F402790

General Info

Members Datasets Scaffolds Average Seq Length
314 210 628 126

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0686013|Ga0436360_0686013_232_693
Length 153
Sequence LQAPAKERRWRELLRNGNLGGLHEWSQLMHIERLDHLVLTVADIARTCDFYSRVLGMEVVTFGEGRTALRFGQQKINLHSADDVPNLVADKPTPGSGDLCFITKTPLAEVVSHLEKCGVSIVAGPGPRAGAIGTIQSIYIRDPDQNLLEISNY

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
156 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
157 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 2.87
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0686013 3300039438 Bacteria 2273
2 JGI25406J46586_10077615 3300003203 Bacteria 1026
3 rootL2_10116517 3300003322 Bacteria 2633
4 JGI25160J50197_1063990 3300003354 Bacteria 724
5 JGI25404J52841_10109704 3300003659 Bacteria 580
6 Ga0065712_10527346 3300005290 Bacteria 632
7 Ga0070683_101147332 3300005329 Bacteria 747
8 Ga0070690_100107496 3300005330 Bacteria 1857
9 Ga0070670_100325054 3300005331 Bacteria 1348
10 Ga0070677_10612611 3300005333 Bacteria 604
11 Ga0070666_10681926 3300005335 Bacteria 753
12 Ga0070682_100728995 3300005337 Bacteria 798
13 Ga0068868_100511852 3300005338 Bacteria 1053
14 Ga0068868_100876555 3300005338 Bacteria 814
15 Ga0070687_100044279 3300005343 Bacteria 2267
16 Ga0070692_10098281 3300005345 Bacteria 1601
17 Ga0070668_101099972 3300005347 Bacteria 717
18 Ga0070669_100492020 3300005353 Bacteria 1016
19 Ga0070669_101441620 3300005353 Bacteria 598
20 Ga0070675_100935457 3300005354 Bacteria 795
21 Ga0070671_100194602 3300005355 Bacteria 1719
22 Ga0070671_100250655 3300005355 Bacteria 1504
23 Ga0070671_101597226 3300005355 Bacteria 578
24 Ga0070674_100049011 3300005356 Bacteria 2902
25 Ga0070673_100175265 3300005364 Bacteria 1833
26 Ga0070673_100276559 3300005364 Bacteria 1471
27 Ga0070667_100495818 3300005367 Bacteria 1119
28 Ga0070709_10168431 3300005434 Bacteria 1529
29 Ga0070709_10183645 3300005434 Bacteria 1470
30 Ga0070709_10628297 3300005434 Bacteria 829
31 Ga0070714_100100764 3300005435 Bacteria 2544
32 Ga0070714_100376580 3300005435 Unclassified 1337
33 Ga0070714_100789144 3300005435 Bacteria 919
34 Ga0070713_100145497 3300005436 Bacteria 2103
35 Ga0070713_100193972 3300005436 Bacteria 1832
36 Ga0070713_100277866 3300005436 Bacteria 1535
37 Ga0070713_100363559 3300005436 Bacteria 1345
38 Ga0070713_100564226 3300005436 Bacteria 1079
39 Ga0070713_100567989 3300005436 Bacteria 1075
40 Ga0070710_10438758 3300005437 Bacteria 883
41 Ga0070701_10052921 3300005438 Bacteria 2111
42 Ga0070701_10984726 3300005438 Bacteria 587
43 Ga0070711_100358664 3300005439 Unclassified 1174
44 Ga0070711_100688723 3300005439 Bacteria 860
45 Ga0070711_100779576 3300005439 Unclassified 810
46 Ga0070700_100177281 3300005441 Bacteria 1480
47 Ga0070700_100471506 3300005441 Bacteria 960
48 Ga0070700_101285184 3300005441 Bacteria 614
49 Ga0070694_100695130 3300005444 Bacteria 827
50 Ga0070708_100047356 3300005445 Bacteria 3797
51 Ga0070663_100486185 3300005455 Bacteria 1023
52 Ga0070662_100770227 3300005457 Bacteria 817
53 Ga0070681_10016866 3300005458 Bacteria 7296
54 Ga0070681_10176871 3300005458 Bacteria 2056
55 Ga0070681_10587372 3300005458 Bacteria 1028
56 Ga0068867_100023574 3300005459 Bacteria 4406
57 Ga0070706_101044237 3300005467 Unclassified 753
58 Ga0070707_100073974 3300005468 Bacteria 3285
59 Ga0070698_100083236 3300005471 Bacteria 3190
60 Ga0070698_100776801 3300005471 Bacteria 901
61 Ga0070698_101647464 3300005471 Bacteria 594
62 Ga0070699_100146962 3300005518 Bacteria 2083
63 Ga0070679_100328088 3300005530 Bacteria 1479
64 Ga0070684_100213825 3300005535 Bacteria 1758
65 Ga0070697_100689812 3300005536 Bacteria 901
66 Ga0070672_100148778 3300005543 Bacteria 1936
67 Ga0070686_100392731 3300005544 Bacteria 1053
68 Ga0070695_100949587 3300005545 Bacteria 697
69 Ga0070665_100639452 3300005548 Bacteria 1077
70 Ga0068855_101379166 3300005563 Bacteria 727
71 Ga0070664_100349326 3300005564 Bacteria 1345
72 Ga0070664_100946880 3300005564 Bacteria 808
73 Ga0068854_101863456 3300005578 Bacteria 552
74 Ga0068852_100162880 3300005616 Bacteria 2084
75 Ga0068859_100521612 3300005617 Bacteria 1283
76 Ga0068866_10033825 3300005718 Bacteria 2484
77 Ga0068861_100006861 3300005719 Bacteria 7774
78 Ga0068861_100673946 3300005719 Bacteria 958
79 Ga0068858_100267760 3300005842 Bacteria 1625
80 Ga0068860_100003364 3300005843 Bacteria 16465
81 Ga0068860_100284024 3300005843 Bacteria 1618
82 Ga0068862_100086904 3300005844 Bacteria 2719
83 Ga0081455_10234387 3300005937 Bacteria 1352
84 Ga0081540_1002911 3300005983 Bacteria 13799
85 Ga0081540_1044213 3300005983 Bacteria 2276
86 Ga0081539_10012579 3300005985 Bacteria 6499
87 Ga0070717_10152865 3300006028 Bacteria 1998
88 Ga0070717_10646784 3300006028 Bacteria 960
89 Ga0070717_11904009 3300006028 Bacteria 537
90 Ga0075432_10220546 3300006058 Bacteria 758
91 Ga0070715_10404458 3300006163 Bacteria 760
92 Ga0070716_100309980 3300006173 Bacteria 1101
93 Ga0070712_100011489 3300006175 Bacteria 5618
94 Ga0070712_100235363 3300006175 Bacteria 1456
95 Ga0070712_100241689 3300006175 Bacteria 1438
96 Ga0075366_10002413 3300006195 Bacteria 9582
97 Ga0097621_102061804 3300006237 Bacteria 545
98 Ga0068871_100715916 3300006358 Bacteria 918
99 Ga0068865_100015649 3300006881 Bacteria 4840
100 Ga0075436_100066082 3300006914 Bacteria 2499
101 Ga0097620_100521610 3300006931 Bacteria 1283
102 Ga0075435_100416667 3300007076 Bacteria 1156
103 Ga0099795_10087865 3300007788 Bacteria 1200
104 Ga0099795_10116123 3300007788 Bacteria 1066
105 Ga0099795_10256246 3300007788 Bacteria 756
106 Ga0111539_10184197 3300009094 Bacteria 2439
107 Ga0105243_11083861 3300009148 Bacteria 808
108 Ga0105241_11818744 3300009174 Bacteria 595
109 Ga0105242_11086495 3300009176 Bacteria 813
110 Ga0105242_12840473 3300009176 Unclassified 535
111 Ga0105248_10694868 3300009177 Bacteria 1148
112 Ga0105249_10030182 3300009553 Bacteria 4899
113 Ga0105249_10649874 3300009553 Bacteria 1112
114 Ga0099796_10014100 3300010159 Bacteria 2300
115 Ga0099796_10083082 3300010159 Bacteria 1178
116 Ga0105239_12380887 3300010375 Bacteria 617
117 Ga0105246_10420955 3300011119 Bacteria 1115
118 Ga0157373_10523778 3300013100 Bacteria 858
119 Ga0157378_10126957 3300013297 Bacteria 2357
120 Ga0163162_10888397 3300013306 Bacteria 1005
121 Ga0163162_11716633 3300013306 Bacteria 717
122 Ga0163162_12599103 3300013306 Bacteria 582
123 Ga0157372_12477515 3300013307 Unclassified 596
124 Ga0157375_10067791 3300013308 Bacteria 3566
125 Ga0157380_10036136 3300014326 Bacteria 3820
126 Ga0182008_10489714 3300014497 Bacteria 674
127 Ga0157377_10281240 3300014745 Bacteria 1091
128 Ga0157377_11234487 3300014745 Bacteria 580
129 Ga0157379_10019470 3300014968 Bacteria 5995
130 Ga0157379_10190348 3300014968 Bacteria 1854
131 Ga0157379_11152641 3300014968 Bacteria 744
132 Ga0157376_11031441 3300014969 Bacteria 846
133 Ga0157376_11690470 3300014969 Bacteria 668
134 Ga0182007_10323419 3300015262 Bacteria 572
135 Ga0163161_10204105 3300017792 Bacteria 1524
136 Ga0163161_10912369 3300017792 Bacteria 745
137 Ga0213873_10181600 3300021358 Bacteria 646
138 Ga0213872_10202368 3300021361 Bacteria 851
139 Ga0213872_10220938 3300021361 Bacteria 806
140 Ga0213875_10000145 3300021388 Bacteria 75194
141 Ga0209130_1000842 3300025284 Bacteria 25657
142 Ga0209025_1065006 3300025294 Bacteria 1335
143 Ga0207426_1000133 3300025302 Bacteria 206783
144 Ga0207692_10251765 3300025898 Unclassified 1059
145 Ga0207685_10529459 3300025905 Bacteria 624
146 Ga0207699_10097867 3300025906 Bacteria 1855
147 Ga0207699_10407188 3300025906 Bacteria 969
148 Ga0207643_10967214 3300025908 Bacteria 551
149 Ga0207684_10025066 3300025910 Bacteria 5083
150 Ga0207707_10011878 3300025912 Bacteria 7576
151 Ga0207707_10473664 3300025912 Bacteria 1070
152 Ga0207695_10854159 3300025913 Bacteria 790
153 Ga0207695_11101733 3300025913 Unclassified 674
154 Ga0207693_10021162 3300025915 Bacteria 5170
155 Ga0207693_10182387 3300025915 Bacteria 1652
156 Ga0207693_10288882 3300025915 Bacteria 1285
157 Ga0207663_10239186 3300025916 Bacteria 1331
158 Ga0207663_10261051 3300025916 Unclassified 1279
159 Ga0207663_10873792 3300025916 Bacteria 718
160 Ga0207662_10192097 3300025918 Bacteria 1318
161 Ga0207646_10015242 3300025922 Bacteria 7271
162 Ga0207681_10621076 3300025923 Bacteria 894
163 Ga0207700_10064859 3300025928 Bacteria 2784
164 Ga0207700_10353016 3300025928 Bacteria 1281
165 Ga0207700_11009160 3300025928 Bacteria 745
166 Ga0207664_10109588 3300025929 Bacteria 2294
167 Ga0207664_10126652 3300025929 Bacteria 2145
168 Ga0207664_10540317 3300025929 Unclassified 1045
169 Ga0207686_10934710 3300025934 Bacteria 701
170 Ga0207670_10416836 3300025936 Bacteria 1077
171 Ga0207670_10629495 3300025936 Bacteria 883
172 Ga0207669_10234145 3300025937 Bacteria 1357
173 Ga0207704_10305150 3300025938 Bacteria 1221
174 Ga0207665_10153057 3300025939 Bacteria 1653
175 Ga0207691_10187196 3300025940 Bacteria 1807
176 Ga0207691_10619020 3300025940 Bacteria 916
177 Ga0207711_11089607 3300025941 Bacteria 739
178 Ga0207661_10064863 3300025944 Bacteria 2963
179 Ga0207679_10386997 3300025945 Bacteria 1227
180 Ga0207667_11278923 3300025949 Bacteria 711
181 Ga0207712_10016405 3300025961 Bacteria 4795
182 Ga0207712_10475111 3300025961 Bacteria 1064
183 Ga0207658_10344526 3300025986 Bacteria 1296
184 Ga0207677_10683874 3300026023 Bacteria 909
185 Ga0207703_10683945 3300026035 Bacteria 975
186 Ga0207708_10390382 3300026075 Bacteria 1149
187 Ga0207708_11616045 3300026075 Bacteria 569
188 Ga0207708_11783450 3300026075 Bacteria 540
189 Ga0207702_10073636 3300026078 Bacteria 2946
190 Ga0207702_11583568 3300026078 Bacteria 648
191 Ga0207641_10072001 3300026088 Bacteria 2976
192 Ga0207641_11021372 3300026088 Unclassified 824
193 Ga0207648_10388963 3300026089 Bacteria 1262
194 Ga0207675_100000393 3300026118 Bacteria 41975
195 Ga0207675_100607274 3300026118 Unclassified 1097
196 Ga0207698_10233314 3300026142 Bacteria 1672
197 Ga0209966_1047732 3300027695 Bacteria 905
198 Ga0207428_10986068 3300027907 Bacteria 592
199 Ga0268265_10006466 3300028380 Bacteria 7943
200 Ga0268264_10015302 3300028381 Bacteria 6291
201 Ga0307515_10297571 3300028794 Bacteria 1302
202 Ga0265327_10211758 3300031251 Bacteria 874
203 Ga0373926_0122219 3300035083 Unclassified 982
204 Ga0373949_0077855 3300035090 Bacteria 879
205 Ga0373939_0324030 3300035114 Bacteria 620
206 Ga0373945_0104873 3300035116 Unclassified 1110
207 Ga0373954_0071923 3300035118 Bacteria 1644
208 Ga0373957_0036662 3300035120 Bacteria 1828
209 Ga0373957_0110820 3300035120 Bacteria 1105
210 Ga0373946_0107865 3300035171 Unclassified 1257
211 Ga0373931_0480988 3300035691 Unclassified 798
212 Ga0373931_0753525 3300035691 Bacteria 646
213 Ga0373935_0296470 3300035692 Bacteria 1142
214 Ga0373935_0337789 3300035692 Bacteria 1072
215 Ga0373935_0515169 3300035692 Bacteria 870
216 Ga0373935_0823340 3300035692 Bacteria 686
217 Ga0373927_0361136 3300035695 Bacteria 957
218 Ga0373933_0106819 3300035724 Bacteria 1742
219 Ga0373947_0076432 3300035725 Bacteria 2064
220 Ga0373947_0437210 3300035725 Bacteria 885
221 Ga0373937_0034191 3300036401 Bacteria 4623
222 Ga0373937_0100738 3300036401 Bacteria 2681
223 Ga0373937_0261950 3300036401 Bacteria 1630
224 Ga0373937_0382542 3300036401 Bacteria 1335
225 Ga0373925_0159846 3300037068 Unclassified 1774
226 Ga0436364_0050825 3300037853 Bacteria 952
227 Ga0436364_0056880 3300037853 Bacteria 87492
228 Ga0436364_0067158 3300037853 Bacteria 1728
229 Ga0436364_0183471 3300037853 Bacteria 676
230 Ga0436364_0784768 3300037853 Bacteria 705
231 Ga0436364_1037748 3300037853 Bacteria 27359
232 Ga0436364_1414712 3300037853 Bacteria 14633
233 Ga0400484_23521 3300038725 Bacteria 38842
234 Ga0400488_56446 3300038741 Bacteria 2110
235 Ga0400487_63080 3300039110 Bacteria 75723
236 Ga0436365_0375524 3300039437 Unclassified 1033
237 Ga0436365_0375820 3300039437 Bacteria 2870
238 Ga0436365_0719958 3300039437 Bacteria 1179
239 Ga0436365_1358340 3300039437 Unclassified 694
240 Ga0436365_1575510 3300039437 Bacteria 571
241 Ga0436360_0485439 3300039438 Bacteria 1137
242 Ga0436360_1158131 3300039438 Bacteria 864
243 Ga0436360_1345966 3300039438 Bacteria 505
244 Ga0436361_0014661 3300039447 Bacteria 1143
245 Ga0436361_0350786 3300039447 Bacteria 1411
246 Ga0436361_0896535 3300039447 Bacteria 2645
247 Ga0436361_0965030 3300039447 Bacteria 1040
248 Ga0436363_1004548 3300039450 Bacteria 916
249 Ga0436363_1551048 3300039450 Bacteria 1781
250 Ga0436362_0020401 3300039453 Bacteria 685
251 Ga0436362_0062507 3300039453 Bacteria 1342
252 Ga0436362_0227616 3300039453 Bacteria 868
253 Ga0436362_0313955 3300039453 Bacteria 3295
254 Ga0439431_0154024 3300041997 Bacteria 654
255 Ga0439431_0251891 3300041997 Bacteria 524
256 Ga0451577_0236057 3300042876 Bacteria 1654
257 Ga0466963_0269873 3300044694 Bacteria 1195
258 Ga0466967_1628291 3300045976 Bacteria 643
259 Ga0495592_0039704 3300046454 Bacteria 3535
260 Ga0495629_0006706 3300046459 Bacteria 8513
261 Ga0495629_0058273 3300046459 Bacteria 2700
262 Ga0495653_0000101 3300046463 Bacteria 70919
263 Ga0495653_0130501 3300046463 Bacteria 1780
264 Ga0495639_0503699 3300046475 Bacteria 618
265 Ga0495628_0001033 3300046516 Bacteria 25478
266 Ga0495628_0484853 3300046516 Bacteria 894
267 Ga0495630_0002916 3300046517 Bacteria 11889
268 Ga0495630_1305994 3300046517 Unclassified 547
269 Ga0495666_0563129 3300046526 Bacteria 508
270 Ga0495665_0000030 3300046531 Bacteria 54150
271 Ga0495640_0286653 3300046533 Bacteria 1025
272 Ga0495586_0020071 3300046535 Bacteria 3560
273 Ga0495586_0362008 3300046535 Bacteria 833
274 Ga0495621_0021365 3300046539 Bacteria 2133
275 Ga0495621_0036034 3300046539 Bacteria 1715
276 Ga0495667_0125885 3300046559 Unclassified 1653
277 Ga0495634_0079720 3300046642 Bacteria 2144
278 Ga0495634_0531378 3300046642 Bacteria 687
279 Ga0495635_0213770 3300046663 Bacteria 1305
280 Ga0495657_0183940 3300046675 Bacteria 1281
281 Ga0495657_0728436 3300046675 Bacteria 569
282 Ga0495623_0007809 3300046679 Bacteria 6956
283 Ga0495600_0007513 3300046809 Bacteria 6672
284 Ga0495600_0019540 3300046809 Bacteria 4327
285 Ga0495674_0000146 3300047319 Bacteria 54437
286 Ga0495680_0069432 3300047322 Bacteria 2689
287 Ga0495675_0123691 3300047444 Bacteria 1610
288 Ga0495673_0126709 3300047469 Bacteria 1007
289 Ga0495593_0000065 3300047673 Bacteria 44613
290 Ga0496104_1169308 3300048907 Bacteria 673
291 Ga0496105_0464910 3300048908 Bacteria 997
292 Ga0496106_1044278 3300048909 Bacteria 642
293 Ga0496106_1407722 3300048909 Bacteria 539
294 Ga0496108_0362264 3300048911 Bacteria 1266
295 Ga0496110_0626966 3300048913 Bacteria 974
296 Ga0496111_0228690 3300048914 Bacteria 1382
297 Ga0496112_0048704 3300048915 Bacteria 4154
298 Ga0496113_0128733 3300048916 Bacteria 1985
299 Ga0496123_0463162 3300048926 Bacteria 562
300 Ga0501047_0712351 3300049581 Bacteria 821
301 Ga0501070_0606627 3300049586 Bacteria 872
302 Ga0501072_1514316 3300049588 Bacteria 518
303 nmdc:mga0k408_6338_c1 3300050493 Bacteria 6314
304 nmdc:mga08y16_758293_c1 3300050511 Bacteria 966
305 nmdc:mga0n895_225394_c1 3300050512 Bacteria 1902
306 nmdc:mga0n895_988984_c1 3300050512 Bacteria 823
307 nmdc:mga0rr50_361593_c1 3300050513 Bacteria 1222
308 nmdc:mga08x19_71835_c1 3300050514 Bacteria 2257
309 nmdc:mga0a205_952784_c1 3300050515 Bacteria 705
310 Ga0495601_0007236 3300053077 Bacteria 6510
311 Ga0495595_0010583 3300053084 Bacteria 3836
312 Ga0495619_0019089 3300053085 Bacteria 4356
313 Ga0500568_0030993 3300053139 Bacteria 2211
314 2753810698 2751185905 Bacteria 6142767
315 Ga0436360_0686013
316 JGI25406J46586_10077615
317 rootL2_10116517
318 JGI25160J50197_1063990
319 JGI25404J52841_10109704
320 Ga0065712_10527346
321 Ga0070683_101147332
322 Ga0070690_100107496
323 Ga0070670_100325054
324 Ga0070677_10612611
325 Ga0070666_10681926
326 Ga0070682_100728995
327 Ga0068868_100511852
328 Ga0068868_100876555
329 Ga0070687_100044279
330 Ga0070692_10098281
331 Ga0070668_101099972
332 Ga0070669_100492020
333 Ga0070669_101441620
334 Ga0070675_100935457
335 Ga0070671_100194602
336 Ga0070671_100250655
337 Ga0070671_101597226
338 Ga0070674_100049011
339 Ga0070673_100175265
340 Ga0070673_100276559
341 Ga0070667_100495818
342 Ga0070709_10168431
343 Ga0070709_10183645
344 Ga0070709_10628297
345 Ga0070714_100100764
346 Ga0070714_100376580
347 Ga0070714_100789144
348 Ga0070713_100145497
349 Ga0070713_100193972
350 Ga0070713_100277866
351 Ga0070713_100363559
352 Ga0070713_100564226
353 Ga0070713_100567989
354 Ga0070710_10438758
355 Ga0070701_10052921
356 Ga0070701_10984726
357 Ga0070711_100358664
358 Ga0070711_100688723
359 Ga0070711_100779576
360 Ga0070700_100177281
361 Ga0070700_100471506
362 Ga0070700_101285184
363 Ga0070694_100695130
364 Ga0070708_100047356
365 Ga0070663_100486185
366 Ga0070662_100770227
367 Ga0070681_10016866
368 Ga0070681_10176871
369 Ga0070681_10587372
370 Ga0068867_100023574
371 Ga0070706_101044237
372 Ga0070707_100073974
373 Ga0070698_100083236
374 Ga0070698_100776801
375 Ga0070698_101647464
376 Ga0070699_100146962
377 Ga0070679_100328088
378 Ga0070684_100213825
379 Ga0070697_100689812
380 Ga0070672_100148778
381 Ga0070686_100392731
382 Ga0070695_100949587
383 Ga0070665_100639452
384 Ga0068855_101379166
385 Ga0070664_100349326
386 Ga0070664_100946880
387 Ga0068854_101863456
388 Ga0068852_100162880
389 Ga0068859_100521612
390 Ga0068866_10033825
391 Ga0068861_100006861
392 Ga0068861_100673946
393 Ga0068858_100267760
394 Ga0068860_100003364
395 Ga0068860_100284024
396 Ga0068862_100086904
397 Ga0081455_10234387
398 Ga0081540_1002911
399 Ga0081540_1044213
400 Ga0081539_10012579
401 Ga0070717_10152865
402 Ga0070717_10646784
403 Ga0070717_11904009
404 Ga0075432_10220546
405 Ga0070715_10404458
406 Ga0070716_100309980
407 Ga0070712_100011489
408 Ga0070712_100235363
409 Ga0070712_100241689
410 Ga0075366_10002413
411 Ga0097621_102061804
412 Ga0068871_100715916
413 Ga0068865_100015649
414 Ga0075436_100066082
415 Ga0097620_100521610
416 Ga0075435_100416667
417 Ga0099795_10087865
418 Ga0099795_10116123
419 Ga0099795_10256246
420 Ga0111539_10184197
421 Ga0105243_11083861
422 Ga0105241_11818744
423 Ga0105242_11086495
424 Ga0105242_12840473
425 Ga0105248_10694868
426 Ga0105249_10030182
427 Ga0105249_10649874
428 Ga0099796_10014100
429 Ga0099796_10083082
430 Ga0105239_12380887
431 Ga0105246_10420955
432 Ga0157373_10523778
433 Ga0157378_10126957
434 Ga0163162_10888397
435 Ga0163162_11716633
436 Ga0163162_12599103
437 Ga0157372_12477515
438 Ga0157375_10067791
439 Ga0157380_10036136
440 Ga0182008_10489714
441 Ga0157377_10281240
442 Ga0157377_11234487
443 Ga0157379_10019470
444 Ga0157379_10190348
445 Ga0157379_11152641
446 Ga0157376_11031441
447 Ga0157376_11690470
448 Ga0182007_10323419
449 Ga0163161_10204105
450 Ga0163161_10912369
451 Ga0213873_10181600
452 Ga0213872_10202368
453 Ga0213872_10220938
454 Ga0213875_10000145
455 Ga0209130_1000842
456 Ga0209025_1065006
457 Ga0207426_1000133
458 Ga0207692_10251765
459 Ga0207685_10529459
460 Ga0207699_10097867
461 Ga0207699_10407188
462 Ga0207643_10967214
463 Ga0207684_10025066
464 Ga0207707_10011878
465 Ga0207707_10473664
466 Ga0207695_10854159
467 Ga0207695_11101733
468 Ga0207693_10021162
469 Ga0207693_10182387
470 Ga0207693_10288882
471 Ga0207663_10239186
472 Ga0207663_10261051
473 Ga0207663_10873792
474 Ga0207662_10192097
475 Ga0207646_10015242
476 Ga0207681_10621076
477 Ga0207700_10064859
478 Ga0207700_10353016
479 Ga0207700_11009160
480 Ga0207664_10109588
481 Ga0207664_10126652
482 Ga0207664_10540317
483 Ga0207686_10934710
484 Ga0207670_10416836
485 Ga0207670_10629495
486 Ga0207669_10234145
487 Ga0207704_10305150
488 Ga0207665_10153057
489 Ga0207691_10187196
490 Ga0207691_10619020
491 Ga0207711_11089607
492 Ga0207661_10064863
493 Ga0207679_10386997
494 Ga0207667_11278923
495 Ga0207712_10016405
496 Ga0207712_10475111
497 Ga0207658_10344526
498 Ga0207677_10683874
499 Ga0207703_10683945
500 Ga0207708_10390382
501 Ga0207708_11616045
502 Ga0207708_11783450
503 Ga0207702_10073636
504 Ga0207702_11583568
505 Ga0207641_10072001
506 Ga0207641_11021372
507 Ga0207648_10388963
508 Ga0207675_100000393
509 Ga0207675_100607274
510 Ga0207698_10233314
511 Ga0209966_1047732
512 Ga0207428_10986068
513 Ga0268265_10006466
514 Ga0268264_10015302
515 Ga0307515_10297571
516 Ga0265327_10211758
517 Ga0373926_0122219
518 Ga0373949_0077855
519 Ga0373939_0324030
520 Ga0373945_0104873
521 Ga0373954_0071923
522 Ga0373957_0036662
523 Ga0373957_0110820
524 Ga0373946_0107865
525 Ga0373931_0480988
526 Ga0373931_0753525
527 Ga0373935_0296470
528 Ga0373935_0337789
529 Ga0373935_0515169
530 Ga0373935_0823340
531 Ga0373927_0361136
532 Ga0373933_0106819
533 Ga0373947_0076432
534 Ga0373947_0437210
535 Ga0373937_0034191
536 Ga0373937_0100738
537 Ga0373937_0261950
538 Ga0373937_0382542
539 Ga0373925_0159846
540 Ga0436364_0050825
541 Ga0436364_0056880
542 Ga0436364_0067158
543 Ga0436364_0183471
544 Ga0436364_0784768
545 Ga0436364_1037748
546 Ga0436364_1414712
547 Ga0400484_23521
548 Ga0400488_56446
549 Ga0400487_63080
550 Ga0436365_0375524
551 Ga0436365_0375820
552 Ga0436365_0719958
553 Ga0436365_1358340
554 Ga0436365_1575510
555 Ga0436360_0485439
556 Ga0436360_1158131
557 Ga0436360_1345966
558 Ga0436361_0014661
559 Ga0436361_0350786
560 Ga0436361_0896535
561 Ga0436361_0965030
562 Ga0436363_1004548
563 Ga0436363_1551048
564 Ga0436362_0020401
565 Ga0436362_0062507
566 Ga0436362_0227616
567 Ga0436362_0313955
568 Ga0439431_0154024
569 Ga0439431_0251891
570 Ga0451577_0236057
571 Ga0466963_0269873
572 Ga0466967_1628291
573 Ga0495592_0039704
574 Ga0495629_0006706
575 Ga0495629_0058273
576 Ga0495653_0000101
577 Ga0495653_0130501
578 Ga0495639_0503699
579 Ga0495628_0001033
580 Ga0495628_0484853
581 Ga0495630_0002916
582 Ga0495630_1305994
583 Ga0495666_0563129
584 Ga0495665_0000030
585 Ga0495640_0286653
586 Ga0495586_0020071
587 Ga0495586_0362008
588 Ga0495621_0021365
589 Ga0495621_0036034
590 Ga0495667_0125885
591 Ga0495634_0079720
592 Ga0495634_0531378
593 Ga0495635_0213770
594 Ga0495657_0183940
595 Ga0495657_0728436
596 Ga0495623_0007809
597 Ga0495600_0007513
598 Ga0495600_0019540
599 Ga0495674_0000146
600 Ga0495680_0069432
601 Ga0495675_0123691
602 Ga0495673_0126709
603 Ga0495593_0000065
604 Ga0496104_1169308
605 Ga0496105_0464910
606 Ga0496106_1044278
607 Ga0496106_1407722
608 Ga0496108_0362264
609 Ga0496110_0626966
610 Ga0496111_0228690
611 Ga0496112_0048704
612 Ga0496113_0128733
613 Ga0496123_0463162
614 Ga0501047_0712351
615 Ga0501070_0606627
616 Ga0501072_1514316
617 nmdc:mga0k408_6338_c1
618 nmdc:mga08y16_758293_c1
619 nmdc:mga0n895_225394_c1
620 nmdc:mga0n895_988984_c1
621 nmdc:mga0rr50_361593_c1
622 nmdc:mga08x19_71835_c1
623 nmdc:mga0a205_952784_c1
624 Ga0495601_0007236
625 Ga0495595_0010583
626 Ga0495619_0019089
627 Ga0500568_0030993
628 2753810698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

150

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.9891 2 124
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.9886 1 126
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.9814 1 126
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.9809 1 126
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.9806 1 126
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9938 7 124 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9773 7 124 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8053 5 125 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8049 69 126 3.30.720.110
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.799 5 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2C9NVF0-F1-model_v4 VOC family virulence protein 0.9976 1 126
AF-A0A7H8QBC6-F1-model_v4 VOC family protein 0.9974 1 126
AF-A0A729TMY3-F1-model_v4 VOC family protein 0.9973 1 126
AF-A0A841JW41-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9972 1 126 GO:0016829
GO:0051213
AF-A0A704RXW5-F1-model_v4 VOC family protein 0.9972 19 126

Map