F402749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 207 | 314 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10005668|Ga0316575_100056683 |
| Length | 147 |
| Sequence | MSKLLARLRDASRSGVYRASQADEILDALRGAGFDLVRIDLAPVSEKEQLLERLASELAFPQWFGRNWDALEDCLTDLSWRAGGQHVLLIEGFETLRARRPDEFGVLVDILASSAQYWSERGRPFFAVFLDGENILALPDLFRRKGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 119 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 125 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 126 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 127 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 128 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 129 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 130 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 131 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 132 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 153 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 177 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 99.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10004631 | 3300005295 | Bacteria | 3406 |
| 2 | Ga0065707_10345827 | 3300005295 | Bacteria | 922 |
| 3 | Ga0070690_100001653 | 3300005330 | Bacteria | 11726 |
| 4 | Ga0068869_100000423 | 3300005334 | Bacteria | 23067 |
| 5 | Ga0070680_100001243 | 3300005336 | Bacteria | 18371 |
| 6 | Ga0070680_100641823 | 3300005336 | Bacteria | 912 |
| 7 | Ga0070682_100009146 | 3300005337 | Bacteria | 5601 |
| 8 | Ga0068868_100000271 | 3300005338 | Bacteria | 34837 |
| 9 | Ga0070689_100006573 | 3300005340 | Bacteria | 8064 |
| 10 | Ga0070689_100101015 | 3300005340 | Bacteria | 2282 |
| 11 | Ga0070691_10001218 | 3300005341 | Bacteria | 10822 |
| 12 | Ga0070687_100000109 | 3300005343 | Bacteria | 27960 |
| 13 | Ga0070687_100638797 | 3300005343 | Unclassified | 736 |
| 14 | Ga0070692_10331901 | 3300005345 | Bacteria | 939 |
| 15 | Ga0070669_100824100 | 3300005353 | Bacteria | 789 |
| 16 | Ga0070674_100540179 | 3300005356 | Bacteria | 976 |
| 17 | Ga0070673_100062065 | 3300005364 | Bacteria | 2968 |
| 18 | Ga0070673_100389988 | 3300005364 | Bacteria | 1243 |
| 19 | Ga0070703_10018974 | 3300005406 | Bacteria | 1992 |
| 20 | Ga0070701_10000272 | 3300005438 | Bacteria | 16935 |
| 21 | Ga0070701_10561217 | 3300005438 | Bacteria | 750 |
| 22 | Ga0070705_100000460 | 3300005440 | Bacteria | 23393 |
| 23 | Ga0070705_100038112 | 3300005440 | Bacteria | 2717 |
| 24 | Ga0070705_100437448 | 3300005440 | Bacteria | 978 |
| 25 | Ga0070700_100038989 | 3300005441 | Bacteria | 2899 |
| 26 | Ga0070694_100006519 | 3300005444 | Bacteria | 7091 |
| 27 | Ga0070694_100049649 | 3300005444 | Bacteria | 2826 |
| 28 | Ga0070708_100483340 | 3300005445 | Bacteria | 1168 |
| 29 | Ga0070708_100909109 | 3300005445 | Bacteria | 826 |
| 30 | Ga0070678_100744200 | 3300005456 | Unclassified | 886 |
| 31 | Ga0070681_10095600 | 3300005458 | Bacteria | 2920 |
| 32 | Ga0068867_100000169 | 3300005459 | Bacteria | 42652 |
| 33 | Ga0068867_102202628 | 3300005459 | Unclassified | 523 |
| 34 | Ga0070707_100774570 | 3300005468 | Bacteria | 923 |
| 35 | Ga0070699_100109879 | 3300005518 | Bacteria | 2420 |
| 36 | Ga0070679_100032403 | 3300005530 | Bacteria | 5169 |
| 37 | Ga0070679_101408879 | 3300005530 | Bacteria | 643 |
| 38 | Ga0070684_100694875 | 3300005535 | Bacteria | 948 |
| 39 | Ga0068853_100151068 | 3300005539 | Bacteria | 2091 |
| 40 | Ga0070686_100001592 | 3300005544 | Bacteria | 12752 |
| 41 | Ga0070686_101037409 | 3300005544 | Bacteria | 674 |
| 42 | Ga0070695_100000521 | 3300005545 | Bacteria | 20258 |
| 43 | Ga0070695_100527420 | 3300005545 | Bacteria | 917 |
| 44 | Ga0070696_100000143 | 3300005546 | Bacteria | 39364 |
| 45 | Ga0070696_100070688 | 3300005546 | Bacteria | 2456 |
| 46 | Ga0070696_100373828 | 3300005546 | Bacteria | 1109 |
| 47 | Ga0070696_100468800 | 3300005546 | Bacteria | 997 |
| 48 | Ga0070693_100000043 | 3300005547 | Bacteria | 48919 |
| 49 | Ga0070693_100272772 | 3300005547 | Bacteria | 1130 |
| 50 | Ga0070704_100000027 | 3300005549 | Bacteria | 47731 |
| 51 | Ga0068855_100010922 | 3300005563 | Bacteria | 10959 |
| 52 | Ga0068855_100339814 | 3300005563 | Bacteria | 1656 |
| 53 | Ga0068854_100021606 | 3300005578 | Bacteria | 4369 |
| 54 | Ga0068856_100004523 | 3300005614 | Bacteria | 13826 |
| 55 | Ga0068856_100570021 | 3300005614 | Bacteria | 1153 |
| 56 | Ga0070702_100000162 | 3300005615 | Bacteria | 21272 |
| 57 | Ga0068852_100041914 | 3300005616 | Bacteria | 3873 |
| 58 | Ga0068859_100002085 | 3300005617 | Bacteria | 20381 |
| 59 | Ga0068864_100050006 | 3300005618 | Bacteria | 3597 |
| 60 | Ga0068866_10001447 | 3300005718 | Bacteria | 10149 |
| 61 | Ga0068861_100000189 | 3300005719 | Bacteria | 32839 |
| 62 | Ga0068870_10025211 | 3300005840 | Bacteria | 2950 |
| 63 | Ga0068863_100568309 | 3300005841 | Bacteria | 1121 |
| 64 | Ga0068863_100721193 | 3300005841 | Bacteria | 992 |
| 65 | Ga0068858_100000286 | 3300005842 | Bacteria | 54596 |
| 66 | Ga0068858_100037522 | 3300005842 | Bacteria | 4494 |
| 67 | Ga0068858_100724421 | 3300005842 | Bacteria | 968 |
| 68 | Ga0068860_100000770 | 3300005843 | Bacteria | 36109 |
| 69 | Ga0068860_100143920 | 3300005843 | Bacteria | 2293 |
| 70 | Ga0068862_100000639 | 3300005844 | Bacteria | 36261 |
| 71 | Ga0070716_100472058 | 3300006173 | Unclassified | 919 |
| 72 | Ga0097621_100000447 | 3300006237 | Bacteria | 28911 |
| 73 | Ga0068871_100000853 | 3300006358 | Bacteria | 20356 |
| 74 | Ga0075428_100006275 | 3300006844 | Bacteria | 13220 |
| 75 | Ga0075430_100111332 | 3300006846 | Bacteria | 2283 |
| 76 | Ga0075430_100157268 | 3300006846 | Bacteria | 1892 |
| 77 | Ga0075433_10001192 | 3300006852 | Bacteria | 18911 |
| 78 | Ga0075433_10067828 | 3300006852 | Bacteria | 3131 |
| 79 | Ga0075433_10218778 | 3300006852 | Bacteria | 1692 |
| 80 | Ga0075433_10790534 | 3300006852 | Bacteria | 829 |
| 81 | Ga0075434_100000302 | 3300006871 | Bacteria | 34971 |
| 82 | Ga0075434_100000551 | 3300006871 | Bacteria | 28665 |
| 83 | Ga0075434_101414353 | 3300006871 | Bacteria | 705 |
| 84 | Ga0075429_100001646 | 3300006880 | Bacteria | 18465 |
| 85 | Ga0068865_100000043 | 3300006881 | Bacteria | 70962 |
| 86 | Ga0075436_100000386 | 3300006914 | Bacteria | 28270 |
| 87 | Ga0075436_100100768 | 3300006914 | Bacteria | 2011 |
| 88 | Ga0097620_100002085 | 3300006931 | Bacteria | 20381 |
| 89 | Ga0075435_100003547 | 3300007076 | Bacteria | 10597 |
| 90 | Ga0075435_100009872 | 3300007076 | Bacteria | 6947 |
| 91 | Ga0075435_100048450 | 3300007076 | Bacteria | 3414 |
| 92 | Ga0099794_10233283 | 3300007265 | Bacteria | 947 |
| 93 | Ga0105240_10653666 | 3300009093 | Bacteria | 1152 |
| 94 | Ga0111539_10020815 | 3300009094 | Bacteria | 8076 |
| 95 | Ga0111539_10025680 | 3300009094 | Bacteria | 7219 |
| 96 | Ga0111539_11114086 | 3300009094 | Unclassified | 917 |
| 97 | Ga0105245_10000271 | 3300009098 | Bacteria | 49162 |
| 98 | Ga0105247_10310240 | 3300009101 | Bacteria | 1097 |
| 99 | Ga0114129_10001887 | 3300009147 | Bacteria | 28595 |
| 100 | Ga0114129_11098983 | 3300009147 | Bacteria | 996 |
| 101 | Ga0105243_10001232 | 3300009148 | Bacteria | 23067 |
| 102 | Ga0105241_10066672 | 3300009174 | Bacteria | 2784 |
| 103 | Ga0105242_10001304 | 3300009176 | Bacteria | 19729 |
| 104 | Ga0105248_10130355 | 3300009177 | Bacteria | 2837 |
| 105 | Ga0105249_10000756 | 3300009553 | Bacteria | 29082 |
| 106 | Ga0105249_12196920 | 3300009553 | Bacteria | 625 |
| 107 | Ga0105239_10033403 | 3300010375 | Bacteria | 5650 |
| 108 | Ga0105239_11552355 | 3300010375 | Bacteria | 765 |
| 109 | Ga0157324_1021364 | 3300012506 | Bacteria | 662 |
| 110 | Ga0157374_10792447 | 3300013296 | Bacteria | 963 |
| 111 | Ga0157378_10000140 | 3300013297 | Bacteria | 67335 |
| 112 | Ga0157372_10567088 | 3300013307 | Bacteria | 1323 |
| 113 | Ga0157375_10230745 | 3300013308 | Bacteria | 2010 |
| 114 | Ga0157380_10109518 | 3300014326 | Bacteria | 2318 |
| 115 | Ga0157377_10177156 | 3300014745 | Bacteria | 1338 |
| 116 | Ga0157377_10521531 | 3300014745 | Bacteria | 834 |
| 117 | Ga0157376_10001071 | 3300014969 | Bacteria | 17927 |
| 118 | Ga0207642_10001374 | 3300025899 | Bacteria | 7551 |
| 119 | Ga0207699_10449013 | 3300025906 | Bacteria | 925 |
| 120 | Ga0207643_10223122 | 3300025908 | Bacteria | 1154 |
| 121 | Ga0207654_10014921 | 3300025911 | Bacteria | 4021 |
| 122 | Ga0207707_10105200 | 3300025912 | Bacteria | 2467 |
| 123 | Ga0207660_10004531 | 3300025917 | Bacteria | 9060 |
| 124 | Ga0207660_10472207 | 3300025917 | Bacteria | 1016 |
| 125 | Ga0207662_10000024 | 3300025918 | Bacteria | 70677 |
| 126 | Ga0207652_10102328 | 3300025921 | Bacteria | 2531 |
| 127 | Ga0207681_10621265 | 3300025923 | Bacteria | 894 |
| 128 | Ga0207687_10002713 | 3300025927 | Bacteria | 11975 |
| 129 | Ga0207644_10310923 | 3300025931 | Bacteria | 1272 |
| 130 | Ga0207686_10000608 | 3300025934 | Bacteria | 22371 |
| 131 | Ga0207709_10007238 | 3300025935 | Bacteria | 6189 |
| 132 | Ga0207670_10003374 | 3300025936 | Bacteria | 8473 |
| 133 | Ga0207669_10435440 | 3300025937 | Bacteria | 1035 |
| 134 | Ga0207704_10000328 | 3300025938 | Bacteria | 22138 |
| 135 | Ga0207665_10605596 | 3300025939 | Bacteria | 856 |
| 136 | Ga0207711_10146056 | 3300025941 | Bacteria | 2131 |
| 137 | Ga0207689_10000162 | 3300025942 | Bacteria | 57621 |
| 138 | Ga0207667_10152518 | 3300025949 | Bacteria | 2378 |
| 139 | Ga0207667_10188988 | 3300025949 | Bacteria | 2113 |
| 140 | Ga0207651_10380205 | 3300025960 | Bacteria | 1196 |
| 141 | Ga0207712_10000637 | 3300025961 | Bacteria | 27584 |
| 142 | Ga0207640_10017324 | 3300025981 | Bacteria | 4214 |
| 143 | Ga0207677_10088700 | 3300026023 | Bacteria | 2243 |
| 144 | Ga0207703_10085812 | 3300026035 | Bacteria | 2635 |
| 145 | Ga0207703_10594764 | 3300026035 | Bacteria | 1046 |
| 146 | Ga0207703_12055363 | 3300026035 | Bacteria | 547 |
| 147 | Ga0207639_10025169 | 3300026041 | Bacteria | 4315 |
| 148 | Ga0207708_10065945 | 3300026075 | Bacteria | 2768 |
| 149 | Ga0207702_10459051 | 3300026078 | Bacteria | 1237 |
| 150 | Ga0207641_10122460 | 3300026088 | Bacteria | 2323 |
| 151 | Ga0207641_10731072 | 3300026088 | Unclassified | 976 |
| 152 | Ga0207641_10945955 | 3300026088 | Bacteria | 857 |
| 153 | Ga0207641_11301782 | 3300026088 | Unclassified | 727 |
| 154 | Ga0207648_10000147 | 3300026089 | Bacteria | 70420 |
| 155 | Ga0207648_12227312 | 3300026089 | Bacteria | 509 |
| 156 | Ga0207675_100000104 | 3300026118 | Bacteria | 67261 |
| 157 | Ga0207683_10131190 | 3300026121 | Bacteria | 2254 |
| 158 | Ga0207698_10014617 | 3300026142 | Bacteria | 5226 |
| 159 | Ga0209996_1045764 | 3300027395 | Bacteria | 657 |
| 160 | Ga0210000_1030350 | 3300027462 | Bacteria | 844 |
| 161 | Ga0209999_1005460 | 3300027543 | Bacteria | 2285 |
| 162 | Ga0207428_10000969 | 3300027907 | Bacteria | 31820 |
| 163 | Ga0207428_10371893 | 3300027907 | Bacteria | 1049 |
| 164 | Ga0268265_10000892 | 3300028380 | Bacteria | 27806 |
| 165 | Ga0268264_10000992 | 3300028381 | Bacteria | 28913 |
| 166 | Ga0268264_10330806 | 3300028381 | Bacteria | 1444 |
| 167 | Ga0316575_10005668 | 3300031665 | Bacteria | 4457 |
| 168 | Ga0316579_10003689 | 3300031691 | Bacteria | 6027 |
| 169 | Ga0265314_10226437 | 3300031711 | Bacteria | 1087 |
| 170 | Ga0307410_10378948 | 3300031852 | Bacteria | 1138 |
| 171 | Ga0307407_10285624 | 3300031903 | Bacteria | 1145 |
| 172 | Ga0307416_101005718 | 3300032002 | Bacteria | 937 |
| 173 | Ga0307411_10141747 | 3300032005 | Bacteria | 1773 |
| 174 | Ga0316583_10015355 | 3300032133 | Bacteria | 2755 |
| 175 | Ga0316585_10054251 | 3300032137 | Bacteria | 1289 |
| 176 | Ga0316580_10034912 | 3300032139 | Bacteria | 1556 |
| 177 | Ga0373930_0028655 | 3300034816 | Bacteria | 1134 |
| 178 | Ga0373958_0003167 | 3300034819 | Bacteria | 2359 |
| 179 | Ga0373938_0056571 | 3300034957 | Bacteria | 908 |
| 180 | Ga0373928_0006824 | 3300035084 | Bacteria | 2200 |
| 181 | Ga0373928_0125133 | 3300035084 | Bacteria | 692 |
| 182 | Ga0373940_0008964 | 3300035088 | Bacteria | 2312 |
| 183 | Ga0373940_0081577 | 3300035088 | Unclassified | 957 |
| 184 | Ga0373944_0010486 | 3300035089 | Bacteria | 2528 |
| 185 | Ga0373949_0008766 | 3300035090 | Bacteria | 2213 |
| 186 | Ga0373951_0041714 | 3300035091 | Bacteria | 1108 |
| 187 | Ga0373951_0042660 | 3300035091 | Bacteria | 1098 |
| 188 | Ga0373951_0096208 | 3300035091 | Unclassified | 782 |
| 189 | Ga0373923_0036776 | 3300035111 | Bacteria | 2000 |
| 190 | Ga0373932_0003257 | 3300035112 | Bacteria | 3929 |
| 191 | Ga0373932_0083351 | 3300035112 | Bacteria | 1014 |
| 192 | Ga0373936_0005548 | 3300035113 | Bacteria | 4761 |
| 193 | Ga0373939_0008527 | 3300035114 | Bacteria | 2515 |
| 194 | Ga0373945_0030256 | 3300035116 | Bacteria | 1907 |
| 195 | Ga0373943_0180923 | 3300035170 | Bacteria | 1158 |
| 196 | Ga0373942_0005348 | 3300035207 | Bacteria | 2979 |
| 197 | Ga0373942_0006811 | 3300035207 | Bacteria | 2640 |
| 198 | Ga0373942_0235151 | 3300035207 | Unclassified | 618 |
| 199 | Ga0373961_0009745 | 3300035241 | Bacteria | 2355 |
| 200 | Ga0373961_0051766 | 3300035241 | Bacteria | 1220 |
| 201 | Ga0373961_0316176 | 3300035241 | Unclassified | 581 |
| 202 | Ga0373962_0007815 | 3300035242 | Bacteria | 2624 |
| 203 | Ga0316574_0043845 | 3300035398 | Bacteria | 2765 |
| 204 | Ga0373931_0000389 | 3300035691 | Bacteria | 18034 |
| 205 | Ga0373931_0016584 | 3300035691 | Bacteria | 3628 |
| 206 | Ga0373931_0065083 | 3300035691 | Bacteria | 1975 |
| 207 | Ga0373931_0555595 | 3300035691 | Bacteria | 746 |
| 208 | Ga0373931_1139713 | 3300035691 | Bacteria | 532 |
| 209 | Ga0373935_0003177 | 3300035692 | Bacteria | 9472 |
| 210 | Ga0373935_0927621 | 3300035692 | Bacteria | 645 |
| 211 | Ga0373927_0017982 | 3300035695 | Bacteria | 4649 |
| 212 | Ga0373933_0458444 | 3300035724 | Unclassified | 834 |
| 213 | Ga0373947_0017453 | 3300035725 | Bacteria | 4127 |
| 214 | Ga0373947_0339458 | 3300035725 | Bacteria | 1006 |
| 215 | Ga0373937_0137349 | 3300036401 | Bacteria | 2286 |
| 216 | Ga0316582_0001361 | 3300036647 | Bacteria | 10622 |
| 217 | Ga0316582_0048633 | 3300036647 | Bacteria | 2682 |
| 218 | Ga0316582_0068925 | 3300036647 | Bacteria | 2285 |
| 219 | Ga0316584_0090361 | 3300036712 | Bacteria | 2292 |
| 220 | Ga0373925_0079949 | 3300037068 | Bacteria | 2484 |
| 221 | Ga0316581_0129338 | 3300037588 | Bacteria | 778 |
| 222 | Ga0316581_0135185 | 3300037588 | Bacteria | 760 |
| 223 | Ga0453684_1205680 | 3300044712 | Bacteria | 794 |
| 224 | Ga0451576_0017095 | 3300045051 | Bacteria | 7981 |
| 225 | Ga0451576_0074722 | 3300045051 | Bacteria | 3526 |
| 226 | Ga0451576_0112958 | 3300045051 | Bacteria | 2827 |
| 227 | Ga0451576_0410025 | 3300045051 | Bacteria | 1421 |
| 228 | Ga0451576_0731739 | 3300045051 | Bacteria | 1039 |
| 229 | Ga0451576_0879548 | 3300045051 | Bacteria | 940 |
| 230 | Ga0451576_1580686 | 3300045051 | Bacteria | 680 |
| 231 | Ga0495603_0021116 | 3300046455 | Bacteria | 3942 |
| 232 | Ga0495580_0012899 | 3300046472 | Bacteria | 6402 |
| 233 | Ga0495582_0065950 | 3300046473 | Bacteria | 2000 |
| 234 | Ga0495630_0064810 | 3300046517 | Bacteria | 2746 |
| 235 | Ga0495663_0204807 | 3300046525 | Bacteria | 689 |
| 236 | Ga0495642_0131114 | 3300046528 | Bacteria | 1079 |
| 237 | Ga0495586_0001150 | 3300046535 | Bacteria | 14818 |
| 238 | Ga0495621_0159597 | 3300046539 | Unclassified | 891 |
| 239 | Ga0495659_0027182 | 3300046664 | Bacteria | 1972 |
| 240 | Ga0495659_0074757 | 3300046664 | Bacteria | 1275 |
| 241 | Ga0495588_0002790 | 3300046674 | Bacteria | 7508 |
| 242 | Ga0495647_0001149 | 3300046681 | Bacteria | 8126 |
| 243 | Ga0495658_0001379 | 3300046683 | Bacteria | 12746 |
| 244 | Ga0495669_0003970 | 3300046684 | Bacteria | 6087 |
| 245 | Ga0495581_0042708 | 3300047315 | Bacteria | 2623 |
| 246 | Ga0495636_0081142 | 3300047318 | Bacteria | 1397 |
| 247 | Ga0495676_0026882 | 3300047321 | Bacteria | 4944 |
| 248 | Ga0495614_0198106 | 3300048089 | Bacteria | 908 |
| 249 | Ga0496114_0845220 | 3300048917 | Bacteria | 795 |
| 250 | Ga0501298_098240 | 3300049521 | Bacteria | 665 |
| 251 | Ga0501031_0346550 | 3300049568 | Bacteria | 962 |
| 252 | Ga0501036_0222619 | 3300049572 | Bacteria | 1584 |
| 253 | Ga0501036_0375226 | 3300049572 | Bacteria | 1187 |
| 254 | Ga0501037_0044146 | 3300049573 | Bacteria | 3275 |
| 255 | Ga0501037_0499680 | 3300049573 | Bacteria | 825 |
| 256 | Ga0501039_0022488 | 3300049575 | Bacteria | 4840 |
| 257 | Ga0501039_0421857 | 3300049575 | Bacteria | 1048 |
| 258 | Ga0501040_0032192 | 3300049576 | Bacteria | 3548 |
| 259 | Ga0501040_0041969 | 3300049576 | Bacteria | 3116 |
| 260 | Ga0501040_0477321 | 3300049576 | Bacteria | 898 |
| 261 | Ga0501040_0732447 | 3300049576 | Bacteria | 715 |
| 262 | Ga0501041_0015543 | 3300049577 | Bacteria | 4521 |
| 263 | Ga0501041_0059957 | 3300049577 | Bacteria | 2329 |
| 264 | Ga0501041_0181860 | 3300049577 | Bacteria | 1316 |
| 265 | Ga0501041_0192144 | 3300049577 | Bacteria | 1279 |
| 266 | Ga0501041_0320867 | 3300049577 | Bacteria | 977 |
| 267 | Ga0501042_1015221 | 3300049578 | Bacteria | 605 |
| 268 | Ga0501046_0155050 | 3300049580 | Bacteria | 1726 |
| 269 | Ga0501048_0191953 | 3300049582 | Bacteria | 1447 |
| 270 | Ga0501048_0311680 | 3300049582 | Bacteria | 1120 |
| 271 | Ga0501070_1369444 | 3300049586 | Bacteria | 538 |
| 272 | Ga0501071_0095026 | 3300049587 | Bacteria | 2193 |
| 273 | Ga0501071_0615769 | 3300049587 | Bacteria | 835 |
| 274 | Ga0501072_0061556 | 3300049588 | Bacteria | 2961 |
| 275 | Ga0501072_0069094 | 3300049588 | Bacteria | 2789 |
| 276 | Ga0501072_0739479 | 3300049588 | Bacteria | 772 |
| 277 | Ga0501072_0804031 | 3300049588 | Bacteria | 736 |
| 278 | Ga0501073_0093496 | 3300049589 | Bacteria | 2089 |
| 279 | Ga0501075_0328529 | 3300049591 | Bacteria | 1165 |
| 280 | Ga0501076_0247862 | 3300049592 | Bacteria | 1457 |
| 281 | Ga0501225_0262047 | 3300049705 | Bacteria | 572 |
| 282 | Ga0501079_0324050 | 3300049741 | Bacteria | 1206 |
| 283 | Ga0501081_0159857 | 3300049743 | Bacteria | 1623 |
| 284 | Ga0501045_0032014 | 3300049824 | Bacteria | 3809 |
| 285 | Ga0501045_0166279 | 3300049824 | Bacteria | 1643 |
| 286 | Ga0501045_0293127 | 3300049824 | Bacteria | 1211 |
| 287 | nmdc:mga0k408_135971_c1 | 3300050493 | Bacteria | 1460 |
| 288 | nmdc:mga05p37_2142_c1 | 3300050507 | Bacteria | 23057 |
| 289 | nmdc:mga05p37_354208_c1 | 3300050507 | Bacteria | 1727 |
| 290 | nmdc:mga09592_1613_c1 | 3300050508 | Bacteria | 18164 |
| 291 | nmdc:mga09592_454839_c1 | 3300050508 | Bacteria | 1104 |
| 292 | nmdc:mga0qj67_154430_c1 | 3300050509 | Bacteria | 1862 |
| 293 | nmdc:mga0qj67_29051_c1 | 3300050509 | Bacteria | 4293 |
| 294 | nmdc:mga06r32_223521_c1 | 3300050510 | Bacteria | 1871 |
| 295 | nmdc:mga08y16_1151_c1 | 3300050511 | Bacteria | 26051 |
| 296 | nmdc:mga08y16_448611_c1 | 3300050511 | Bacteria | 1316 |
| 297 | nmdc:mga0n895_2444_c1 | 3300050512 | Bacteria | 14514 |
| 298 | nmdc:mga0n895_42591_c1 | 3300050512 | Bacteria | 4418 |
| 299 | nmdc:mga0n895_739194_c1 | 3300050512 | Bacteria | 978 |
| 300 | nmdc:mga0n895_915_c1 | 3300050512 | Bacteria | 21233 |
| 301 | nmdc:mga0rr50_33471_c1 | 3300050513 | Bacteria | 3672 |
| 302 | nmdc:mga0rr50_701_c1 | 3300050513 | Bacteria | 17960 |
| 303 | nmdc:mga0rr50_75876_c1 | 3300050513 | Bacteria | 2579 |
| 304 | nmdc:mga08x19_1038_c1 | 3300050514 | Bacteria | 17363 |
| 305 | nmdc:mga08x19_48027_c1 | 3300050514 | Bacteria | 2733 |
| 306 | nmdc:mga08x19_481451_c1 | 3300050514 | Bacteria | 875 |
| 307 | nmdc:mga0a205_187_c1 | 3300050515 | Bacteria | 42758 |
| 308 | nmdc:mga0a205_20775_c1 | 3300050515 | Bacteria | 6202 |
| 309 | nmdc:mga0a205_239373_c1 | 3300050515 | Bacteria | 1696 |
| 310 | Ga0501084_0177349 | 3300054114 | Bacteria | 1799 |
| 311 | Ga0501082_0249920 | 3300060353 | Bacteria | 1543 |
| 312 | Ga0501082_0416414 | 3300060353 | Bacteria | 1173 |
| 313 | Ga0501082_0563925 | 3300060353 | Bacteria | 996 |
| 314 | Ga0501082_0575894 | 3300060353 | Bacteria | 985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0732447 | Ga0501040_0732447_335_691 | 118 |
| 2 | 3300027395 | Ga0209996_1045764 | Ga0209996_10457642 | 124 |
| 3 | 3300027462 | Ga0210000_1030350 | Ga0210000_10303502 | 124 |
| 4 | 3300027543 | Ga0209999_1005460 | Ga0209999_10054603 | 124 |
| 5 | 3300049578 | Ga0501042_1015221 | Ga0501042_1015221_166_540 | 124 |
| 6 | 3300049587 | Ga0501071_0615769 | Ga0501071_0615769_162_536 | 124 |
| 7 | 3300049588 | Ga0501072_0804031 | Ga0501072_0804031_223_597 | 124 |
| 8 | 3300035692 | Ga0373935_0927621 | Ga0373935_0927621_11_394 | 127 |
| 9 | 3300035725 | Ga0373947_0017453 | Ga0373947_0017453_3733_4116 | 127 |
| 10 | 3300035725 | Ga0373947_0339458 | Ga0373947_0339458_12_395 | 127 |
| 11 | 3300049568 | Ga0501031_0346550 | Ga0501031_0346550_360_755 | 131 |
| 12 | 3300049572 | Ga0501036_0375226 | Ga0501036_0375226_278_673 | 131 |
| 13 | 3300049575 | Ga0501039_0421857 | Ga0501039_0421857_80_475 | 131 |
| 14 | 3300049577 | Ga0501041_0059957 | Ga0501041_0059957_1604_1999 | 131 |
| 15 | 3300049577 | Ga0501041_0192144 | Ga0501041_0192144_207_602 | 131 |
| 16 | 3300049582 | Ga0501048_0191953 | Ga0501048_0191953_352_747 | 131 |
| 17 | 3300049587 | Ga0501071_0095026 | Ga0501071_0095026_1095_1490 | 131 |
| 18 | 3300049591 | Ga0501075_0328529 | Ga0501075_0328529_25_420 | 131 |
| 19 | 3300049592 | Ga0501076_0247862 | Ga0501076_0247862_54_449 | 131 |
| 20 | 3300049741 | Ga0501079_0324050 | Ga0501079_0324050_430_825 | 131 |
| 21 | 3300049743 | Ga0501081_0159857 | Ga0501081_0159857_393_788 | 131 |
| 22 | 3300049824 | Ga0501045_0032014 | Ga0501045_0032014_1373_1768 | 131 |
| 23 | 3300049824 | Ga0501045_0293127 | Ga0501045_0293127_255_650 | 131 |
| 24 | 3300060353 | Ga0501082_0249920 | Ga0501082_0249920_572_967 | 131 |
| 25 | 3300046528 | Ga0495642_0131114 | Ga0495642_0131114_545_946 | 133 |
| 26 | 3300046539 | Ga0495621_0159597 | Ga0495621_0159597_240_641 | 133 |
| 27 | 3300046664 | Ga0495659_0074757 | Ga0495659_0074757_531_932 | 133 |
| 28 | 3300032137 | Ga0316585_10054251 | Ga0316585_100542512 | 134 |
| 29 | 3300032139 | Ga0316580_10034912 | Ga0316580_100349121 | 134 |
| 30 | 3300035398 | Ga0316574_0043845 | Ga0316574_0043845_1766_2182 | 134 |
| 31 | 3300036647 | Ga0316582_0048633 | Ga0316582_0048633_61_477 | 134 |
| 32 | 3300036712 | Ga0316584_0090361 | Ga0316584_0090361_1412_1828 | 134 |
| 33 | 3300005343 | Ga0070687_100638797 | Ga0070687_1006387972 | 135 |
| 34 | 3300005444 | Ga0070694_100049649 | Ga0070694_1000496494 | 135 |
| 35 | 3300005445 | Ga0070708_100909109 | Ga0070708_1009091092 | 135 |
| 36 | 3300005530 | Ga0070679_101408879 | Ga0070679_1014088792 | 135 |
| 37 | 3300005544 | Ga0070686_101037409 | Ga0070686_1010374091 | 135 |
| 38 | 3300005545 | Ga0070695_100527420 | Ga0070695_1005274201 | 135 |
| 39 | 3300005546 | Ga0070696_100373828 | Ga0070696_1003738282 | 135 |
| 40 | 3300005842 | Ga0068858_100724421 | Ga0068858_1007244212 | 135 |
| 41 | 3300006173 | Ga0070716_100472058 | Ga0070716_1004720582 | 135 |
| 42 | 3300006852 | Ga0075433_10067828 | Ga0075433_100678284 | 135 |
| 43 | 3300006852 | Ga0075433_10218778 | Ga0075433_102187783 | 135 |
| 44 | 3300006871 | Ga0075434_100000551 | Ga0075434_10000055117 | 135 |
| 45 | 3300006871 | Ga0075434_101414353 | Ga0075434_1014143532 | 135 |
| 46 | 3300006914 | Ga0075436_100100768 | Ga0075436_1001007682 | 135 |
| 47 | 3300007076 | Ga0075435_100009872 | Ga0075435_1000098723 | 135 |
| 48 | 3300007076 | Ga0075435_100048450 | Ga0075435_1000484503 | 135 |
| 49 | 3300009147 | Ga0114129_11098983 | Ga0114129_110989832 | 135 |
| 50 | 3300009553 | Ga0105249_12196920 | Ga0105249_121969201 | 135 |
| 51 | 3300025939 | Ga0207665_10605596 | Ga0207665_106055962 | 135 |
| 52 | 3300026035 | Ga0207703_10594764 | Ga0207703_105947642 | 135 |
| 53 | 3300035112 | Ga0373932_0083351 | Ga0373932_0083351_166_573 | 135 |
| 54 | 3300035241 | Ga0373961_0051766 | Ga0373961_0051766_716_1126 | 135 |
| 55 | 3300035691 | Ga0373931_0555595 | Ga0373931_0555595_205_615 | 135 |
| 56 | 3300035691 | Ga0373931_1139713 | Ga0373931_1139713_48_455 | 135 |
| 57 | 3300046525 | Ga0495663_0204807 | Ga0495663_0204807_78_485 | 135 |
| 58 | 3300046664 | Ga0495659_0027182 | Ga0495659_0027182_1211_1618 | 135 |
| 59 | 3300046684 | Ga0495669_0003970 | Ga0495669_0003970_4284_4691 | 135 |
| 60 | 3300047318 | Ga0495636_0081142 | Ga0495636_0081142_746_1153 | 135 |
| 61 | 3300049521 | Ga0501298_098240 | Ga0501298_098240_224_631 | 135 |
| 62 | 3300049586 | Ga0501070_1369444 | Ga0501070_1369444_74_481 | 135 |
| 63 | 3300049705 | Ga0501225_0262047 | Ga0501225_0262047_35_442 | 135 |
| 64 | 3300050507 | nmdc:mga05p37_354208_c1 | nmdc:mga05p37_354208_c1_180_587 | 135 |
| 65 | 3300050512 | nmdc:mga0n895_42591_c1 | nmdc:mga0n895_42591_c1_3206_3613 | 135 |
| 66 | 3300050512 | nmdc:mga0n895_739194_c1 | nmdc:mga0n895_739194_c1_498_905 | 135 |
| 67 | 3300050512 | nmdc:mga0n895_915_c1 | nmdc:mga0n895_915_c1_18953_19360 | 135 |
| 68 | 3300050513 | nmdc:mga0rr50_33471_c1 | nmdc:mga0rr50_33471_c1_2257_2664 | 135 |
| 69 | 3300050513 | nmdc:mga0rr50_75876_c1 | nmdc:mga0rr50_75876_c1_962_1369 | 135 |
| 70 | 3300050514 | nmdc:mga08x19_48027_c1 | nmdc:mga08x19_48027_c1_2204_2611 | 135 |
| 71 | 3300050514 | nmdc:mga08x19_481451_c1 | nmdc:mga08x19_481451_c1_56_463 | 135 |
| 72 | 3300050515 | nmdc:mga0a205_20775_c1 | nmdc:mga0a205_20775_c1_1422_1829 | 135 |
| 73 | 3300050515 | nmdc:mga0a205_239373_c1 | nmdc:mga0a205_239373_c1_265_672 | 135 |
| 74 | 3300005468 | Ga0070707_100774570 | Ga0070707_1007745701 | 136 |
| 75 | 3300005518 | Ga0070699_100109879 | Ga0070699_1001098793 | 136 |
| 76 | 3300005841 | Ga0068863_100721193 | Ga0068863_1007211933 | 136 |
| 77 | 3300026088 | Ga0207641_10945955 | Ga0207641_109459552 | 136 |
| 78 | 3300035724 | Ga0373933_0458444 | Ga0373933_0458444_313_726 | 136 |
| 79 | 3300036401 | Ga0373937_0137349 | Ga0373937_0137349_991_1404 | 136 |
| 80 | 3300005546 | Ga0070696_100468800 | Ga0070696_1004688003 | 137 |
| 81 | 3300006846 | Ga0075430_100111332 | Ga0075430_1001113322 | 137 |
| 82 | 3300007265 | Ga0099794_10233283 | Ga0099794_102332831 | 137 |
| 83 | 3300031852 | Ga0307410_10378948 | Ga0307410_103789482 | 137 |
| 84 | 3300031903 | Ga0307407_10285624 | Ga0307407_102856242 | 137 |
| 85 | 3300032005 | Ga0307411_10141747 | Ga0307411_101417472 | 137 |
| 86 | 3300049572 | Ga0501036_0222619 | Ga0501036_0222619_248_661 | 137 |
| 87 | 3300049573 | Ga0501037_0044146 | Ga0501037_0044146_174_590 | 137 |
| 88 | 3300049573 | Ga0501037_0499680 | Ga0501037_0499680_32_445 | 137 |
| 89 | 3300049575 | Ga0501039_0022488 | Ga0501039_0022488_1191_1604 | 137 |
| 90 | 3300049576 | Ga0501040_0032192 | Ga0501040_0032192_459_872 | 137 |
| 91 | 3300049576 | Ga0501040_0041969 | Ga0501040_0041969_658_1071 | 137 |
| 92 | 3300049577 | Ga0501041_0015543 | Ga0501041_0015543_2554_2967 | 137 |
| 93 | 3300049577 | Ga0501041_0181860 | Ga0501041_0181860_837_1253 | 137 |
| 94 | 3300049580 | Ga0501046_0155050 | Ga0501046_0155050_399_812 | 137 |
| 95 | 3300049582 | Ga0501048_0311680 | Ga0501048_0311680_276_689 | 137 |
| 96 | 3300049588 | Ga0501072_0061556 | Ga0501072_0061556_981_1394 | 137 |
| 97 | 3300049588 | Ga0501072_0739479 | Ga0501072_0739479_152_568 | 137 |
| 98 | 3300049824 | Ga0501045_0166279 | Ga0501045_0166279_55_471 | 137 |
| 99 | 3300050508 | nmdc:mga09592_454839_c1 | nmdc:mga09592_454839_c1_17_430 | 137 |
| 100 | 3300050509 | nmdc:mga0qj67_29051_c1 | nmdc:mga0qj67_29051_c1_602_1015 | 137 |
| 101 | 3300060353 | Ga0501082_0563925 | Ga0501082_0563925_31_447 | 137 |
| 102 | 3300060353 | Ga0501082_0575894 | Ga0501082_0575894_109_522 | 137 |
| 103 | 3300005345 | Ga0070692_10331901 | Ga0070692_103319013 | 140 |
| 104 | 3300005440 | Ga0070705_100437448 | Ga0070705_1004374481 | 140 |
| 105 | 3300005459 | Ga0068867_102202628 | Ga0068867_1022026281 | 140 |
| 106 | 3300026089 | Ga0207648_12227312 | Ga0207648_122273121 | 140 |
| 107 | 3300031711 | Ga0265314_10226437 | Ga0265314_102264373 | 140 |
| 108 | 3300032002 | Ga0307416_101005718 | Ga0307416_1010057181 | 140 |
| 109 | 3300049589 | Ga0501073_0093496 | Ga0501073_0093496_727_1152 | 140 |
| 110 | 3300050493 | nmdc:mga0k408_135971_c1 | nmdc:mga0k408_135971_c1_122_547 | 140 |
| 111 | 3300005295 | Ga0065707_10004631 | Ga0065707_100046315 | 142 |
| 112 | 3300005295 | Ga0065707_10345827 | Ga0065707_103458272 | 142 |
| 113 | 3300005330 | Ga0070690_100001653 | Ga0070690_1000016534 | 142 |
| 114 | 3300005334 | Ga0068869_100000423 | Ga0068869_1000004234 | 142 |
| 115 | 3300005336 | Ga0070680_100001243 | Ga0070680_1000012438 | 142 |
| 116 | 3300005336 | Ga0070680_100641823 | Ga0070680_1006418232 | 142 |
| 117 | 3300005337 | Ga0070682_100009146 | Ga0070682_1000091464 | 142 |
| 118 | 3300005338 | Ga0068868_100000271 | Ga0068868_10000027124 | 142 |
| 119 | 3300005340 | Ga0070689_100006573 | Ga0070689_1000065737 | 142 |
| 120 | 3300005340 | Ga0070689_100101015 | Ga0070689_1001010153 | 142 |
| 121 | 3300005341 | Ga0070691_10001218 | Ga0070691_100012186 | 142 |
| 122 | 3300005343 | Ga0070687_100000109 | Ga0070687_10000010920 | 142 |
| 123 | 3300005353 | Ga0070669_100824100 | Ga0070669_1008241001 | 142 |
| 124 | 3300005356 | Ga0070674_100540179 | Ga0070674_1005401792 | 142 |
| 125 | 3300005364 | Ga0070673_100062065 | Ga0070673_1000620653 | 142 |
| 126 | 3300005364 | Ga0070673_100389988 | Ga0070673_1003899882 | 142 |
| 127 | 3300005406 | Ga0070703_10018974 | Ga0070703_100189743 | 142 |
| 128 | 3300005438 | Ga0070701_10000272 | Ga0070701_1000027217 | 142 |
| 129 | 3300005438 | Ga0070701_10561217 | Ga0070701_105612171 | 142 |
| 130 | 3300005440 | Ga0070705_100000460 | Ga0070705_10000046017 | 142 |
| 131 | 3300005440 | Ga0070705_100038112 | Ga0070705_1000381123 | 142 |
| 132 | 3300005441 | Ga0070700_100038989 | Ga0070700_1000389893 | 142 |
| 133 | 3300005444 | Ga0070694_100006519 | Ga0070694_1000065198 | 142 |
| 134 | 3300005445 | Ga0070708_100483340 | Ga0070708_1004833402 | 142 |
| 135 | 3300005456 | Ga0070678_100744200 | Ga0070678_1007442001 | 142 |
| 136 | 3300005458 | Ga0070681_10095600 | Ga0070681_100956003 | 142 |
| 137 | 3300005459 | Ga0068867_100000169 | Ga0068867_10000016927 | 142 |
| 138 | 3300005530 | Ga0070679_100032403 | Ga0070679_1000324035 | 142 |
| 139 | 3300005535 | Ga0070684_100694875 | Ga0070684_1006948752 | 142 |
| 140 | 3300005539 | Ga0068853_100151068 | Ga0068853_1001510683 | 142 |
| 141 | 3300005544 | Ga0070686_100001592 | Ga0070686_10000159210 | 142 |
| 142 | 3300005545 | Ga0070695_100000521 | Ga0070695_10000052120 | 142 |
| 143 | 3300005546 | Ga0070696_100000143 | Ga0070696_10000014316 | 142 |
| 144 | 3300005546 | Ga0070696_100070688 | Ga0070696_1000706882 | 142 |
| 145 | 3300005547 | Ga0070693_100000043 | Ga0070693_10000004331 | 142 |
| 146 | 3300005547 | Ga0070693_100272772 | Ga0070693_1002727722 | 142 |
| 147 | 3300005549 | Ga0070704_100000027 | Ga0070704_10000002731 | 142 |
| 148 | 3300005563 | Ga0068855_100010922 | Ga0068855_1000109226 | 142 |
| 149 | 3300005563 | Ga0068855_100339814 | Ga0068855_1003398142 | 142 |
| 150 | 3300005578 | Ga0068854_100021606 | Ga0068854_1000216063 | 142 |
| 151 | 3300005614 | Ga0068856_100004523 | Ga0068856_10000452315 | 142 |
| 152 | 3300005614 | Ga0068856_100570021 | Ga0068856_1005700213 | 142 |
| 153 | 3300005615 | Ga0070702_100000162 | Ga0070702_10000016210 | 142 |
| 154 | 3300005616 | Ga0068852_100041914 | Ga0068852_1000419144 | 142 |
| 155 | 3300005617 | Ga0068859_100002085 | Ga0068859_10000208510 | 142 |
| 156 | 3300005618 | Ga0068864_100050006 | Ga0068864_1000500063 | 142 |
| 157 | 3300005718 | Ga0068866_10001447 | Ga0068866_100014475 | 142 |
| 158 | 3300005719 | Ga0068861_100000189 | Ga0068861_1000001894 | 142 |
| 159 | 3300005840 | Ga0068870_10025211 | Ga0068870_100252114 | 142 |
| 160 | 3300005841 | Ga0068863_100568309 | Ga0068863_1005683092 | 142 |
| 161 | 3300005842 | Ga0068858_100000286 | Ga0068858_10000028642 | 142 |
| 162 | 3300005842 | Ga0068858_100037522 | Ga0068858_1000375223 | 142 |
| 163 | 3300005843 | Ga0068860_100000770 | Ga0068860_10000077032 | 142 |
| 164 | 3300005843 | Ga0068860_100143920 | Ga0068860_1001439202 | 142 |
| 165 | 3300005844 | Ga0068862_100000639 | Ga0068862_1000006396 | 142 |
| 166 | 3300006237 | Ga0097621_100000447 | Ga0097621_10000044716 | 142 |
| 167 | 3300006358 | Ga0068871_100000853 | Ga0068871_10000085317 | 142 |
| 168 | 3300006844 | Ga0075428_100006275 | Ga0075428_1000062754 | 142 |
| 169 | 3300006846 | Ga0075430_100157268 | Ga0075430_1001572683 | 142 |
| 170 | 3300006852 | Ga0075433_10001192 | Ga0075433_1000119219 | 142 |
| 171 | 3300006852 | Ga0075433_10790534 | Ga0075433_107905342 | 142 |
| 172 | 3300006871 | Ga0075434_100000302 | Ga0075434_10000030224 | 142 |
| 173 | 3300006880 | Ga0075429_100001646 | Ga0075429_10000164619 | 142 |
| 174 | 3300006881 | Ga0068865_100000043 | Ga0068865_10000004317 | 142 |
| 175 | 3300006914 | Ga0075436_100000386 | Ga0075436_1000003867 | 142 |
| 176 | 3300006931 | Ga0097620_100002085 | Ga0097620_10000208510 | 142 |
| 177 | 3300007076 | Ga0075435_100003547 | Ga0075435_10000354710 | 142 |
| 178 | 3300009093 | Ga0105240_10653666 | Ga0105240_106536661 | 142 |
| 179 | 3300009094 | Ga0111539_10020815 | Ga0111539_1002081510 | 142 |
| 180 | 3300009094 | Ga0111539_10025680 | Ga0111539_100256804 | 142 |
| 181 | 3300009094 | Ga0111539_11114086 | Ga0111539_111140862 | 142 |
| 182 | 3300009098 | Ga0105245_10000271 | Ga0105245_1000027117 | 142 |
| 183 | 3300009101 | Ga0105247_10310240 | Ga0105247_103102402 | 142 |
| 184 | 3300009147 | Ga0114129_10001887 | Ga0114129_1000188719 | 142 |
| 185 | 3300009148 | Ga0105243_10001232 | Ga0105243_1000123223 | 142 |
| 186 | 3300009174 | Ga0105241_10066672 | Ga0105241_100666723 | 142 |
| 187 | 3300009176 | Ga0105242_10001304 | Ga0105242_1000130412 | 142 |
| 188 | 3300009177 | Ga0105248_10130355 | Ga0105248_101303553 | 142 |
| 189 | 3300009553 | Ga0105249_10000756 | Ga0105249_100007567 | 142 |
| 190 | 3300010375 | Ga0105239_10033403 | Ga0105239_100334035 | 142 |
| 191 | 3300010375 | Ga0105239_11552355 | Ga0105239_115523552 | 142 |
| 192 | 3300012506 | Ga0157324_1021364 | Ga0157324_10213642 | 142 |
| 193 | 3300013296 | Ga0157374_10792447 | Ga0157374_107924471 | 142 |
| 194 | 3300013297 | Ga0157378_10000140 | Ga0157378_1000014016 | 142 |
| 195 | 3300013307 | Ga0157372_10567088 | Ga0157372_105670882 | 142 |
| 196 | 3300013308 | Ga0157375_10230745 | Ga0157375_102307453 | 142 |
| 197 | 3300014326 | Ga0157380_10109518 | Ga0157380_101095182 | 142 |
| 198 | 3300014745 | Ga0157377_10177156 | Ga0157377_101771563 | 142 |
| 199 | 3300014745 | Ga0157377_10521531 | Ga0157377_105215312 | 142 |
| 200 | 3300014969 | Ga0157376_10001071 | Ga0157376_100010716 | 142 |
| 201 | 3300025899 | Ga0207642_10001374 | Ga0207642_100013747 | 142 |
| 202 | 3300025906 | Ga0207699_10449013 | Ga0207699_104490132 | 142 |
| 203 | 3300025908 | Ga0207643_10223122 | Ga0207643_102231223 | 142 |
| 204 | 3300025911 | Ga0207654_10014921 | Ga0207654_100149215 | 142 |
| 205 | 3300025912 | Ga0207707_10105200 | Ga0207707_101052005 | 142 |
| 206 | 3300025917 | Ga0207660_10004531 | Ga0207660_100045315 | 142 |
| 207 | 3300025917 | Ga0207660_10472207 | Ga0207660_104722071 | 142 |
| 208 | 3300025918 | Ga0207662_10000024 | Ga0207662_1000002416 | 142 |
| 209 | 3300025921 | Ga0207652_10102328 | Ga0207652_101023283 | 142 |
| 210 | 3300025923 | Ga0207681_10621265 | Ga0207681_106212652 | 142 |
| 211 | 3300025927 | Ga0207687_10002713 | Ga0207687_1000271313 | 142 |
| 212 | 3300025931 | Ga0207644_10310923 | Ga0207644_103109233 | 142 |
| 213 | 3300025934 | Ga0207686_10000608 | Ga0207686_100006085 | 142 |
| 214 | 3300025935 | Ga0207709_10007238 | Ga0207709_100072388 | 142 |
| 215 | 3300025936 | Ga0207670_10003374 | Ga0207670_100033743 | 142 |
| 216 | 3300025937 | Ga0207669_10435440 | Ga0207669_104354402 | 142 |
| 217 | 3300025938 | Ga0207704_10000328 | Ga0207704_100003284 | 142 |
| 218 | 3300025941 | Ga0207711_10146056 | Ga0207711_101460563 | 142 |
| 219 | 3300025942 | Ga0207689_10000162 | Ga0207689_100001624 | 142 |
| 220 | 3300025949 | Ga0207667_10152518 | Ga0207667_101525182 | 142 |
| 221 | 3300025949 | Ga0207667_10188988 | Ga0207667_101889883 | 142 |
| 222 | 3300025960 | Ga0207651_10380205 | Ga0207651_103802053 | 142 |
| 223 | 3300025961 | Ga0207712_10000637 | Ga0207712_1000063713 | 142 |
| 224 | 3300025981 | Ga0207640_10017324 | Ga0207640_100173244 | 142 |
| 225 | 3300026023 | Ga0207677_10088700 | Ga0207677_100887003 | 142 |
| 226 | 3300026035 | Ga0207703_10085812 | Ga0207703_100858122 | 142 |
| 227 | 3300026035 | Ga0207703_12055363 | Ga0207703_120553631 | 142 |
| 228 | 3300026041 | Ga0207639_10025169 | Ga0207639_100251695 | 142 |
| 229 | 3300026075 | Ga0207708_10065945 | Ga0207708_100659453 | 142 |
| 230 | 3300026078 | Ga0207702_10459051 | Ga0207702_104590512 | 142 |
| 231 | 3300026088 | Ga0207641_10122460 | Ga0207641_101224602 | 142 |
| 232 | 3300026088 | Ga0207641_10731072 | Ga0207641_107310723 | 142 |
| 233 | 3300026088 | Ga0207641_11301782 | Ga0207641_113017822 | 142 |
| 234 | 3300026089 | Ga0207648_10000147 | Ga0207648_1000014717 | 142 |
| 235 | 3300026118 | Ga0207675_100000104 | Ga0207675_10000010416 | 142 |
| 236 | 3300026121 | Ga0207683_10131190 | Ga0207683_101311903 | 142 |
| 237 | 3300026142 | Ga0207698_10014617 | Ga0207698_100146174 | 142 |
| 238 | 3300027907 | Ga0207428_10000969 | Ga0207428_1000096916 | 142 |
| 239 | 3300027907 | Ga0207428_10371893 | Ga0207428_103718933 | 142 |
| 240 | 3300028380 | Ga0268265_10000892 | Ga0268265_1000089216 | 142 |
| 241 | 3300028381 | Ga0268264_10000992 | Ga0268264_1000099225 | 142 |
| 242 | 3300028381 | Ga0268264_10330806 | Ga0268264_103308063 | 142 |
| 243 | 3300031665 | Ga0316575_10005668 | Ga0316575_100056683 | 142 |
| 244 | 3300031691 | Ga0316579_10003689 | Ga0316579_100036894 | 142 |
| 245 | 3300032133 | Ga0316583_10015355 | Ga0316583_100153553 | 142 |
| 246 | 3300034816 | Ga0373930_0028655 | Ga0373930_0028655_313_741 | 142 |
| 247 | 3300034819 | Ga0373958_0003167 | Ga0373958_0003167_951_1379 | 142 |
| 248 | 3300034957 | Ga0373938_0056571 | Ga0373938_0056571_264_692 | 142 |
| 249 | 3300035084 | Ga0373928_0006824 | Ga0373928_0006824_1543_1971 | 142 |
| 250 | 3300035084 | Ga0373928_0125133 | Ga0373928_0125133_171_599 | 142 |
| 251 | 3300035088 | Ga0373940_0008964 | Ga0373940_0008964_1214_1642 | 142 |
| 252 | 3300035088 | Ga0373940_0081577 | Ga0373940_0081577_221_649 | 142 |
| 253 | 3300035089 | Ga0373944_0010486 | Ga0373944_0010486_1487_1915 | 142 |
| 254 | 3300035090 | Ga0373949_0008766 | Ga0373949_0008766_1430_1858 | 142 |
| 255 | 3300035091 | Ga0373951_0041714 | Ga0373951_0041714_511_939 | 142 |
| 256 | 3300035091 | Ga0373951_0042660 | Ga0373951_0042660_79_507 | 142 |
| 257 | 3300035091 | Ga0373951_0096208 | Ga0373951_0096208_285_713 | 142 |
| 258 | 3300035111 | Ga0373923_0036776 | Ga0373923_0036776_611_1039 | 142 |
| 259 | 3300035112 | Ga0373932_0003257 | Ga0373932_0003257_1995_2423 | 142 |
| 260 | 3300035113 | Ga0373936_0005548 | Ga0373936_0005548_2348_2776 | 142 |
| 261 | 3300035114 | Ga0373939_0008527 | Ga0373939_0008527_1449_1877 | 142 |
| 262 | 3300035116 | Ga0373945_0030256 | Ga0373945_0030256_1049_1477 | 142 |
| 263 | 3300035170 | Ga0373943_0180923 | Ga0373943_0180923_701_1129 | 142 |
| 264 | 3300035207 | Ga0373942_0005348 | Ga0373942_0005348_355_783 | 142 |
| 265 | 3300035207 | Ga0373942_0006811 | Ga0373942_0006811_77_505 | 142 |
| 266 | 3300035207 | Ga0373942_0235151 | Ga0373942_0235151_25_453 | 142 |
| 267 | 3300035241 | Ga0373961_0009745 | Ga0373961_0009745_237_665 | 142 |
| 268 | 3300035241 | Ga0373961_0316176 | Ga0373961_0316176_123_551 | 142 |
| 269 | 3300035242 | Ga0373962_0007815 | Ga0373962_0007815_367_795 | 142 |
| 270 | 3300035691 | Ga0373931_0000389 | Ga0373931_0000389_12884_13312 | 142 |
| 271 | 3300035691 | Ga0373931_0016584 | Ga0373931_0016584_2652_3080 | 142 |
| 272 | 3300035691 | Ga0373931_0065083 | Ga0373931_0065083_678_1106 | 142 |
| 273 | 3300035692 | Ga0373935_0003177 | Ga0373935_0003177_5052_5480 | 142 |
| 274 | 3300035695 | Ga0373927_0017982 | Ga0373927_0017982_1496_1924 | 142 |
| 275 | 3300036647 | Ga0316582_0001361 | Ga0316582_0001361_141_584 | 142 |
| 276 | 3300036647 | Ga0316582_0068925 | Ga0316582_0068925_1676_2119 | 142 |
| 277 | 3300037068 | Ga0373925_0079949 | Ga0373925_0079949_2027_2455 | 142 |
| 278 | 3300037588 | Ga0316581_0129338 | Ga0316581_0129338_160_603 | 142 |
| 279 | 3300037588 | Ga0316581_0135185 | Ga0316581_0135185_161_604 | 142 |
| 280 | 3300044712 | Ga0453684_1205680 | Ga0453684_1205680_215_643 | 142 |
| 281 | 3300045051 | Ga0451576_0017095 | Ga0451576_0017095_2107_2535 | 142 |
| 282 | 3300045051 | Ga0451576_0074722 | Ga0451576_0074722_2409_2837 | 142 |
| 283 | 3300045051 | Ga0451576_0112958 | Ga0451576_0112958_24_452 | 142 |
| 284 | 3300045051 | Ga0451576_0410025 | Ga0451576_0410025_297_725 | 142 |
| 285 | 3300045051 | Ga0451576_0731739 | Ga0451576_0731739_192_620 | 142 |
| 286 | 3300045051 | Ga0451576_0879548 | Ga0451576_0879548_335_763 | 142 |
| 287 | 3300045051 | Ga0451576_1580686 | Ga0451576_1580686_103_531 | 142 |
| 288 | 3300046455 | Ga0495603_0021116 | Ga0495603_0021116_389_817 | 142 |
| 289 | 3300046472 | Ga0495580_0012899 | Ga0495580_0012899_1698_2126 | 142 |
| 290 | 3300046473 | Ga0495582_0065950 | Ga0495582_0065950_15_443 | 142 |
| 291 | 3300046517 | Ga0495630_0064810 | Ga0495630_0064810_187_615 | 142 |
| 292 | 3300046535 | Ga0495586_0001150 | Ga0495586_0001150_8946_9374 | 142 |
| 293 | 3300046674 | Ga0495588_0002790 | Ga0495588_0002790_6301_6729 | 142 |
| 294 | 3300046681 | Ga0495647_0001149 | Ga0495647_0001149_6460_6888 | 142 |
| 295 | 3300046683 | Ga0495658_0001379 | Ga0495658_0001379_3118_3546 | 142 |
| 296 | 3300047315 | Ga0495581_0042708 | Ga0495581_0042708_1507_1935 | 142 |
| 297 | 3300047321 | Ga0495676_0026882 | Ga0495676_0026882_3639_4067 | 142 |
| 298 | 3300048089 | Ga0495614_0198106 | Ga0495614_0198106_177_605 | 142 |
| 299 | 3300048917 | Ga0496114_0845220 | Ga0496114_0845220_173_601 | 142 |
| 300 | 3300049576 | Ga0501040_0477321 | Ga0501040_0477321_22_450 | 142 |
| 301 | 3300049577 | Ga0501041_0320867 | Ga0501041_0320867_79_507 | 142 |
| 302 | 3300049588 | Ga0501072_0069094 | Ga0501072_0069094_1943_2371 | 142 |
| 303 | 3300050507 | nmdc:mga05p37_2142_c1 | nmdc:mga05p37_2142_c1_13502_13930 | 142 |
| 304 | 3300050508 | nmdc:mga09592_1613_c1 | nmdc:mga09592_1613_c1_4264_4692 | 142 |
| 305 | 3300050509 | nmdc:mga0qj67_154430_c1 | nmdc:mga0qj67_154430_c1_1378_1806 | 142 |
| 306 | 3300050510 | nmdc:mga06r32_223521_c1 | nmdc:mga06r32_223521_c1_1056_1484 | 142 |
| 307 | 3300050511 | nmdc:mga08y16_1151_c1 | nmdc:mga08y16_1151_c1_15206_15634 | 142 |
| 308 | 3300050511 | nmdc:mga08y16_448611_c1 | nmdc:mga08y16_448611_c1_314_742 | 142 |
| 309 | 3300050512 | nmdc:mga0n895_2444_c1 | nmdc:mga0n895_2444_c1_11663_12091 | 142 |
| 310 | 3300050513 | nmdc:mga0rr50_701_c1 | nmdc:mga0rr50_701_c1_17486_17914 | 142 |
| 311 | 3300050514 | nmdc:mga08x19_1038_c1 | nmdc:mga08x19_1038_c1_3673_4101 | 142 |
| 312 | 3300050515 | nmdc:mga0a205_187_c1 | nmdc:mga0a205_187_c1_38266_38694 | 142 |
| 313 | 3300054114 | Ga0501084_0177349 | Ga0501084_0177349_857_1285 | 142 |
| 314 | 3300060353 | Ga0501082_0416414 | Ga0501082_0416414_502_930 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b3s-assembly2.cif.gz_E | structural response to mutation at a protein-protein interface | 0.7774 | 35 | 125 |
| 1b2s-assembly3.cif.gz_F | structural response to mutation at a protein-protein interface | 0.7765 | 35 | 126 |
| 1b2s-assembly3.cif.gz_F | structural response to mutation at a protein-protein interface | 0.7616 | 35 | 126 |
| 2za4-assembly4.cif.gz_B | crystal structural analysis of barnase-barstar complex | 0.7613 | 35 | 126 |
| 1b3s-assembly3.cif.gz_F | structural response to mutation at a protein-protein interface | 0.7531 | 35 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1btbA00 | Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like | 0.753 | 35 | 126 | 3.30.370.10 |
| 1btbA00 | Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like | 0.739 | 35 | 126 | 3.30.370.10 |
| 2cx6B00 | Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like | 0.7165 | 35 | 128 | 3.30.370.10 |
| 1bv0E00 | Alpha Beta;2-Layer Sandwich;Barnase; Chain D;Barstar-like | 0.713 | 38 | 125 | 3.30.370.10 |
| af_Q57824_3_139_3.40.50.11700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7069 | 84 | 131 | 3.40.50.11700 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0E4L2-F1-model_v4 | Barstar (barnase inhibitor) domain-containing protein | 0.9711 | 36 | 126 |
|
| AF-A0A521YQJ0-F1-model_v4 | Barnase inhibitor | 0.9683 | 1 | 142 |
|
| AF-A0A521YQJ0-F1-model_v4 | Barnase inhibitor | 0.9616 | 1 | 142 |
|
| AF-A0A0S8B9S5-F1-model_v4 | Barstar (barnase inhibitor) domain-containing protein | 0.9564 | 10 | 137 |
|
| AF-A0A1G3G0U3-F1-model_v4 | Barnase inhibitor | 0.9488 | 34 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar