070684_100248320 3300005535 Bacteria 1626
40 Ga0068853_100391345 3300005539 Bacteria 1300
41 Ga0068853_100734801 3300005539 Bacteria 943
42 Ga0070695_100005413 3300005545 Bacteria 7515
43 Ga0070665_100011283 3300005548 Bacteria 9036
44 Ga0068855_100018942 3300005563 Bacteria 8275
45 Ga0068855_100024407 3300005563 Bacteria 7233
46 Ga0068855_100061939 3300005563 Bacteria 4369
47 Ga0068855_100179192 3300005563 Bacteria 2396
48 Ga0068855_100266411 3300005563 Bacteria 1907
49 Ga0068855_100489025 3300005563 Bacteria 1339
50 Ga0068856_100056578 3300005614 Bacteria 3870
51 Ga0068856_100114527 3300005614 Bacteria 2696
52 Ga0068856_100716510 3300005614 Bacteria 1021
53 Ga0070717_10010708 3300006028 Bacteria 6938
54 Ga0070717_10108960 3300006028 Bacteria 2360
55 Ga0105240_10061687 3300009093 Bacteria 4671
56 Ga0105240_10146025 3300009093 Bacteria 2822
57 Ga0105240_11058266 3300009093 Bacteria 865
58 Ga0105240_11285791 3300009093 Bacteria 772
59 Ga0105245_10394627 3300009098 Bacteria 1381
60 Ga0114129_10051392 3300009147 Bacteria 5786
61 Ga0105237_10022063 3300009545 Bacteria 6535
62 Ga0105237_10046900 3300009545 Bacteria 4344
63 Ga0105237_10173179 3300009545 Bacteria 2158
64 Ga0105238_10028455 3300009551 Bacteria 5693
65 Ga0105238_10253065 3300009551 Bacteria 1740
66 Ga0105239_10096878 3300010375 Bacteria 3259
67 Ga0157370_10019054 3300013104 Bacteria 6898
68 Ga0157370_10706565 3300013104 Bacteria 920
69 Ga0157370_10872627 3300013104 Bacteria 817
70 Ga0157369_10031978 3300013105 Bacteria 5789
71 Ga0157369_10072040 3300013105 Bacteria 3709
72 Ga0157369_10198006 3300013105 Bacteria 2109
73 Ga0157369_10390959 3300013105 Bacteria 1443
74 Ga0157369_10431241 3300013105 Bacteria 1366
75 Ga0157374_10121913 3300013296 Bacteria 2517
76 Ga0157374_10168751 3300013296 Bacteria 2134
77 Ga0157378_10144522 3300013297 Bacteria 2211
78 Ga0157372_10142981 3300013307 Bacteria 2758
79 Ga0157372_10379796 3300013307 Bacteria 1646
80 Ga0157375_10064339 3300013308 Bacteria 3651
81 Ga0182008_10038330 3300014497 Bacteria 2396
82 Ga0182008_10279967 3300014497 Bacteria 868
83 Ga0197907_10937721 3300020069 Bacteria 975
84 Ga0206356_10134314 3300020070 Bacteria 1290
85 Ga0206356_10738257 3300020070 Bacteria 1512
86 Ga0206354_11059094 3300020081 Bacteria 1333
87 Ga0206354_11181670 3300020081 Bacteria 1886
88 Ga0206353_10345266 3300020082 Bacteria 4150
89 Ga0206353_10345561 3300020082 Bacteria 1375
90 Ga0207692_10038424 3300025898 Bacteria 2347
91 Ga0207710_10056575 3300025900 Bacteria 1770
92 Ga0207705_10045468 3300025909 Bacteria 3155
93 Ga0207705_10069700 3300025909 Bacteria 2547
94 Ga0207705_10552951 3300025909 Bacteria 895
95 Ga0207654_10109578 3300025911 Bacteria 1715
96 Ga0207654_10414926 3300025911 Bacteria 938
97 Ga0207707_10020861 3300025912 Bacteria 5723
98 Ga0207707_10035099 3300025912 Bacteria 4386
99 Ga0207707_10182313 3300025912 Bacteria 1833
100 Ga0207707_10424174 3300025912 Bacteria 1140
101 Ga0207695_10114418 3300025913 Bacteria 2673
102 Ga0207695_10591400 3300025913 Bacteria 991
103 Ga0207663_10009013 3300025916 Bacteria 5253
104 Ga0207660_10243516 3300025917 Bacteria 1417
105 Ga0207657_10002710 3300025919 Bacteria 19085
106 Ga0207657_10016631 3300025919 Bacteria 7087
107 Ga0207657_10021820 3300025919 Bacteria 6015
108 Ga0207657_10024850 3300025919 Bacteria 5538
109 Ga0207657_10149129 3300025919 Bacteria 1906
110 Ga0207657_10626991 3300025919 Bacteria 838
111 Ga0207649_10026349 3300025920 Bacteria 3400
112 Ga0207652_10035020 3300025921 Bacteria 4235
113 Ga0207652_10099956 3300025921 Bacteria 2560
114 Ga0207652_10308233 3300025921 Bacteria 1429
115 Ga0207646_10163852 3300025922 Bacteria 2007
116 Ga0207646_10301997 3300025922 Bacteria 1446
117 Ga0207694_10085461 3300025924 Bacteria 2483
118 Ga0207694_10132853 3300025924 Bacteria 1996
119 Ga0207687_10412321 3300025927 Bacteria 1113
120 Ga0207700_10023624 3300025928 Bacteria 4243
121 Ga0207700_10086849 3300025928 Bacteria 2459
122 Ga0207664_10024994 3300025929 Bacteria 4493
123 Ga0207664_10063320 3300025929 Bacteria 2956
124 Ga0207664_10088896 3300025929 Bacteria 2529
125 Ga0207690_10155859 3300025932 Bacteria 1698
126 Ga0207661_10406414 3300025944 Bacteria 1235
127 Ga0207667_10086323 3300025949 Bacteria 3247
128 Ga0207667_10339059 3300025949 Bacteria 1534
129 Ga0207667_10384247 3300025949 Bacteria 1430
130 Ga0207667_10512887 3300025949 Bacteria 1215
131 Ga0207640_10828849 3300025981 Bacteria 803
132 Ga0207639_10588919 3300026041 Bacteria 1025
133 Ga0207702_10078913 3300026078 Bacteria 2851
134 Ga0207702_10287466 3300026078 Bacteria 1557
135 Ga0207702_10457298 3300026078 Bacteria 1239
136 Ga0207702_10496232 3300026078 Bacteria 1190
137 Ga0207674_10102928 3300026116 Bacteria 2835
138 Ga0207698_10134636 3300026142 Bacteria 2118
139 Ga0265334_10025212 3300028573 Bacteria 2408
140 Ga0265336_10008007 3300028666 Bacteria 3729
141 Ga0265336_10072236 3300028666 Bacteria 1031
142 Ga0265338_10006432 3300028800 Bacteria 14974
143 Ga0265338_10016845 3300028800 Bacteria 7916
144 Ga0265338_10023271 3300028800 Bacteria 6375
145 Ga0265338_10078801 3300028800 Bacteria 2776
146 Ga0265338_10089014 3300028800 Bacteria 2559
147 Ga0265338_10287411 3300028800 Bacteria 1199
148 Ga0265324_10016586 3300029957 Bacteria 2686
149 Ga0265324_10032265 3300029957 Bacteria 1831
150 Ga0265325_10015834 3300031241 Bacteria 4229
151 Ga0265329_10015352 3300031242 Bacteria 2676
152 Ga0265340_10057099 3300031247 Bacteria 1876
153 Ga0265339_10065058 3300031249 Bacteria 1955
154 Ga0265339_10095157 3300031249 Bacteria 1556
155 Ga0265331_10068889 3300031250 Bacteria 1658
156 Ga0265327_10011799 3300031251 Bacteria 5973
157 Ga0265316_10010795 3300031344 Bacteria 8298
158 Ga0265316_10141306 3300031344 Bacteria 1808
159 Ga0265313_10009467 3300031595 Bacteria 6322
160 Ga0265313_10063632 3300031595 Bacteria 1719
161 Ga0265313_10126483 3300031595 Bacteria 1111
162 Ga0265314_10014152 3300031711 Bacteria 6401
163 Ga0265314_10031609 3300031711 Bacteria 3904
164 Ga0265314_10247453 3300031711 Bacteria 1025
165 Ga0265342_10103812 3300031712 Bacteria 1616
166 Ga0307406_10309785 3300031901 Bacteria 1217
167 Ga0307416_100073793 3300032002 Bacteria 2847
168 Ga0373944_0006751 3300035089 Bacteria 3055
169 Ga0373936_0004952 3300035113 Bacteria 5016
170 Ga0373945_0015473 3300035116 Bacteria 2567
171 Ga0373956_0245689 3300035119 Bacteria 851
172 Ga0373943_0001158 3300035170 Bacteria 11773
173 Ga0373946_0087664 3300035171 Bacteria 1374
174 Ga0373924_0036941 3300035410 Bacteria 1987
175 Ga0373947_0006697 3300035725 Bacteria 6686
176 Ga0373937_0035616 3300036401 Bacteria 4531
177 Ga0395899_0015742 3300037312 Bacteria 5765
178 Ga0395900_0079310 3300037418 Bacteria 3373
179 Ga0395900_0095535 3300037418 Bacteria 3054
180 Ga0395900_0116871 3300037418 Bacteria 2737
181 Ga0395900_0429999 3300037418 Bacteria 1280
182 Ga0395898_0056556 3300037466 Bacteria 3823
183 Ga0395898_0109133 3300037466 Bacteria 2653
184 Ga0395898_0211329 3300037466 Bacteria 1851
185 Ga0395898_0830709 3300037466 Bacteria 864
186 Ga0395905_0021234 3300037471 Bacteria 6144
187 Ga0395901_0076870 3300038443 Bacteria 3483
188 Ga0436365_0437123 3300039437 Bacteria 1388
189 Ga0436365_1874631 3300039437 Bacteria 1393
190 Ga0436360_0118243 3300039438 Bacteria 1849
191 Ga0436360_0232500 3300039438 Bacteria 8369
192 Ga0466969_0066455 3300044656 Bacteria 1741
193 Ga0466961_0127718 3300044693 Bacteria 1594
194 Ga0466961_0167126 3300044693 Bacteria 1369
195 Ga0466961_0304125 3300044693 Bacteria 974
196 Ga0466961_0341243 3300044693 Bacteria 912
197 Ga0466961_0420749 3300044693 Bacteria 810
198 Ga0466963_0005120 3300044694 Bacteria 7658
199 Ga0466963_0006364 3300044694 Bacteria 6984
200 Ga0466963_0017538 3300044694 Bacteria 4464
201 Ga0466963_0026395 3300044694 Bacteria 3715
202 Ga0466963_0041979 3300044694 Bacteria 3001
203 Ga0466963_0046257 3300044694 Bacteria 2868
204 Ga0466963_0050390 3300044694 Bacteria 2756
205 Ga0466963_0066801 3300044694 Bacteria 2412
206 Ga0466963_0149100 3300044694 Bacteria 1624
207 Ga0466964_0005704 3300044706 Bacteria 4633
208 Ga0466964_0018649 3300044706 Bacteria 2664
209 Ga0466964_0061502 3300044706 Bacteria 1564
210 Ga0466964_0099650 3300044706 Bacteria 1279
211 Ga0466964_0125825 3300044706 Bacteria 1161
212 Ga0466971_0140669 3300044719 Bacteria 1123
213 Ga0466971_0147705 3300044719 Bacteria 1096
214 Ga0466957_0010935 3300044842 Bacteria 5220
215 Ga0466957_0025931 3300044842 Bacteria 3475
216 Ga0466957_0043122 3300044842 Bacteria 2731
217 Ga0466957_0055958 3300044842 Bacteria 2411
218 Ga0466957_0121367 3300044842 Bacteria 1666
219 Ga0466960_0073862 3300044901 Bacteria 1703
220 Ga0466960_0182754 3300044901 Bacteria 1137
221 Ga0466960_0274543 3300044901 Bacteria 943
222 Ga0466959_0070609 3300045049 Bacteria 2530
223 Ga0466959_0080993 3300045049 Bacteria 2340
224 Ga0466958_0010553 3300045836 Bacteria 5178
225 Ga0466958_0019396 3300045836 Bacteria 3958
226 Ga0466958_0045583 3300045836 Bacteria 2645
227 Ga0466958_0157271 3300045836 Bacteria 1435
228 Ga0466967_0008374 3300045976 Bacteria 7569
229 Ga0466967_0037392 3300045976 Bacteria 4154
230 Ga0466967_0038189 3300045976 Bacteria 4116
231 Ga0466967_0056272 3300045976 Bacteria 3467
232 Ga0466967_0067524 3300045976 Bacteria 3190
233 Ga0466967_0110198 3300045976 Bacteria 2528
234 Ga0466967_0130107 3300045976 Bacteria 2335
235 Ga0466967_0145176 3300045976 Bacteria 2213
236 Ga0466967_0177770 3300045976 Bacteria 2005
237 Ga0466967_0256267 3300045976 Bacteria 1673
238 Ga0466967_0279099 3300045976 Bacteria 1602
239 Ga0466967_0383228 3300045976 Bacteria 1365
240 Ga0466967_0447738 3300045976 Bacteria 1262
241 Ga0466967_0715232 3300045976 Bacteria 992
242 Ga0495592_0029483 3300046454 Bacteria 4155
243 Ga0495603_0037036 3300046455 Bacteria 2927
244 Ga0495629_0007118 3300046459 Bacteria 8241
245 Ga0495641_0040825 3300046461 Bacteria 2157
246 Ga0495653_0121392 3300046463 Bacteria 1862
247 Ga0495582_0095781 3300046473 Bacteria 1658
248 Ga0495664_0014890 3300046477 Bacteria 4415
249 Ga0495664_0128716 3300046477 Bacteria 1532
250 Ga0495628_0058488 3300046516 Bacteria 3028
251 Ga0495630_0110379 3300046517 Bacteria 2083
252 Ga0495630_0476869 3300046517 Bacteria 956
253 Ga0495652_0072405 3300046529 Bacteria 2873
254 Ga0495652_0140856 3300046529 Bacteria 1896
255 Ga0495652_0400810 3300046529 Unclassified 971
256 Ga0495640_0067649 3300046533 Bacteria 2406
257 Ga0495640_0440064 3300046533 Bacteria 797
258 Ga0495587_0091829 3300046536 Bacteria 1753
259 Ga0495587_0180174 3300046536 Bacteria 1198
260 Ga0495645_0017775 3300046543 Bacteria 5099
261 Ga0495667_0237759 3300046559 Bacteria 1161
262 Ga0495599_0044527 3300046678 Bacteria 2783
263 Ga0495647_0077799 3300046681 Bacteria 1340
264 Ga0495658_0016388 3300046683 Bacteria 3814
265 Ga0495658_0044534 3300046683 Bacteria 2487
266 Ga0495658_0046887 3300046683 Bacteria 2431
267 Ga0495613_0178995 3300046689 Bacteria 1502
268 Ga0495604_0045876 3300047317 Bacteria 3409
269 Ga0495604_0193757 3300047317 Bacteria 1414
270 Ga0495604_0385656 3300047317 Bacteria 925
271 Ga0495684_0155125 3300047471 Bacteria 1710
272 Ga0495593_0063714 3300047673 Bacteria 1925
273 Ga0496100_0010595 3300048903 Bacteria 5222
274 Ga0496101_0001361 3300048904 Bacteria 14635
275 Ga0496102_0010974 3300048905 Bacteria 7807
276 Ga0496102_0041177 3300048905 Bacteria 4182
277 Ga0496103_0049892 3300048906 Bacteria 2588
278 Ga0496104_0002527 3300048907 Bacteria 15765
279 Ga0496104_0194097 3300048907 Bacteria 1942
280 Ga0496104_0267370 3300048907 Bacteria 1622
281 Ga0496105_0006492 3300048908 Bacteria 8990
282 Ga0496105_0051574 3300048908 Bacteria 3398
283 Ga0496105_0219202 3300048908 Bacteria 1549
284 Ga0496106_0003504 3300048909 Bacteria 11694
285 Ga0496107_0003591 3300048910 Bacteria 10402
286 Ga0496107_0124949 3300048910 Bacteria 1897
287 Ga0496108_0190824 3300048911 Bacteria 1776
288 Ga0496108_1024345 3300048911 Bacteria 704
289 Ga0496109_0002570 3300048912 Bacteria 15204
290 Ga0496109_0281489 3300048912 Bacteria 1567
291 Ga0496110_0006814 3300048913 Bacteria 9086
292 Ga0496111_0004379 3300048914 Bacteria 8918
293 Ga0496111_0120748 3300048914 Bacteria 1935
294 Ga0496112_0002534 3300048915 Bacteria 14751
295 Ga0496112_0007263 3300048915 Bacteria 9820
296 Ga0496112_0145967 3300048915 Bacteria 2334
297 Ga0496112_0159805 3300048915 Bacteria 2220
298 Ga0496112_0521739 3300048915 Bacteria 1122
299 Ga0496113_0151088 3300048916 Bacteria 1832
300 Ga0496114_0002399 3300048917 Bacteria 14271
301 Ga0496115_0007925 3300048918 Bacteria 7835
302 Ga0501067_0001025 3300049583 Bacteria 15041
303 Ga0501067_0006754 3300049583 Bacteria 6363
304 Ga0501067_0044518 3300049583 Bacteria 2465
305 Ga0501067_0062544 3300049583 Bacteria 2060
306 Ga0501068_0225382 3300049584 Bacteria 1192
307 Ga0501069_0135325 3300049585 Bacteria 1412
308 Ga0501071_0666273 3300049587 Bacteria 801
309 nmdc:mga05p37_124454_c1 3300050507 Bacteria 3167
310 nmdc:mga06r32_640747_c1 3300050510 Bacteria 1031
311 Ga0495619_0112664 3300053085 Bacteria 1860
312 Ga0495619_0314621 3300053085 Bacteria 1084
313 Ga0530510_0018956 3300061734 Bacteria 4880
314 Ga0530510_0137386 3300061734 Bacteria 1800
315 Ga0466963_0075907
316 rootH1_10022582
317 Ga0070658_10020135
318 Ga0070683_100359484
319 Ga0070683_100532828
320 Ga0070680_100007599
321 Ga0070680_100207653
322 Ga0070680_100388932
323 Ga0070682_100057173
324 Ga0070660_100011474
325 Ga0070660_100011767
326 Ga0070660_100187542
327 Ga0070661_100037926
328 Ga0070661_100201081
329 Ga0070659_100008726
330 Ga0070659_100558018
331 Ga0070709_10106388
332 Ga0070714_100214845
333 Ga0070713_100021458
334 Ga0070713_100053970
335 Ga0070710_10045339
336 Ga0070711_100027428
337 Ga0070694_100040379
338 Ga0070678_100317641
339 Ga0070681_10017938
340 Ga0070681_10040916
341 Ga0070681_10048466
342 Ga0070681_10059486
343 Ga0070681_10438813
344 Ga0070706_100429726
345 Ga0070707_100159767
346 Ga0070707_100376098
347 Ga0070679_100030208
348 Ga0070679_100049177
349 Ga0070679_100065344
350 Ga0070679_100287314
351 Ga0070679_100296662
352 Ga0070679_100882914
353 Ga0070684_100248320
354 Ga0068853_100391345
355 Ga0068853_100734801
356 Ga0070695_100005413
357 Ga0070665_100011283
358 Ga0068855_100018942
359 Ga0068855_100024407
360 Ga0068855_100061939
361 Ga0068855_100179192
362 Ga0068855_100266411
363 Ga0068855_100489025
364 Ga0068856_100056578
365 Ga0068856_100114527
366 Ga0068856_100716510
367 Ga0070717_10010708
368 Ga0070717_10108960
369 Ga0105240_10061687
370 Ga0105240_10146025
371 Ga0105240_11058266
372 Ga0105240_11285791
373 Ga0105245_10394627
374 Ga0114129_10051392
375 Ga0105237_10022063
376 Ga0105237_10046900
377 Ga0105237_10173179
378 Ga0105238_10028455
379 Ga0105238_10253065
380 Ga0105239_10096878
381 Ga0157370_10019054
382 Ga0157370_10706565
383 Ga0157370_10872627
384 Ga0157369_10031978
385 Ga0157369_10072040
386 Ga0157369_10198006
387 Ga0157369_10390959
388 Ga0157369_10431241
389 Ga0157374_10121913
390 Ga0157374_10168751
391 Ga0157378_10144522
392 Ga0157372_10142981
393 Ga0157372_10379796
394 Ga0157375_10064339
395 Ga0182008_10038330
396 Ga0182008_10279967
397 Ga0197907_10937721
398 Ga0206356_10134314
399 Ga0206356_10738257
400 Ga0206354_11059094
401 Ga0206354_11181670
402 Ga0206353_10345266
403 Ga0206353_10345561
404 Ga0207692_10038424
405 Ga0207710_10056575
406 Ga0207705_10045468
407 Ga0207705_10069700
408 Ga0207705_10552951
409 Ga0207654_10109578
410 Ga0207654_10414926
411 Ga0207707_10020861
412 Ga0207707_10035099
413 Ga0207707_10182313
414 Ga0207707_10424174
415 Ga0207695_10114418
416 Ga0207695_10591400
417 Ga0207663_10009013
418 Ga0207660_10243516
419 Ga0207657_10002710
420 Ga0207657_10016631
421 Ga0207657_10021820
422 Ga0207657_10024850
423 Ga0207657_10149129
424 Ga0207657_10626991
425 Ga0207649_10026349
426 Ga0207652_10035020
427 Ga0207652_10099956
428 Ga0207652_10308233
429 Ga0207646_10163852
430 Ga0207646_10301997
431 Ga0207694_10085461
432 Ga0207694_10132853
433 Ga0207687_10412321
434 Ga0207700_10023624
435 Ga0207700_10086849
436 Ga0207664_10024994
437 Ga0207664_10063320
438 Ga0207664_10088896
439 Ga0207690_10155859
440 Ga0207661_10406414
441 Ga0207667_10086323
442 Ga0207667_10339059
443 Ga0207667_10384247
444 Ga0207667_10512887
445 Ga0207640_10828849
446 Ga0207639_10588919
447 Ga0207702_10078913
448 Ga0207702_10287466
449 Ga0207702_10457298
450 Ga0207702_10496232
451 Ga0207674_10102928
452 Ga0207698_10134636
453 Ga0265334_10025212
454 Ga0265336_10008007
455 Ga0265336_10072236
456 Ga0265338_10006432
457 Ga0265338_10016845
458 Ga0265338_10023271
459 Ga0265338_10078801
460 Ga0265338_10089014
461 Ga0265338_10287411
462 Ga0265324_10016586
463 Ga0265324_10032265
464 Ga0265325_10015834
465 Ga0265329_10015352
466 Ga0265340_10057099
467 Ga0265339_10065058
468 Ga0265339_10095157
469 Ga0265331_10068889
470 Ga0265327_10011799
471 Ga0265316_10010795
472 Ga0265316_10141306
473 Ga0265313_10009467
474 Ga0265313_10063632
475 Ga0265313_10126483
476 Ga0265314_10014152
477 Ga0265314_10031609
478 Ga0265314_10247453
479 Ga0265342_10103812
480 Ga0307406_10309785
481 Ga0307416_100073793
482 Ga0373944_0006751
483 Ga0373936_0004952
484 Ga0373945_0015473
485 Ga0373956_0245689
486 Ga0373943_0001158
487 Ga0373946_0087664
488 Ga0373924_0036941
489 Ga0373947_0006697
490 Ga0373937_0035616
491 Ga0395899_0015742
492 Ga0395900_0079310
493 Ga0395900_0095535
494 Ga0395900_0116871
495 Ga0395900_0429999
496 Ga0395898_0056556
497 Ga0395898_0109133
498 Ga0395898_0211329
499 Ga0395898_0830709
500 Ga0395905_0021234
501 Ga0395901_0076870
502 Ga0436365_0437123
503 Ga0436365_1874631
504 Ga0436360_0118243
505 Ga0436360_0232500
506 Ga0466969_0066455
507 Ga0466961_0127718
508 Ga0466961_0167126
509 Ga0466961_0304125
510 Ga0466961_0341243
511 Ga0466961_0420749
512 Ga0466963_0005120
513 Ga0466963_0006364
514 Ga0466963_0017538
515 Ga0466963_0026395
516 Ga0466963_0041979
517 Ga0466963_0046257
518 Ga0466963_0050390
519 Ga0466963_0066801
520 Ga0466963_0149100
521 Ga0466964_0005704
522 Ga0466964_0018649
523 Ga0466964_0061502
524 Ga0466964_0099650
525 Ga0466964_0125825
526 Ga0466971_0140669
527 Ga0466971_0147705
528 Ga0466957_0010935
529 Ga0466957_0025931
530 Ga0466957_0043122
531 Ga0466957_0055958
532 Ga0466957_0121367
533 Ga0466960_0073862
534 Ga0466960_0182754
535 Ga0466960_0274543
536 Ga0466959_0070609
537 Ga0466959_0080993
538 Ga0466958_0010553
539 Ga0466958_0019396
540 Ga0466958_0045583
541 Ga0466958_0157271
542 Ga0466967_0008374
543 Ga0466967_0037392
544 Ga0466967_0038189
545 Ga0466967_0056272
546 Ga0466967_0067524
547 Ga0466967_0110198
548 Ga0466967_0130107
549 Ga0466967_0145176
550 Ga0466967_0177770
551 Ga0466967_0256267
552 Ga0466967_0279099
553 Ga0466967_0383228
554 Ga0466967_0447738
555 Ga0466967_0715232
556 Ga0495592_0029483
557 Ga0495603_0037036
558 Ga0495629_0007118
559 Ga0495641_0040825
560 Ga0495653_0121392
561 Ga0495582_0095781
562 Ga0495664_0014890
563 Ga0495664_0128716
564 Ga0495628_0058488
565 Ga0495630_0110379
566 Ga0495630_0476869
567 Ga0495652_0072405
568 Ga0495652_0140856
569 Ga0495652_0400810
570 Ga0495640_0067649
571 Ga0495640_0440064
572 Ga0495587_0091829
573 Ga0495587_0180174
574 Ga0495645_0017775
575 Ga0495667_0237759
576 Ga0495599_0044527
577 Ga0495647_0077799
578 Ga0495658_0016388
579 Ga0495658_0044534
580 Ga0495658_0046887
581 Ga0495613_0178995
582 Ga0495604_0045876
583 Ga0495604_0193757
584 Ga0495604_0385656
585 Ga0495684_0155125
586 Ga0495593_0063714
587 Ga0496100_0010595
588 Ga0496101_0001361
589 Ga0496102_0010974
590 Ga0496102_0041177
591 Ga0496103_0049892
592 Ga0496104_0002527
593 Ga0496104_0194097
594 Ga0496104_0267370
595 Ga0496105_0006492
596 Ga0496105_0051574
597 Ga0496105_0219202
598 Ga0496106_0003504
599 Ga0496107_0003591
600 Ga0496107_0124949
601 Ga0496108_0190824
602 Ga0496108_1024345
603 Ga0496109_0002570
604 Ga0496109_0281489
605 Ga0496110_0006814
606 Ga0496111_0004379
607 Ga0496111_0120748
608 Ga0496112_0002534
609 Ga0496112_0007263
610 Ga0496112_0145967
611 Ga0496112_0159805
612 Ga0496112_0521739
613 Ga0496113_0151088
614 Ga0496114_0002399
615 Ga0496115_0007925
616 Ga0501067_0001025
617 Ga0501067_0006754
618 Ga0501067_0044518
619 Ga0501067_0062544
620 Ga0501068_0225382
621 Ga0501069_0135325
622 Ga0501071_0666273
623 nmdc:mga05p37_124454_c1
624 nmdc:mga06r32_640747_c1
625 Ga0495619_0112664
626 Ga0495619_0314621
627 Ga0530510_0018956
628 Ga0530510_0137386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

19

194

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

25

253

0.94

PF08659

KR

KR domain

20

172

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9172 5 243
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9145 5 243
5jsf-assembly1.cif.gz_A crystal structure of 17beta-hydroxysteroid dehydrogenase 14 s205 variant in complex with nad. 0.9064 6 240
6emm-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid 0.9055 6 240
5wul-assembly1.cif.gz_B serratia marcescens short-chain dehydrogenase/reductase f98a/f202l 0.9049 5 240
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9172 5 243 3.40.50.720
1npxA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.911 7 37 3.50.50.60
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9104 5 173 3.40.50.720
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.907 5 83 3.40.50.720
5wuwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 5 240 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A818ZKC0-F1-model_v4 Uncharacterized protein 0.9312 5 181 GO:0016491
AF-A0A524BC85-F1-model_v4 Short-chain dehydrogenase 0.9303 6 240 GO:0016616
GO:0030497
AF-A0A538AU63-F1-model_v4 SDR family oxidoreductase 0.9243 5 240 GO:0016616
AF-A0A3M2M792-F1-model_v4 SDR family oxidoreductase 0.9237 7 240 GO:0016491
AF-A0A523WPD4-F1-model_v4 SDR family oxidoreductase 0.9236 51 240 GO:0016491

Map