F402749

General Info

Members Datasets Scaffolds Average Seq Length
314 207 314 140

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10005668|Ga0316575_100056683
Length 147
Sequence MSKLLARLRDASRSGVYRASQADEILDALRGAGFDLVRIDLAPVSEKEQLLERLASELAFPQWFGRNWDALEDCLTDLSWRAGGQHVLLIEGFETLRARRPDEFGVLVDILASSAQYWSERGRPFFAVFLDGENILALPDLFRRKGA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 0.32
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10004631 3300005295 Bacteria 3406
2 Ga0065707_10345827 3300005295 Bacteria 922
3 Ga0070690_100001653 3300005330 Bacteria 11726
4 Ga0068869_100000423 3300005334 Bacteria 23067
5 Ga0070680_100001243 3300005336 Bacteria 18371
6 Ga0070680_100641823 3300005336 Bacteria 912
7 Ga0070682_100009146 3300005337 Bacteria 5601
8 Ga0068868_100000271 3300005338 Bacteria 34837
9 Ga0070689_100006573 3300005340 Bacteria 8064
10 Ga0070689_100101015 3300005340 Bacteria 2282
11 Ga0070691_10001218 3300005341 Bacteria 10822
12 Ga0070687_100000109 3300005343 Bacteria 27960
13 Ga0070687_100638797 3300005343 Unclassified 736
14 Ga0070692_10331901 3300005345 Bacteria 939
15 Ga0070669_100824100 3300005353 Bacteria 789
16 Ga0070674_100540179 3300005356 Bacteria 976
17 Ga0070673_100062065 3300005364 Bacteria 2968
18 Ga0070673_100389988 3300005364 Bacteria 1243
19 Ga0070703_10018974 3300005406 Bacteria 1992
20 Ga0070701_10000272 3300005438 Bacteria 16935
21 Ga0070701_10561217 3300005438 Bacteria 750
22 Ga0070705_100000460 3300005440 Bacteria 23393
23 Ga0070705_100038112 3300005440 Bacteria 2717
24 Ga0070705_100437448 3300005440 Bacteria 978
25 Ga0070700_100038989 3300005441 Bacteria 2899
26 Ga0070694_100006519 3300005444 Bacteria 7091
27 Ga0070694_100049649 3300005444 Bacteria 2826
28 Ga0070708_100483340 3300005445 Bacteria 1168
29 Ga0070708_100909109 3300005445 Bacteria 826
30 Ga0070678_100744200 3300005456 Unclassified 886
31 Ga0070681_10095600 3300005458 Bacteria 2920
32 Ga0068867_100000169 3300005459 Bacteria 42652
33 Ga0068867_102202628 3300005459 Unclassified 523
34 Ga0070707_100774570 3300005468 Bacteria 923
35 Ga0070699_100109879 3300005518 Bacteria 2420
36 Ga0070679_100032403 3300005530 Bacteria 5169
37 Ga0070679_101408879 3300005530 Bacteria 643
38 Ga0070684_100694875 3300005535 Bacteria 948
39 Ga0068853_100151068 3300005539 Bacteria 2091
40 Ga0070686_100001592 3300005544 Bacteria 12752
41 Ga0070686_101037409 3300005544 Bacteria 674
42 Ga0070695_100000521 3300005545 Bacteria 20258
43 Ga0070695_100527420 3300005545 Bacteria 917
44 Ga0070696_100000143 3300005546 Bacteria 39364
45 Ga0070696_100070688 3300005546 Bacteria 2456
46 Ga0070696_100373828 3300005546 Bacteria 1109
47 Ga0070696_100468800 3300005546 Bacteria 997
48 Ga0070693_100000043 3300005547 Bacteria 48919
49 Ga0070693_100272772 3300005547 Bacteria 1130
50 Ga0070704_100000027 3300005549 Bacteria 47731
51 Ga0068855_100010922 3300005563 Bacteria 10959
52 Ga0068855_100339814 3300005563 Bacteria 1656
53 Ga0068854_100021606 3300005578 Bacteria 4369
54 Ga0068856_100004523 3300005614 Bacteria 13826
55 Ga0068856_100570021 3300005614 Bacteria 1153
56 Ga0070702_100000162 3300005615 Bacteria 21272
57 Ga0068852_100041914 3300005616 Bacteria 3873
58 Ga0068859_100002085 3300005617 Bacteria 20381
59 Ga0068864_100050006 3300005618 Bacteria 3597
60 Ga0068866_10001447 3300005718 Bacteria 10149
61 Ga0068861_100000189 3300005719 Bacteria 32839
62 Ga0068870_10025211 3300005840 Bacteria 2950
63 Ga0068863_100568309 3300005841 Bacteria 1121
64 Ga0068863_100721193 3300005841 Bacteria 992
65 Ga0068858_100000286 3300005842 Bacteria 54596
66 Ga0068858_100037522 3300005842 Bacteria 4494
67 Ga0068858_100724421 3300005842 Bacteria 968
68 Ga0068860_100000770 3300005843 Bacteria 36109
69 Ga0068860_100143920 3300005843 Bacteria 2293
70 Ga0068862_100000639 3300005844 Bacteria 36261
71 Ga0070716_100472058 3300006173 Unclassified 919
72 Ga0097621_100000447 3300006237 Bacteria 28911
73 Ga0068871_100000853 3300006358 Bacteria 20356
74 Ga0075428_100006275 3300006844 Bacteria 13220
75 Ga0075430_100111332 3300006846 Bacteria 2283
76 Ga0075430_100157268 3300006846 Bacteria 1892
77 Ga0075433_10001192 3300006852 Bacteria 18911
78 Ga0075433_10067828 3300006852 Bacteria 3131
79 Ga0075433_10218778 3300006852 Bacteria 1692
80 Ga0075433_10790534 3300006852 Bacteria 829
81 Ga0075434_100000302 3300006871 Bacteria 34971
82 Ga0075434_100000551 3300006871 Bacteria 28665
83 Ga0075434_101414353 3300006871 Bacteria 705
84 Ga0075429_100001646 3300006880 Bacteria 18465
85 Ga0068865_100000043 3300006881 Bacteria 70962
86 Ga0075436_100000386 3300006914 Bacteria 28270
87 Ga0075436_100100768 3300006914 Bacteria 2011
88 Ga0097620_100002085 3300006931 Bacteria 20381
89 Ga0075435_100003547 3300007076 Bacteria 10597
90 Ga0075435_100009872 3300007076 Bacteria 6947
91 Ga0075435_100048450 3300007076 Bacteria 3414
92 Ga0099794_10233283 3300007265 Bacteria 947
93 Ga0105240_10653666 3300009093 Bacteria 1152
94 Ga0111539_10020815 3300009094 Bacteria 8076
95 Ga0111539_10025680 3300009094 Bacteria 7219
96 Ga0111539_11114086 3300009094 Unclassified 917
97 Ga0105245_10000271 3300009098 Bacteria 49162
98 Ga0105247_10310240 3300009101 Bacteria 1097
99 Ga0114129_10001887 3300009147 Bacteria 28595
100 Ga0114129_11098983 3300009147 Bacteria 996
101 Ga0105243_10001232 3300009148 Bacteria 23067
102 Ga0105241_10066672 3300009174 Bacteria 2784
103 Ga0105242_10001304 3300009176 Bacteria 19729
104 Ga0105248_10130355 3300009177 Bacteria 2837
105 Ga0105249_10000756 3300009553 Bacteria 29082
106 Ga0105249_12196920 3300009553 Bacteria 625
107 Ga0105239_10033403 3300010375 Bacteria 5650
108 Ga0105239_11552355 3300010375 Bacteria 765
109 Ga0157324_1021364 3300012506 Bacteria 662
110 Ga0157374_10792447 3300013296 Bacteria 963
111 Ga0157378_10000140 3300013297 Bacteria 67335
112 Ga0157372_10567088 3300013307 Bacteria 1323
113 Ga0157375_10230745 3300013308 Bacteria 2010
114 Ga0157380_10109518 3300014326 Bacteria 2318
115 Ga0157377_10177156 3300014745 Bacteria 1338
116 Ga0157377_10521531 3300014745 Bacteria 834
117 Ga0157376_10001071 3300014969 Bacteria 17927
118 Ga0207642_10001374 3300025899 Bacteria 7551
119 Ga0207699_10449013 3300025906 Bacteria 925
120 Ga0207643_10223122 3300025908 Bacteria 1154
121 Ga0207654_10014921 3300025911 Bacteria 4021
122 Ga0207707_10105200 3300025912 Bacteria 2467
123 Ga0207660_10004531 3300025917 Bacteria 9060
124 Ga0207660_10472207 3300025917 Bacteria 1016
125 Ga0207662_10000024 3300025918 Bacteria 70677
126 Ga0207652_10102328 3300025921 Bacteria 2531
127 Ga0207681_10621265 3300025923 Bacteria 894
128 Ga0207687_10002713 3300025927 Bacteria 11975
129 Ga0207644_10310923 3300025931 Bacteria 1272
130 Ga0207686_10000608 3300025934 Bacteria 22371
131 Ga0207709_10007238 3300025935 Bacteria 6189
132 Ga0207670_10003374 3300025936 Bacteria 8473
133 Ga0207669_10435440 3300025937 Bacteria 1035
134 Ga0207704_10000328 3300025938 Bacteria 22138
135 Ga0207665_10605596 3300025939 Bacteria 856
136 Ga0207711_10146056 3300025941 Bacteria 2131
137 Ga0207689_10000162 3300025942 Bacteria 57621
138 Ga0207667_10152518 3300025949 Bacteria 2378
139 Ga0207667_10188988 3300025949 Bacteria 2113
140 Ga0207651_10380205 3300025960 Bacteria 1196
141 Ga0207712_10000637 3300025961 Bacteria 27584
142 Ga0207640_10017324 3300025981 Bacteria 4214
143 Ga0207677_10088700 3300026023 Bacteria 2243
144 Ga0207703_10085812 3300026035 Bacteria 2635
145 Ga0207703_10594764 3300026035 Bacteria 1046
146 Ga0207703_12055363 3300026035 Bacteria 547
147 Ga0207639_10025169 3300026041 Bacteria 4315
148 Ga0207708_10065945 3300026075 Bacteria 2768
149 Ga0207702_10459051 3300026078 Bacteria 1237
150 Ga0207641_10122460 3300026088 Bacteria 2323
151 Ga0207641_10731072 3300026088 Unclassified 976
152 Ga0207641_10945955 3300026088 Bacteria 857
153 Ga0207641_11301782 3300026088 Unclassified 727
154 Ga0207648_10000147 3300026089 Bacteria 70420
155 Ga0207648_12227312 3300026089 Bacteria 509
156 Ga0207675_100000104 3300026118 Bacteria 67261
157 Ga0207683_10131190 3300026121 Bacteria 2254
158 Ga0207698_10014617 3300026142 Bacteria 5226
159 Ga0209996_1045764 3300027395 Bacteria 657
160 Ga0210000_1030350 3300027462 Bacteria 844
161 Ga0209999_1005460 3300027543 Bacteria 2285
162 Ga0207428_10000969 3300027907 Bacteria 31820
163 Ga0207428_10371893 3300027907 Bacteria 1049
164 Ga0268265_10000892 3300028380 Bacteria 27806
165 Ga0268264_10000992 3300028381 Bacteria 28913
166 Ga0268264_10330806 3300028381 Bacteria 1444
167 Ga0316575_10005668 3300031665 Bacteria 4457
168 Ga0316579_10003689 3300031691 Bacteria 6027
169 Ga0265314_10226437 3300031711 Bacteria 1087
170 Ga0307410_10378948 3300031852 Bacteria 1138
171 Ga0307407_10285624 3300031903 Bacteria 1145
172 Ga0307416_101005718 3300032002 Bacteria 937
173 Ga0307411_10141747 3300032005 Bacteria 1773
174 Ga0316583_10015355 3300032133 Bacteria 2755
175 Ga0316585_10054251 3300032137 Bacteria 1289
176 Ga0316580_10034912 3300032139 Bacteria 1556
177 Ga0373930_0028655 3300034816 Bacteria 1134
178 Ga0373958_0003167 3300034819 Bacteria 2359
179 Ga0373938_0056571 3300034957 Bacteria 908
180 Ga0373928_0006824 3300035084 Bacteria 2200
181 Ga0373928_0125133 3300035084 Bacteria 692
182 Ga0373940_0008964 3300035088 Bacteria 2312
183 Ga0373940_0081577 3300035088 Unclassified 957
184 Ga0373944_0010486 3300035089 Bacteria 2528
185 Ga0373949_0008766 3300035090 Bacteria 2213
186 Ga0373951_0041714 3300035091 Bacteria 1108
187 Ga0373951_0042660 3300035091 Bacteria 1098
188 Ga0373951_0096208 3300035091 Unclassified 782
189 Ga0373923_0036776 3300035111 Bacteria 2000
190 Ga0373932_0003257 3300035112 Bacteria 3929
191 Ga0373932_0083351 3300035112 Bacteria 1014
192 Ga0373936_0005548 3300035113 Bacteria 4761
193 Ga0373939_0008527 3300035114 Bacteria 2515
194 Ga0373945_0030256 3300035116 Bacteria 1907
195 Ga0373943_0180923 3300035170 Bacteria 1158
196 Ga0373942_0005348 3300035207 Bacteria 2979
197 Ga0373942_0006811 3300035207 Bacteria 2640
198 Ga0373942_0235151 3300035207 Unclassified 618
199 Ga0373961_0009745 3300035241 Bacteria 2355
200 Ga0373961_0051766 3300035241 Bacteria 1220
201 Ga0373961_0316176 3300035241 Unclassified 581
202 Ga0373962_0007815 3300035242 Bacteria 2624
203 Ga0316574_0043845 3300035398 Bacteria 2765
204 Ga0373931_0000389 3300035691 Bacteria 18034
205 Ga0373931_0016584 3300035691 Bacteria 3628
206 Ga0373931_0065083 3300035691 Bacteria 1975
207 Ga0373931_0555595 3300035691 Bacteria 746
208 Ga0373931_1139713 3300035691 Bacteria 532
209 Ga0373935_0003177 3300035692 Bacteria 9472
210 Ga0373935_0927621 3300035692 Bacteria 645
211 Ga0373927_0017982 3300035695 Bacteria 4649
212 Ga0373933_0458444 3300035724 Unclassified 834
213 Ga0373947_0017453 3300035725 Bacteria 4127
214 Ga0373947_0339458 3300035725 Bacteria 1006
215 Ga0373937_0137349 3300036401 Bacteria 2286
216 Ga0316582_0001361 3300036647 Bacteria 10622
217 Ga0316582_0048633 3300036647 Bacteria 2682
218 Ga0316582_0068925 3300036647 Bacteria 2285
219 Ga0316584_0090361 3300036712 Bacteria 2292
220 Ga0373925_0079949 3300037068 Bacteria 2484
221 Ga0316581_0129338 3300037588 Bacteria 778
222 Ga0316581_0135185 3300037588 Bacteria 760
223 Ga0453684_1205680 3300044712 Bacteria 794
224 Ga0451576_0017095 3300045051 Bacteria 7981
225 Ga0451576_0074722 3300045051 Bacteria 3526
226 Ga0451576_0112958 3300045051 Bacteria 2827
227 Ga0451576_0410025 3300045051 Bacteria 1421
228 Ga0451576_0731739 3300045051 Bacteria 1039
229 Ga0451576_0879548 3300045051 Bacteria 940
230 Ga0451576_1580686 3300045051 Bacteria 680
231 Ga0495603_0021116 3300046455 Bacteria 3942
232 Ga0495580_0012899 3300046472 Bacteria 6402
233 Ga0495582_0065950 3300046473 Bacteria 2000
234 Ga0495630_0064810 3300046517 Bacteria 2746
235 Ga0495663_0204807 3300046525 Bacteria 689
236 Ga0495642_0131114 3300046528 Bacteria 1079
237 Ga0495586_0001150 3300046535 Bacteria 14818
238 Ga0495621_0159597 3300046539 Unclassified 891
239 Ga0495659_0027182 3300046664 Bacteria 1972
240 Ga0495659_0074757 3300046664 Bacteria 1275
241 Ga0495588_0002790 3300046674 Bacteria 7508
242 Ga0495647_0001149 3300046681 Bacteria 8126
243 Ga0495658_0001379 3300046683 Bacteria 12746
244 Ga0495669_0003970 3300046684 Bacteria 6087
245 Ga0495581_0042708 3300047315 Bacteria 2623
246 Ga0495636_0081142 3300047318 Bacteria 1397
247 Ga0495676_0026882 3300047321 Bacteria 4944
248 Ga0495614_0198106 3300048089 Bacteria 908
249 Ga0496114_0845220 3300048917 Bacteria 795
250 Ga0501298_098240 3300049521 Bacteria 665
251 Ga0501031_0346550 3300049568 Bacteria 962
252 Ga0501036_0222619 3300049572 Bacteria 1584
253 Ga0501036_0375226 3300049572 Bacteria 1187
254 Ga0501037_0044146 3300049573 Bacteria 3275
255 Ga0501037_0499680 3300049573 Bacteria 825
256 Ga0501039_0022488 3300049575 Bacteria 4840
257 Ga0501039_0421857 3300049575 Bacteria 1048
258 Ga0501040_0032192 3300049576 Bacteria 3548
259 Ga0501040_0041969 3300049576 Bacteria 3116
260 Ga0501040_0477321 3300049576 Bacteria 898
261 Ga0501040_0732447 3300049576 Bacteria 715
262 Ga0501041_0015543 3300049577 Bacteria 4521
263 Ga0501041_0059957 3300049577 Bacteria 2329
264 Ga0501041_0181860 3300049577 Bacteria 1316
265 Ga0501041_0192144 3300049577 Bacteria 1279
266 Ga0501041_0320867 3300049577 Bacteria 977
267 Ga0501042_1015221 3300049578 Bacteria 605
268 Ga0501046_0155050 3300049580 Bacteria 1726
269 Ga0501048_0191953 3300049582 Bacteria 1447
270 Ga0501048_0311680 3300049582 Bacteria 1120
271 Ga0501070_1369444 3300049586 Bacteria 538
272 Ga0501071_0095026 3300049587 Bacteria 2193
273 Ga0501071_0615769 3300049587 Bacteria 835
274 Ga0501072_0061556 3300049588 Bacteria 2961
275 Ga0501072_0069094 3300049588 Bacteria 2789
276 Ga0501072_0739479 3300049588 Bacteria 772
277 Ga0501072_0804031 3300049588 Bacteria 736
278 Ga0501073_0093496 3300049589 Bacteria 2089
279 Ga0501075_0328529 3300049591 Bacteria 1165
280 Ga0501076_0247862 3300049592 Bacteria 1457
281 Ga0501225_0262047 3300049705 Bacteria 572
282 Ga0501079_0324050 3300049741 Bacteria 1206
283 Ga0501081_0159857 3300049743 Bacteria 1623
284 Ga0501045_0032014 3300049824 Bacteria 3809
285 Ga0501045_0166279 3300049824 Bacteria 1643
286 Ga0501045_0293127 3300049824 Bacteria 1211
287 nmdc:mga0k408_135971_c1 3300050493 Bacteria 1460
288 nmdc:mga05p37_2142_c1 3300050507 Bacteria 23057
289 nmdc:mga05p37_354208_c1 3300050507 Bacteria 1727
290 nmdc:mga09592_1613_c1 3300050508 Bacteria 18164
291 nmdc:mga09592_454839_c1 3300050508 Bacteria 1104
292 nmdc:mga0qj67_154430_c1 3300050509 Bacteria 1862
293 nmdc:mga0qj67_29051_c1 3300050509 Bacteria 4293
294 nmdc:mga06r32_223521_c1 3300050510 Bacteria 1871
295 nmdc:mga08y16_1151_c1 3300050511 Bacteria 26051
296 nmdc:mga08y16_448611_c1 3300050511 Bacteria 1316
297 nmdc:mga0n895_2444_c1 3300050512 Bacteria 14514
298 nmdc:mga0n895_42591_c1 3300050512 Bacteria 4418
299 nmdc:mga0n895_739194_c1 3300050512 Bacteria 978
300 nmdc:mga0n895_915_c1 3300050512 Bacteria 21233
301 nmdc:mga0rr50_33471_c1 3300050513 Bacteria 3672
302 nmdc:mga0rr50_701_c1 3300050513 Bacteria 17960
303 nmdc:mga0rr50_75876_c1 3300050513 Bacteria 2579
304 nmdc:mga08x19_1038_c1 3300050514 Bacteria 17363
305 nmdc:mga08x19_48027_c1 3300050514 Bacteria 2733
306 nmdc:mga08x19_481451_c1 3300050514 Bacteria 875
307 nmdc:mga0a205_187_c1 3300050515 Bacteria 42758
308 nmdc:mga0a205_20775_c1 3300050515 Bacteria 6202
309 nmdc:mga0a205_239373_c1 3300050515 Bacteria 1696
310 Ga0501084_0177349 3300054114 Bacteria 1799
311 Ga0501082_0249920 3300060353 Bacteria 1543
312 Ga0501082_0416414 3300060353 Bacteria 1173
313 Ga0501082_0563925 3300060353 Bacteria 996
314 Ga0501082_0575894 3300060353 Bacteria 985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0732447 Ga0501040_0732447_335_691 118
2 3300027395 Ga0209996_1045764 Ga0209996_10457642 124
3 3300027462 Ga0210000_1030350 Ga0210000_10303502 124
4 3300027543 Ga0209999_1005460 Ga0209999_10054603 124
5 3300049578 Ga0501042_1015221 Ga0501042_1015221_166_540 124
6 3300049587 Ga0501071_0615769 Ga0501071_0615769_162_536 124
7 3300049588 Ga0501072_0804031 Ga0501072_0804031_223_597 124
8 3300035692 Ga0373935_0927621 Ga0373935_0927621_11_394 127
9 3300035725 Ga0373947_0017453 Ga0373947_0017453_3733_4116 127
10 3300035725 Ga0373947_0339458 Ga0373947_0339458_12_395 127
11 3300049568 Ga0501031_0346550 Ga0501031_0346550_360_755 131
12 3300049572 Ga0501036_0375226 Ga0501036_0375226_278_673 131
13 3300049575 Ga0501039_0421857 Ga0501039_0421857_80_475 131
14 3300049577 Ga0501041_0059957 Ga0501041_0059957_1604_1999 131
15 3300049577 Ga0501041_0192144 Ga0501041_0192144_207_602 131
16 3300049582 Ga0501048_0191953 Ga0501048_0191953_352_747 131
17 3300049587 Ga0501071_0095026 Ga0501071_0095026_1095_1490 131
18 3300049591 Ga0501075_0328529 Ga0501075_0328529_25_420 131
19 3300049592 Ga0501076_0247862 Ga0501076_0247862_54_449 131
20 3300049741 Ga0501079_0324050 Ga0501079_0324050_430_825 131
21 3300049743 Ga0501081_0159857 Ga0501081_0159857_393_788 131
22 3300049824 Ga0501045_0032014 Ga0501045_0032014_1373_1768 131
23 3300049824 Ga0501045_0293127 Ga0501045_0293127_255_650 131
24 3300060353 Ga0501082_0249920 Ga0501082_0249920_572_967 131
25 3300046528 Ga0495642_0131114 Ga0495642_0131114_545_946 133
26 3300046539 Ga0495621_0159597 Ga0495621_0159597_240_641 133
27 3300046664 Ga0495659_0074757 Ga0495659_0074757_531_932 133
28 3300032137 Ga0316585_10054251 Ga0316585_100542512 134
29 3300032139 Ga0316580_10034912 Ga0316580_100349121 134
30 3300035398 Ga0316574_0043845 Ga0316574_0043845_1766_2182 134
31 3300036647 Ga0316582_0048633 Ga0316582_0048633_61_477 134
32 3300036712 Ga0316584_0090361 Ga0316584_0090361_1412_1828 134
33 3300005343 Ga0070687_100638797 Ga0070687_1006387972 135
34 3300005444 Ga0070694_100049649 Ga0070694_1000496494 135
35 3300005445 Ga0070708_100909109 Ga0070708_1009091092 135
36 3300005530 Ga0070679_101408879 Ga0070679_1014088792 135
37 3300005544 Ga0070686_101037409 Ga0070686_1010374091 135
38 3300005545 Ga0070695_100527420 Ga0070695_1005274201 135
39 3300005546 Ga0070696_100373828 Ga0070696_1003738282 135
40 3300005842 Ga0068858_100724421 Ga0068858_1007244212 135
41 3300006173 Ga0070716_100472058 Ga0070716_1004720582 135
42 3300006852 Ga0075433_10067828 Ga0075433_100678284 135
43 3300006852 Ga0075433_10218778 Ga0075433_102187783 135
44 3300006871 Ga0075434_100000551 Ga0075434_10000055117 135
45 3300006871 Ga0075434_101414353 Ga0075434_1014143532 135
46 3300006914 Ga0075436_100100768 Ga0075436_1001007682 135
47 3300007076 Ga0075435_100009872 Ga0075435_1000098723 135
48 3300007076 Ga0075435_100048450 Ga0075435_1000484503 135
49 3300009147 Ga0114129_11098983 Ga0114129_110989832 135
50 3300009553 Ga0105249_12196920 Ga0105249_121969201 135
51 3300025939 Ga0207665_10605596 Ga0207665_106055962 135
52 3300026035 Ga0207703_10594764 Ga0207703_105947642 135
53 3300035112 Ga0373932_0083351 Ga0373932_0083351_166_573 135
54 3300035241 Ga0373961_0051766 Ga0373961_0051766_716_1126 135
55 3300035691 Ga0373931_0555595 Ga0373931_0555595_205_615 135
56 3300035691 Ga0373931_1139713 Ga0373931_1139713_48_455 135
57 3300046525 Ga0495663_0204807 Ga0495663_0204807_78_485 135
58 3300046664 Ga0495659_0027182 Ga0495659_0027182_1211_1618 135
59 3300046684 Ga0495669_0003970 Ga0495669_0003970_4284_4691 135
60 3300047318 Ga0495636_0081142 Ga0495636_0081142_746_1153 135
61 3300049521 Ga0501298_098240 Ga0501298_098240_224_631 135
62 3300049586 Ga0501070_1369444 Ga0501070_1369444_74_481 135
63 3300049705 Ga0501225_0262047 Ga0501225_0262047_35_442 135
64 3300050507 nmdc:mga05p37_354208_c1 nmdc:mga05p37_354208_c1_180_587 135
65 3300050512 nmdc:mga0n895_42591_c1 nmdc:mga0n895_42591_c1_3206_3613 135
66 3300050512 nmdc:mga0n895_739194_c1 nmdc:mga0n895_739194_c1_498_905 135
67 3300050512 nmdc:mga0n895_915_c1 nmdc:mga0n895_915_c1_18953_19360 135
68 3300050513 nmdc:mga0rr50_33471_c1 nmdc:mga0rr50_33471_c1_2257_2664 135
69 3300050513 nmdc:mga0rr50_75876_c1 nmdc:mga0rr50_75876_c1_962_1369 135
70 3300050514 nmdc:mga08x19_48027_c1 nmdc:mga08x19_48027_c1_2204_2611 135
71 3300050514 nmdc:mga08x19_481451_c1 nmdc:mga08x19_481451_c1_56_463 135
72 3300050515 nmdc:mga0a205_20775_c1 nmdc:mga0a205_20775_c1_1422_1829 135
73 3300050515 nmdc:mga0a205_239373_c1 nmdc:mga0a205_239373_c1_265_672 135
74 3300005468 Ga0070707_100774570 Ga0070707_1007745701 136
75 3300005518 Ga0070699_100109879 Ga0070699_1001098793 136
76 3300005841 Ga0068863_100721193 Ga0068863_1007211933 136
77 3300026088 Ga0207641_10945955 Ga0207641_109459552 136
78 3300035724 Ga0373933_0458444 Ga0373933_0458444_313_726 136
79 3300036401 Ga0373937_0137349 Ga0373937_0137349_991_1404 136
80 3300005546 Ga0070696_100468800 Ga0070696_1004688003 137
81 3300006846 Ga0075430_100111332 Ga0075430_1001113322 137
82 3300007265 Ga0099794_10233283 Ga0099794_102332831 137
83 3300031852 Ga0307410_10378948 Ga0307410_103789482 137
84 3300031903 Ga0307407_10285624 Ga0307407_102856242 137
85 3300032005 Ga0307411_10141747 Ga0307411_101417472 137
86 3300049572 Ga0501036_0222619 Ga0501036_0222619_248_661 137
87 3300049573 Ga0501037_0044146 Ga0501037_0044146_174_590 137
88 3300049573 Ga0501037_0499680 Ga0501037_0499680_32_445 137
89 3300049575 Ga0501039_0022488 Ga0501039_0022488_1191_1604 137
90 3300049576 Ga0501040_0032192 Ga0501040_0032192_459_872 137
91 3300049576 Ga0501040_0041969 Ga0501040_0041969_658_1071 137
92 3300049577 Ga0501041_0015543 Ga0501041_0015543_2554_2967 137
93 3300049577 Ga0501041_0181860 Ga0501041_0181860_837_1253 137
94 3300049580 Ga0501046_0155050 Ga0501046_0155050_399_812 137
95 3300049582 Ga0501048_0311680 Ga0501048_0311680_276_689 137
96 3300049588 Ga0501072_0061556 Ga0501072_0061556_981_1394 137
97 3300049588 Ga0501072_0739479 Ga0501072_0739479_152_568 137
98 3300049824 Ga0501045_0166279 Ga0501045_0166279_55_471 137
99 3300050508 nmdc:mga09592_454839_c1 nmdc:mga09592_454839_c1_17_430 137
100 3300050509 nmdc:mga0qj67_29051_c1 nmdc:mga0qj67_29051_c1_602_1015 137
101 3300060353 Ga0501082_0563925 Ga0501082_0563925_31_447 137
102 3300060353 Ga0501082_0575894 Ga0501082_0575894_109_522 137
103 3300005345 Ga0070692_10331901 Ga0070692_103319013 140
104 3300005440 Ga0070705_100437448 Ga0070705_1004374481 140
105 3300005459 Ga0068867_102202628 Ga0068867_1022026281 140
106 3300026089 Ga0207648_12227312 Ga0207648_122273121 140
107 3300031711 Ga0265314_10226437 Ga0265314_102264373 140
108 3300032002 Ga0307416_101005718 Ga0307416_1010057181 140
109 3300049589 Ga0501073_0093496 Ga0501073_0093496_727_1152 140
110 3300050493 nmdc:mga0k408_135971_c1 nmdc:mga0k408_135971_c1_122_547 140
111 3300005295 Ga0065707_10004631 Ga0065707_100046315 142
112 3300005295 Ga0065707_10345827 Ga0065707_103458272 142
113 3300005330 Ga0070690_100001653 Ga0070690_1000016534 142
114 3300005334 Ga0068869_100000423 Ga0068869_1000004234 142
115 3300005336 Ga0070680_100001243 Ga0070680_1000012438 142
116 3300005336 Ga0070680_100641823 Ga0070680_1006418232 142
117 3300005337 Ga0070682_100009146 Ga0070682_1000091464 142
118 3300005338 Ga0068868_100000271 Ga0068868_10000027124 142
119 3300005340 Ga0070689_100006573 Ga0070689_1000065737 142
120 3300005340 Ga0070689_100101015 Ga0070689_1001010153 142
121 3300005341 Ga0070691_10001218 Ga0070691_100012186 142
122 3300005343 Ga0070687_100000109 Ga0070687_10000010920 142
123 3300005353 Ga0070669_100824100 Ga0070669_1008241001 142
124 3300005356 Ga0070674_100540179 Ga0070674_1005401792 142
125 3300005364 Ga0070673_100062065 Ga0070673_1000620653 142
126 3300005364 Ga0070673_100389988 Ga0070673_1003899882 142
127 3300005406 Ga0070703_10018974 Ga0070703_100189743 142
128 3300005438 Ga0070701_10000272 Ga0070701_1000027217 142
129 3300005438 Ga0070701_10561217 Ga0070701_105612171 142
130 3300005440 Ga0070705_100000460 Ga0070705_10000046017 142
131 3300005440 Ga0070705_100038112 Ga0070705_1000381123 142
132 3300005441 Ga0070700_100038989 Ga0070700_1000389893 142
133 3300005444 Ga0070694_100006519 Ga0070694_1000065198 142
134 3300005445 Ga0070708_100483340 Ga0070708_1004833402 142
135 3300005456 Ga0070678_100744200 Ga0070678_1007442001 142
136 3300005458 Ga0070681_10095600 Ga0070681_100956003 142
137 3300005459 Ga0068867_100000169 Ga0068867_10000016927 142
138 3300005530 Ga0070679_100032403 Ga0070679_1000324035 142
139 3300005535 Ga0070684_100694875 Ga0070684_1006948752 142
140 3300005539 Ga0068853_100151068 Ga0068853_1001510683 142
141 3300005544 Ga0070686_100001592 Ga0070686_10000159210 142
142 3300005545 Ga0070695_100000521 Ga0070695_10000052120 142
143 3300005546 Ga0070696_100000143 Ga0070696_10000014316 142
144 3300005546 Ga0070696_100070688 Ga0070696_1000706882 142
145 3300005547 Ga0070693_100000043 Ga0070693_10000004331 142
146 3300005547 Ga0070693_100272772 Ga0070693_1002727722 142
147 3300005549 Ga0070704_100000027 Ga0070704_10000002731 142
148 3300005563 Ga0068855_100010922 Ga0068855_1000109226 142
149 3300005563 Ga0068855_100339814 Ga0068855_1003398142 142
150 3300005578 Ga0068854_100021606 Ga0068854_1000216063 142
151 3300005614 Ga0068856_100004523 Ga0068856_10000452315 142
152 3300005614 Ga0068856_100570021 Ga0068856_1005700213 142
153 3300005615 Ga0070702_100000162 Ga0070702_10000016210 142
154 3300005616 Ga0068852_100041914 Ga0068852_1000419144 142
155 3300005617 Ga0068859_100002085 Ga0068859_10000208510 142
156 3300005618 Ga0068864_100050006 Ga0068864_1000500063 142
157 3300005718 Ga0068866_10001447 Ga0068866_100014475 142
158 3300005719 Ga0068861_100000189 Ga0068861_1000001894 142
159 3300005840 Ga0068870_10025211 Ga0068870_100252114 142
160 3300005841 Ga0068863_100568309 Ga0068863_1005683092 142
161 3300005842 Ga0068858_100000286 Ga0068858_10000028642 142
162 3300005842 Ga0068858_100037522 Ga0068858_1000375223 142
163 3300005843 Ga0068860_100000770 Ga0068860_10000077032 142
164 3300005843 Ga0068860_100143920 Ga0068860_1001439202 142
165 3300005844 Ga0068862_100000639 Ga0068862_1000006396 142
166 3300006237 Ga0097621_100000447 Ga0097621_10000044716 142
167 3300006358 Ga0068871_100000853 Ga0068871_10000085317 142
168 3300006844 Ga0075428_100006275 Ga0075428_1000062754 142
169 3300006846 Ga0075430_100157268 Ga0075430_1001572683 142
170 3300006852 Ga0075433_10001192 Ga0075433_1000119219 142
171 3300006852 Ga0075433_10790534 Ga0075433_107905342 142
172 3300006871 Ga0075434_100000302 Ga0075434_10000030224 142
173 3300006880 Ga0075429_100001646 Ga0075429_10000164619 142
174 3300006881 Ga0068865_100000043 Ga0068865_10000004317 142
175 3300006914 Ga0075436_100000386 Ga0075436_1000003867 142
176 3300006931 Ga0097620_100002085 Ga0097620_10000208510 142
177 3300007076 Ga0075435_100003547 Ga0075435_10000354710 142
178 3300009093 Ga0105240_10653666 Ga0105240_106536661 142
179 3300009094 Ga0111539_10020815 Ga0111539_1002081510 142
180 3300009094 Ga0111539_10025680 Ga0111539_100256804 142
181 3300009094 Ga0111539_11114086 Ga0111539_111140862 142
182 3300009098 Ga0105245_10000271 Ga0105245_1000027117 142
183 3300009101 Ga0105247_10310240 Ga0105247_103102402 142
184 3300009147 Ga0114129_10001887 Ga0114129_1000188719 142
185 3300009148 Ga0105243_10001232 Ga0105243_1000123223 142
186 3300009174 Ga0105241_10066672 Ga0105241_100666723 142
187 3300009176 Ga0105242_10001304 Ga0105242_1000130412 142
188 3300009177 Ga0105248_10130355 Ga0105248_101303553 142
189 3300009553 Ga0105249_10000756 Ga0105249_100007567 142
190 3300010375 Ga0105239_10033403 Ga0105239_100334035 142
191 3300010375 Ga0105239_11552355 Ga0105239_115523552 142
192 3300012506 Ga0157324_1021364 Ga0157324_10213642 142
193 3300013296 Ga0157374_10792447 Ga0157374_107924471 142
194 3300013297 Ga0157378_10000140 Ga0157378_1000014016 142
195 3300013307 Ga0157372_10567088 Ga0157372_105670882 142
196 3300013308 Ga0157375_10230745 Ga0157375_102307453 142
197 3300014326 Ga0157380_10109518 Ga0157380_101095182 142
198 3300014745 Ga0157377_10177156 Ga0157377_101771563 142
199 3300014745 Ga0157377_10521531 Ga0157377_105215312 142
200 3300014969 Ga0157376_10001071 Ga0157376_100010716 142
201 3300025899 Ga0207642_10001374 Ga0207642_100013747 142
202 3300025906 Ga0207699_10449013 Ga0207699_104490132 142
203 3300025908 Ga0207643_10223122 Ga0207643_102231223 142
204 3300025911 Ga0207654_10014921 Ga0207654_100149215 142
205 3300025912 Ga0207707_10105200 Ga0207707_101052005 142
206 3300025917 Ga0207660_10004531 Ga0207660_100045315 142
207 3300025917 Ga0207660_10472207 Ga0207660_104722071 142
208 3300025918 Ga0207662_10000024 Ga0207662_1000002416 142
209 3300025921 Ga0207652_10102328 Ga0207652_101023283 142
210 3300025923 Ga0207681_10621265 Ga0207681_106212652 142
211 3300025927 Ga0207687_10002713 Ga0207687_1000271313 142
212 3300025931 Ga0207644_10310923 Ga0207644_103109233 142
213 3300025934 Ga0207686_10000608 Ga0207686_100006085 142
214 3300025935 Ga0207709_10007238 Ga0207709_100072388 142
215 3300025936 Ga0207670_10003374 Ga0207670_100033743 142
216 3300025937 Ga0207669_10435440 Ga0207669_104354402 142
217 3300025938 Ga0207704_10000328 Ga0207704_100003284 142
218 3300025941 Ga0207711_10146056 Ga0207711_101460563 142
219 3300025942 Ga0207689_10000162 Ga0207689_100001624 142
220 3300025949 Ga0207667_10152518 Ga0207667_101525182 142
221 3300025949 Ga0207667_10188988 Ga0207667_101889883 142
222 3300025960 Ga0207651_10380205 Ga0207651_103802053 142
223 3300025961 Ga0207712_10000637 Ga0207712_1000063713 142
224 3300025981 Ga0207640_10017324 Ga0207640_100173244 142
225 3300026023 Ga0207677_10088700 Ga0207677_100887003 142
226 3300026035 Ga0207703_10085812 Ga0207703_100858122 142
227 3300026035 Ga0207703_12055363 Ga0207703_120553631 142
228 3300026041 Ga0207639_10025169 Ga0207639_100251695 142
229 3300026075 Ga0207708_10065945 Ga0207708_100659453 142
230 3300026078 Ga0207702_10459051 Ga0207702_104590512 142
231 3300026088 Ga0207641_10122460 Ga0207641_101224602 142
232 3300026088 Ga0207641_10731072 Ga0207641_107310723 142
233 3300026088 Ga0207641_11301782 Ga0207641_113017822 142
234 3300026089 Ga0207648_10000147 Ga0207648_1000014717 142
235 3300026118 Ga0207675_100000104 Ga0207675_10000010416 142
236 3300026121 Ga0207683_10131190 Ga0207683_101311903 142
237 3300026142 Ga0207698_10014617 Ga0207698_100146174 142
238 3300027907 Ga0207428_10000969 Ga0207428_1000096916 142
239 3300027907 Ga0207428_10371893 Ga0207428_103718933 142
240 3300028380 Ga0268265_10000892 Ga0268265_1000089216 142
241 3300028381 Ga0268264_10000992 Ga0268264_1000099225 142
242 3300028381 Ga0268264_10330806 Ga0268264_103308063 142
243 3300031665 Ga0316575_10005668 Ga0316575_100056683 142
244 3300031691 Ga0316579_10003689 Ga0316579_100036894 142
245 3300032133 Ga0316583_10015355 Ga0316583_100153553 142
246 3300034816 Ga0373930_0028655 Ga0373930_0028655_313_741 142
247 3300034819 Ga0373958_0003167 Ga0373958_0003167_951_1379 142
248 3300034957 Ga0373938_0056571 Ga0373938_0056571_264_692 142
249 3300035084 Ga0373928_0006824 Ga0373928_0006824_1543_1971 142
250 3300035084 Ga0373928_0125133 Ga0373928_0125133_171_599 142
251 3300035088 Ga0373940_0008964 Ga0373940_0008964_1214_1642 142
252 3300035088 Ga0373940_0081577 Ga0373940_0081577_221_649 142
253 3300035089 Ga0373944_0010486 Ga0373944_0010486_1487_1915 142
254 3300035090 Ga0373949_0008766 Ga0373949_0008766_1430_1858 142
255 3300035091 Ga0373951_0041714 Ga0373951_0041714_511_939 142
256 3300035091 Ga0373951_0042660 Ga0373951_0042660_79_507 142
257 3300035091 Ga0373951_0096208 Ga0373951_0096208_285_713 142
258 3300035111 Ga0373923_0036776 Ga0373923_0036776_611_1039 142
259 3300035112 Ga0373932_0003257 Ga0373932_0003257_1995_2423 142
260 3300035113 Ga0373936_0005548 Ga0373936_0005548_2348_2776 142
261 3300035114 Ga0373939_0008527 Ga0373939_0008527_1449_1877 142
262 3300035116 Ga0373945_0030256 Ga0373945_0030256_1049_1477 142
263 3300035170 Ga0373943_0180923 Ga0373943_0180923_701_1129 142
264 3300035207 Ga0373942_0005348 Ga0373942_0005348_355_783 142
265 3300035207 Ga0373942_0006811 Ga0373942_0006811_77_505 142
266 3300035207 Ga0373942_0235151 Ga0373942_0235151_25_453 142
267 3300035241 Ga0373961_0009745 Ga0373961_0009745_237_665 142
268 3300035241 Ga0373961_0316176 Ga0373961_0316176_123_551 142
269 3300035242 Ga0373962_0007815 Ga0373962_0007815_367_795 142
270 3300035691 Ga0373931_0000389 Ga0373931_0000389_12884_13312 142
271 3300035691 Ga0373931_0016584 Ga0373931_0016584_2652_3080 142
272 3300035691 Ga0373931_0065083 Ga0373931_0065083_678_1106 142
273 3300035692 Ga0373935_0003177 Ga0373935_0003177_5052_5480 142
274 3300035695 Ga0373927_0017982 Ga0373927_0017982_1496_1924 142
275 3300036647 Ga0316582_0001361 Ga0316582_0001361_141_584 142
276 3300036647 Ga0316582_0068925 Ga0316582_0068925_1676_2119 142
277 3300037068 Ga0373925_0079949 Ga0373925_0079949_2027_2455 142
278 3300037588 Ga0316581_0129338 Ga0316581_0129338_160_603 142
279 3300037588 Ga0316581_0135185 Ga0316581_0135185_161_604 142
280 3300044712 Ga0453684_1205680 Ga0453684_1205680_215_643 142
281 3300045051 Ga0451576_0017095 Ga0451576_0017095_2107_2535 142
282 3300045051 Ga0451576_0074722 Ga0451576_0074722_2409_2837 142
283 3300045051 Ga0451576_0112958 Ga0451576_0112958_24_452 142
284 3300045051 Ga0451576_0410025 Ga0451576_0410025_297_725 142
285 3300045051 Ga0451576_0731739 Ga0451576_0731739_192_620 142
286 3300045051 Ga0451576_0879548 Ga0451576_0879548_335_763 142
287 3300045051 Ga0451576_1580686 Ga0451576_1580686_103_531 142
288 3300046455 Ga0495603_0021116 Ga0495603_0021116_389_817 142
289 3300046472 Ga0495580_0012899 Ga0495580_0012899_1698_2126 142
290 3300046473 Ga0495582_0065950 Ga0495582_0065950_15_443 142
291 3300046517 Ga0495630_0064810 Ga0495630_0064810_187_615 142
292 3300046535 Ga0495586_0001150 Ga0495586_0001150_8946_9374 142
293 3300046674 Ga0495588_0002790 Ga0495588_0002790_6301_6729 142
294 3300046681 Ga0495647_0001149 Ga0495647_0001149_6460_6888 142
295 3300046683 Ga0495658_0001379 Ga0495658_0001379_3118_3546 142
296 3300047315 Ga0495581_0042708 Ga0495581_0042708_1507_1935 142
297 3300047321 Ga0495676_0026882 Ga0495676_0026882_3639_4067 142
298 3300048089 Ga0495614_0198106 Ga0495614_0198106_177_605 142
299 3300048917 Ga0496114_0845220 Ga0496114_0845220_173_601 142
300 3300049576 Ga0501040_0477321 Ga0501040_0477321_22_450 142
301 3300049577 Ga0501041_0320867 Ga0501041_0320867_79_507 142
302 3300049588 Ga0501072_0069094 Ga0501072_0069094_1943_2371 142
303 3300050507 nmdc:mga05p37_2142_c1 nmdc:mga05p37_2142_c1_13502_13930 142
304 3300050508 nmdc:mga09592_1613_c1 nmdc:mga09592_1613_c1_4264_4692 142
305 3300050509 nmdc:mga0qj67_154430_c1 nmdc:mga0qj67_154430_c1_1378_1806 142
306 3300050510 nmdc:mga06r32_223521_c1 nmdc:mga06r32_223521_c1_1056_1484 142
307 3300050511 nmdc:mga08y16_1151_c1 nmdc:mga08y16_1151_c1_15206_15634 142
308 3300050511 nmdc:mga08y16_448611_c1 nmdc:mga08y16_448611_c1_314_742 142
309 3300050512 nmdc:mga0n895_2444_c1 nmdc:mga0n895_2444_c1_11663_12091 142
310 3300050513 nmdc:mga0rr50_701_c1 nmdc:mga0rr50_701_c1_17486_17914 142
311 3300050514 nmdc:mga08x19_1038_c1 nmdc:mga08x19_1038_c1_3673_4101 142
312 3300050515 nmdc:mga0a205_187_c1 nmdc:mga0a205_187_c1_38266_38694 142
313 3300054114 Ga0501084_0177349 Ga0501084_0177349_857_1285 142
314 3300060353 Ga0501082_0416414 Ga0501082_0416414_502_930 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01337

Barstar

Barstar (barnase inhibitor)

34

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b3s-assembly2.cif.gz_E structural response to mutation at a protein-protein interface 0.7774 35 125
1b2s-assembly3.cif.gz_F structural response to mutation at a protein-protein interface 0.7765 35 126
1b2s-assembly3.cif.gz_F structural response to mutation at a protein-protein interface 0.7616 35 126
2za4-assembly4.cif.gz_B crystal structural analysis of barnase-barstar complex 0.7613 35 126
1b3s-assembly3.cif.gz_F structural response to mutation at a protein-protein interface 0.7531 35 126
ID Description Score Start End Superfamily
1btbA00 Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like 0.753 35 126 3.30.370.10
1btbA00 Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like 0.739 35 126 3.30.370.10
2cx6B00 Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like 0.7165 35 128 3.30.370.10
1bv0E00 Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like 0.713 38 125 3.30.370.10
af_Q57824_3_139_3.40.50.11700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7069 84 131 3.40.50.11700
ID Description Score Start End GO Terms
AF-H0E4L2-F1-model_v4 Barstar (barnase inhibitor) domain-containing protein 0.9711 36 126
AF-A0A521YQJ0-F1-model_v4 Barnase inhibitor 0.9683 1 142
AF-A0A521YQJ0-F1-model_v4 Barnase inhibitor 0.9616 1 142
AF-A0A0S8B9S5-F1-model_v4 Barstar (barnase inhibitor) domain-containing protein 0.9564 10 137
AF-A0A1G3G0U3-F1-model_v4 Barnase inhibitor 0.9488 34 134

Feature Viewer

pLDDT pTM Quality
92.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map