F402747

General Info

Members Datasets Scaffolds Average Seq Length
314 178 242 255

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100023531|Ga0307408_1000235312
Length 285
Sequence LYLFVFKEKTKKDTASIRARALRILRTLIFTMTQKELKEFLDEKVIQYNNQDFIESDPVQIPHLFSQKEDIEIAGFLSATIAWGNRKMIIKNSHTMMQLMGNTPFDFVMSHSEEDLARLENFVHRTFNGKDFGGFIKGLQHIYKNHNGLEVLFAKNQEKDSLQKSIHEFKKIFFEIDHLPRTQKHISDPLNNSAAKRINMYLRWMVRQDAKGVDLGIWKTISPSALSCPLDVHSGNVARKLGILTRKQNDAKALAELDKKLRQMDAQDPVKYDFALFGLGVFEGF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
13 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
14 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
15 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
16 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
17 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
18 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
19 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
20 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
21 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
22 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
23 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
24 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
25 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
26 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
27 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
28 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
29 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
30 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
31 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
32 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
33 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
34 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
35 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
36 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
37 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
38 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
39 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
40 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
41 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
42 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
43 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
44 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
45 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
46 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
47 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
48 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
49 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
50 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
51 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
52 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
53 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
54 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
55 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
56 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
57 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
58 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
59 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
60 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
61 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
62 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
63 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
64 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
65 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
66 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
67 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
68 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
69 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
70 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
74 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
75 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
108 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
167 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
168 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
175 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
176 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
177 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
178 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.07
Metatranscriptomes 0
Isolates 22.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 2.23
Nodule 2.23
Rhizoplane 0.32
Rhizosphere 75.8
Stem 0
Stem Tuber 0
Unclassified 18.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1392192 2162886007 Bacteria 1508
2 JGI24741J21665_1023573 3300001915 Bacteria 949
3 rootH2_10009524 3300003320 Bacteria 16181
4 rootL2_10110896 3300003322 Bacteria 3777
5 rootL2_10209876 3300003322 Bacteria 2809
6 rootH1_10138189 3300003323 Bacteria 8319
7 Ga0065714_10002979 3300005288 Bacteria 9211
8 Ga0065714_10067305 3300005288 Bacteria 5666
9 Ga0065714_10073154 3300005288 Bacteria 3237
10 Ga0065704_10072094 3300005289 Bacteria 9176
11 Ga0065704_10093972 3300005289 Bacteria 2567
12 Ga0065704_10113999 3300005289 Bacteria 1901
13 Ga0065715_10098401 3300005293 Bacteria 3553
14 Ga0070658_10249124 3300005327 Bacteria 1507
15 Ga0070683_100001620 3300005329 Bacteria 17410
16 Ga0070682_100000290 3300005337 Bacteria 35754
17 Ga0070668_100023749 3300005347 Bacteria 4641
18 Ga0070684_100049595 3300005535 Bacteria 3644
19 Ga0068855_100042959 3300005563 Bacteria 5356
20 Ga0068856_100060683 3300005614 Bacteria 3736
21 Ga0068856_100078685 3300005614 Bacteria 3269
22 Ga0068856_100537522 3300005614 Bacteria 1190
23 Ga0099824_1005721 3300006942 Bacteria 17401
24 Ga0079104_1000271 3300006946 Bacteria 67895
25 Ga0099826_10004388 3300006948 Bacteria 9878
26 Ga0105244_10000226 3300009036 Bacteria 58209
27 Ga0105240_10836097 3300009093 Bacteria 995
28 Ga0105243_10000268 3300009148 Bacteria 58509
29 Ga0105243_10078217 3300009148 Bacteria 2692
30 Ga0157373_10000012 3300013100 Bacteria 188666
31 Ga0157373_10000019 3300013100 Bacteria 166579
32 Ga0157373_10281194 3300013100 Bacteria 1179
33 Ga0157371_10000081 3300013102 Bacteria 151138
34 Ga0157371_10005701 3300013102 Bacteria 10444
35 Ga0157371_10405087 3300013102 Bacteria 998
36 Ga0157370_10000135 3300013104 Bacteria 88550
37 Ga0157370_10000451 3300013104 Bacteria 51369
38 Ga0157370_10004907 3300013104 Bacteria 15158
39 Ga0157370_10008940 3300013104 Bacteria 10761
40 Ga0157370_10026347 3300013104 Bacteria 5741
41 Ga0157370_10036238 3300013104 Bacteria 4788
42 Ga0157370_10046804 3300013104 Bacteria 4147
43 Ga0157370_10050208 3300013104 Bacteria 3988
44 Ga0157370_10058529 3300013104 Bacteria 3662
45 Ga0157370_10072632 3300013104 Bacteria 3246
46 Ga0157369_10009164 3300013105 Bacteria 11322
47 Ga0157369_10053373 3300013105 Bacteria 4370
48 Ga0157369_10097810 3300013105 Bacteria 3130
49 Ga0157369_10222415 3300013105 Unclassified 1976
50 Ga0163162_10119986 3300013306 Bacteria 2733
51 Ga0157372_10012982 3300013307 Bacteria 8886
52 Ga0157372_10199995 3300013307 Unclassified 2314
53 Ga0157375_10000150 3300013308 Bacteria 68209
54 Ga0157375_10120095 3300013308 Bacteria 2736
55 Ga0182008_10000015 3300014497 Bacteria 243121
56 Ga0182006_1000015 3300015261 Bacteria 325938
57 Ga0182006_1001418 3300015261 Bacteria 14493
58 Ga0182006_1087439 3300015261 Bacteria 1126
59 Ga0163161_10000177 3300017792 Bacteria 58594
60 Ga0163161_10001295 3300017792 Bacteria 18666
61 Ga0163161_10013685 3300017792 Bacteria 5649
62 Ga0163161_10027579 3300017792 Bacteria 4030
63 Ga0209675_1000042 3300025291 Bacteria 235989
64 Ga0207655_1000010 3300025728 Bacteria 649325
65 Ga0207655_1000517 3300025728 Bacteria 49084
66 Ga0207657_10207799 3300025919 Bacteria 1572
67 Ga0207709_10001541 3300025935 Bacteria 15827
68 Ga0207709_10071092 3300025935 Bacteria 2208
69 Ga0207661_10001955 3300025944 Bacteria 14167
70 Ga0207667_10144013 3300025949 Bacteria 2453
71 Ga0207667_10436899 3300025949 Bacteria 1331
72 Ga0207702_10062467 3300026078 Bacteria 3181
73 Ga0207702_10081784 3300026078 Bacteria 2806
74 Ga0209281_1000396 3300027111 Bacteria 67930
75 Ga0209489_118617 3300027361 Bacteria 2648
76 Ga0209968_1001575 3300027526 Bacteria 3455
77 Ga0210002_1006852 3300027617 Bacteria 1723
78 Ga0209282_1015972 3300027666 Bacteria 4774
79 Ga0265337_1058254 3300028556 Bacteria 1074
80 Ga0307515_10278800 3300028794 Bacteria 1382
81 Ga0265327_10075893 3300031251 Bacteria 1671
82 Ga0307408_100000121 3300031548 Bacteria 85849
83 Ga0307408_100023531 3300031548 Bacteria 4198
84 Ga0316579_10038583 3300031691 Bacteria 2209
85 Ga0316576_10043302 3300031727 Bacteria 3248
86 Ga0316576_10044038 3300031727 Bacteria 3223
87 Ga0316576_10063123 3300031727 Bacteria 2718
88 Ga0307405_10000001 3300031731 Bacteria 1731270
89 Ga0307405_10020171 3300031731 Bacteria 3720
90 Ga0307405_10590417 3300031731 Bacteria 905
91 Ga0307410_10000055 3300031852 Bacteria 40536
92 Ga0307406_10000009 3300031901 Bacteria 119997
93 Ga0307407_10167666 3300031903 Bacteria 1443
94 Ga0307412_10000134 3300031911 Bacteria 53865
95 Ga0307412_10000692 3300031911 Bacteria 19471
96 Ga0307412_10002630 3300031911 Bacteria 9977
97 Ga0307409_100376140 3300031995 Bacteria 1349
98 Ga0307416_100000004 3300032002 Bacteria 505535
99 Ga0307416_100003636 3300032002 Bacteria 9109
100 Ga0307414_10000001 3300032004 Bacteria 1352954
101 Ga0307414_10000032 3300032004 Bacteria 186421
102 Ga0307414_10003821 3300032004 Bacteria 8096
103 Ga0307414_10017657 3300032004 Bacteria 4372
104 Ga0307414_10027305 3300032004 Bacteria 3687
105 Ga0307414_10231934 3300032004 Bacteria 1522
106 Ga0307411_10000005 3300032005 Bacteria 391311
107 Ga0316585_10033654 3300032137 Bacteria 1617
108 Ga0316574_0263266 3300035398 Bacteria 1101
109 Ga0316582_0059701 3300036647 Bacteria 2443
110 Ga0316584_0142563 3300036712 Bacteria 1786
111 Ga0316584_0221880 3300036712 Bacteria 1388
112 Ga0316584_0236579 3300036712 Bacteria 1338
113 Ga0395905_0057513 3300037471 Bacteria 3638
114 Ga0439447_000239 3300041407 Bacteria 19387
115 Ga0439465_0031379 3300041413 Bacteria 1692
116 Ga0451577_0000043 3300042876 Bacteria 329533
117 Ga0451577_0000048 3300042876 Bacteria 309377
118 Ga0451577_0000097 3300042876 Bacteria 193351
119 Ga0451577_0004966 3300042876 Bacteria 13809
120 Ga0451577_0009407 3300042876 Bacteria 9418
121 Ga0451577_0009856 3300042876 Bacteria 9153
122 Ga0451577_0017237 3300042876 Bacteria 6677
123 Ga0451577_0079267 3300042876 Bacteria 2928
124 Ga0451577_0083753 3300042876 Unclassified 2845
125 Ga0451577_0090629 3300042876 Bacteria 2729
126 Ga0451577_0173239 3300042876 Bacteria 1945
127 Ga0451577_0213337 3300042876 Bacteria 1744
128 Ga0451577_0265398 3300042876 Bacteria 1554
129 Ga0451577_0550003 3300042876 Bacteria 1048
130 Ga0453683_0000045 3300044673 Bacteria 211088
131 Ga0453683_0000078 3300044673 Bacteria 147056
132 Ga0453683_0000426 3300044673 Bacteria 48447
133 Ga0453683_0002803 3300044673 Bacteria 13258
134 Ga0453683_0003781 3300044673 Bacteria 11029
135 Ga0453683_0008256 3300044673 Bacteria 7001
136 Ga0453683_0008625 3300044673 Bacteria 6835
137 Ga0453683_0013923 3300044673 Bacteria 5234
138 Ga0453683_0038493 3300044673 Unclassified 3007
139 Ga0453683_0050817 3300044673 Bacteria 2597
140 Ga0453683_0233776 3300044673 Bacteria 1170
141 Ga0453683_0296977 3300044673 Unclassified 1033
142 Ga0453684_0000051 3300044712 Bacteria 551033
143 Ga0453684_0000133 3300044712 Bacteria 329529
144 Ga0453684_0000143 3300044712 Bacteria 315998
145 Ga0453684_0000161 3300044712 Bacteria 298175
146 Ga0453684_0000226 3300044712 Bacteria 244912
147 Ga0453684_0000630 3300044712 Bacteria 128059
148 Ga0453684_0000846 3300044712 Bacteria 103225
149 Ga0453684_0008122 3300044712 Bacteria 18958
150 Ga0453684_0009690 3300044712 Bacteria 16768
151 Ga0453684_0014987 3300044712 Bacteria 12310
152 Ga0453684_0019413 3300044712 Bacteria 10352
153 Ga0453684_0036315 3300044712 Bacteria 6792
154 Ga0453684_0072853 3300044712 Bacteria 4334
155 Ga0453684_0105752 3300044712 Bacteria 3432
156 Ga0453684_0109424 3300044712 Unclassified 3361
157 Ga0453684_0564122 3300044712 Bacteria 1252
158 Ga0453684_0603327 3300044712 Bacteria 1203
159 Ga0451576_0000059 3300045051 Bacteria 296795
160 Ga0451576_0000097 3300045051 Bacteria 220569
161 Ga0451576_0000175 3300045051 Bacteria 161976
162 Ga0451576_0000403 3300045051 Bacteria 100887
163 Ga0451576_0000639 3300045051 Bacteria 72715
164 Ga0451576_0001255 3300045051 Bacteria 44559
165 Ga0451576_0016384 3300045051 Bacteria 8182
166 Ga0451576_0017890 3300045051 Bacteria 7783
167 Ga0451576_0020885 3300045051 Bacteria 7126
168 Ga0451576_0085524 3300045051 Unclassified 3281
169 Ga0451576_0108290 3300045051 Bacteria 2891
170 Ga0451576_0122551 3300045051 Bacteria 2707
171 Ga0451576_0278233 3300045051 Bacteria 1750
172 Ga0495627_000071 3300046453 Bacteria 124716
173 Ga0495627_005191 3300046453 Bacteria 5297
174 Ga0495627_016762 3300046453 Bacteria 2503
175 Ga0495596_0003697 3300046500 Bacteria 7647
176 Ga0495606_0019355 3300046507 Bacteria 5069
177 Ga0495606_0043605 3300046507 Bacteria 2990
178 Ga0495610_0000001 3300046512 Bacteria 1620061
179 Ga0495610_0095303 3300046512 Bacteria 1342
180 Ga0495616_0023208 3300046513 Bacteria 3340
181 Ga0495632_0005369 3300046519 Bacteria 8484
182 Ga0495643_0000597 3300046522 Bacteria 43811
183 Ga0495643_0046937 3300046522 Bacteria 2340
184 Ga0495663_0000010 3300046525 Bacteria 161009
185 Ga0495663_0014602 3300046525 Bacteria 2203
186 Ga0495654_0000001 3300046530 Bacteria 1513197
187 Ga0495609_0000060 3300046538 Bacteria 139944
188 Ga0495633_0000018 3300046558 Bacteria 243398
189 Ga0495633_0000909 3300046558 Bacteria 25222
190 Ga0495625_0001819 3300046660 Bacteria 24409
191 Ga0495625_0008145 3300046660 Bacteria 8980
192 Ga0495625_0213051 3300046660 Bacteria 1269
193 Ga0495686_0000022 3300047472 Bacteria 403456
194 Ga0495686_0008895 3300047472 Bacteria 7304
195 Ga0496115_0014425 3300048918 Bacteria 5982
196 Ga0496116_0000027 3300048919 Bacteria 448077
197 Ga0496116_0000041 3300048919 Bacteria 343299
198 Ga0496117_0000021 3300048920 Bacteria 444168
199 Ga0496117_0101034 3300048920 Bacteria 1826
200 Ga0496118_0000330 3300048921 Bacteria 80749
201 Ga0496118_0106691 3300048921 Bacteria 1873
202 Ga0496118_0155728 3300048921 Bacteria 1422
203 Ga0496119_0000004 3300048922 Bacteria 536344
204 Ga0496120_0142934 3300048923 Bacteria 1212
205 Ga0496121_0037115 3300048924 Bacteria 4332
206 Ga0496121_0059321 3300048924 Bacteria 3156
207 Ga0496121_0085977 3300048924 Bacteria 2473
208 Ga0496122_0000154 3300048925 Bacteria 160610
209 Ga0496122_0002108 3300048925 Bacteria 29485
210 Ga0496122_0002780 3300048925 Bacteria 24068
211 Ga0496122_0007390 3300048925 Bacteria 12236
212 Ga0496122_0061140 3300048925 Bacteria 2767
213 Ga0496123_0001697 3300048926 Bacteria 29442
214 Ga0496123_0012771 3300048926 Bacteria 7122
215 Ga0496123_0240074 3300048926 Bacteria 900
216 Ga0496124_0001176 3300048927 Bacteria 40893
217 Ga0496124_0005888 3300048927 Bacteria 13574
218 Ga0496125_0000036 3300048928 Bacteria 335814
219 Ga0496125_0000457 3300048928 Bacteria 73822
220 Ga0496125_0001300 3300048928 Bacteria 37067
221 Ga0496125_0037105 3300048928 Bacteria 4242
222 Ga0496125_0122445 3300048928 Bacteria 1851
223 Ga0496126_0003451 3300048929 Bacteria 19950
224 Ga0496126_0008262 3300048929 Bacteria 11239
225 Ga0496126_0097872 3300048929 Bacteria 2571
226 Ga0496126_0314960 3300048929 Bacteria 1288
227 Ga0501034_0454659 3300049571 Bacteria 1198
228 Ga0501198_001197 3300049649 Bacteria 3335
229 Ga0501238_002326 3300049671 Bacteria 2263
230 Ga0501249_000003 3300049679 Bacteria 242930
231 Ga0501249_008705 3300049679 Bacteria 2106
232 Ga0501241_000024 3300049758 Bacteria 64119
233 Ga0501241_001121 3300049758 Bacteria 5612
234 Ga0501266_000025 3300049763 Bacteria 67199
235 Ga0501269_000170 3300049766 Bacteria 19920
236 Ga0501280_002632 3300049776 Bacteria 2938
237 Ga0500646_0035713 3300053090 Bacteria 1382
238 Ga0500641_0000030 3300053096 Bacteria 96500
239 Ga0500641_0000166 3300053096 Bacteria 24750
240 Ga0500641_0000345 3300053096 Bacteria 17222
241 Ga0500658_0000008 3300053134 Bacteria 273324
242 Ga0500622_0039684 3300053156 Bacteria 2454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428061 2587750984 206
2 3300031903 Ga0307407_10167666 Ga0307407_101676662 241
3 iso_pu_bacteria 2585428187 2588231522 242
4 iso_pu_bacteria 2965320100 2965320322 243
5 iso_pu_bacteria 2523533629 2524006050 244
6 iso_pu_bacteria 2513020052 2513236496 245
7 iso_pu_bacteria 2519899754 2520878478 245
8 iso_pu_bacteria 2643221600 2644011765 245
9 iso_pu_bacteria 2643221667 2644370149 245
10 iso_pu_bacteria 2643221725 2644685563 245
11 iso_pu_bacteria 2738541273 2738699384 245
12 iso_pu_bacteria 2738541279 2738736204 245
13 iso_pu_bacteria 2738541285 2738768647 245
14 iso_pu_bacteria 2738543007 2739217786 245
15 iso_pu_bacteria 2738543014 2739255351 245
16 iso_pu_bacteria 2739367858 2740008239 245
17 iso_pu_bacteria 2739367874 2740061377 245
18 iso_pu_bacteria 2816332280 2817415501 245
19 iso_pu_bacteria 2833640130 2833644222 245
20 iso_pu_bacteria 2857613821 2857614278 245
21 iso_pu_bacteria 2857618242 2857619366 245
22 iso_pu_bacteria 2881359912 2881362331 245
23 iso_pu_bacteria 2903895155 2903898273 245
24 iso_pu_bacteria 2904419702 2904423327 245
25 iso_pu_bacteria 2904555929 2904556342 245
26 iso_pu_bacteria 2919191525 2919193270 245
27 iso_pu_bacteria 2919509842 2919512452 245
28 iso_pu_bacteria 2929150217 2929152749 245
29 iso_pu_bacteria 2958458903 2958462490 245
30 iso_pu_bacteria 2977268062 2977269437 245
31 iso_pu_bacteria 2984572630 2984575281 245
32 iso_pu_bacteria 2984606641 2984608735 245
33 iso_pu_bacteria 8036736890 8036738476 245
34 iso_pu_bacteria 8054307821 8054309496 245
35 iso_pu_bacteria 8055592153 8055594443 245
36 iso_pu_bacteria 8056440228 8056444536 245
37 3300031691 Ga0316579_10038583 Ga0316579_100385832 246
38 3300032137 Ga0316585_10033654 Ga0316585_100336542 246
39 3300037471 Ga0395905_0057513 Ga0395905_0057513_279_1055 246
40 3300044712 Ga0453684_0564122 Ga0453684_0564122_467_1228 246
41 3300048921 Ga0496118_0155728 Ga0496118_0155728_240_998 246
42 iso_pu_bacteria 2511231000 2511231531 246
43 iso_pu_bacteria 2582581281 2585159569 246
44 iso_pu_bacteria 2582581282 2585163826 246
45 iso_pu_bacteria 2582581873 2585425462 246
46 iso_pu_bacteria 2585428045 2587677471 246
47 iso_pu_bacteria 2585428060 2587745602 246
48 iso_pu_bacteria 2585428095 2587865547 246
49 iso_pu_bacteria 2585428183 2588216243 246
50 iso_pu_bacteria 2585428184 2588220452 246
51 iso_pu_bacteria 2588253712 2588445612 246
52 iso_pu_bacteria 2588254255 2590602424 246
53 iso_pu_bacteria 2588254257 2590611219 246
54 iso_pu_bacteria 2728369107 2729202137 246
55 iso_pu_bacteria 2772190705 2772604570 246
56 iso_pu_bacteria 2775506739 2775673464 246
57 iso_pu_bacteria 2842083920 2842087995 246
58 iso_pu_bacteria 2905999023 2906002188 246
59 iso_pu_bacteria 2919097161 2919097570 246
60 iso_pu_bacteria 2919399522 2919400883 246
61 iso_pu_bacteria 2946019816 2946020509 246
62 3300032004 Ga0307414_10017657 Ga0307414_100176575 247
63 3300042876 Ga0451577_0090629 Ga0451577_0090629_617_1399 247
64 3300044712 Ga0453684_0603327 Ga0453684_0603327_375_1157 247
65 3300048926 Ga0496123_0240074 Ga0496123_0240074_86_844 247
66 iso_pu_bacteria 2585428115 2587943684 247
67 iso_pu_bacteria 2919683626 2919686567 247
68 iso_pu_bacteria 2945924605 2945926819 247
69 iso_pu_bacteria 2977243572 2977246866 247
70 iso_pu_bacteria 2993372514 2993374250 247
71 iso_pu_bacteria 2993480792 2993481146 247
72 iso_pu_bacteria 8055419101 8055421137 247
73 3300005289 Ga0065704_10113999 Ga0065704_101139992 248
74 3300013102 Ga0157371_10000081 Ga0157371_1000008113 248
75 3300013102 Ga0157371_10405087 Ga0157371_104050872 248
76 3300013104 Ga0157370_10008940 Ga0157370_100089402 248
77 3300013105 Ga0157369_10009164 Ga0157369_100091649 248
78 3300013105 Ga0157369_10222415 Ga0157369_102224152 248
79 3300013307 Ga0157372_10012982 Ga0157372_100129829 248
80 3300025919 Ga0207657_10207799 Ga0207657_102077992 248
81 3300028794 Ga0307515_10278800 Ga0307515_102788002 248
82 3300031727 Ga0316576_10043302 Ga0316576_100433024 248
83 3300031727 Ga0316576_10044038 Ga0316576_100440384 248
84 3300035398 Ga0316574_0263266 Ga0316574_0263266_120_884 248
85 3300042876 Ga0451577_0173239 Ga0451577_0173239_578_1357 248
86 3300045051 Ga0451576_0020885 Ga0451576_0020885_4748_5521 248
87 iso_pu_bacteria 2582581278 2585143975 248
88 iso_pu_bacteria 2585428182 2588208989 248
89 iso_pu_bacteria 2585428185 2588225166 248
90 iso_pu_bacteria 2751185877 2753671867 248
91 iso_pu_bacteria 2765235839 2765576793 248
92 iso_pu_bacteria 2816332188 2816872092 248
93 iso_pu_bacteria 2871720351 2871720886 248
94 iso_pu_bacteria 2889290771 2889292651 248
95 3300001915 JGI24741J21665_1023573 JGI24741J21665_10235731 249
96 3300003320 rootH2_10009524 rootH2_100095248 249
97 3300003322 rootL2_10110896 rootL2_101108963 249
98 3300003322 rootL2_10209876 rootL2_102098762 249
99 3300003323 rootH1_10138189 rootH1_101381893 249
100 3300005288 Ga0065714_10002979 Ga0065714_100029795 249
101 3300005288 Ga0065714_10067305 Ga0065714_100673053 249
102 3300005288 Ga0065714_10073154 Ga0065714_100731542 249
103 3300005289 Ga0065704_10072094 Ga0065704_100720947 249
104 3300005293 Ga0065715_10098401 Ga0065715_100984012 249
105 3300005327 Ga0070658_10249124 Ga0070658_102491242 249
106 3300005329 Ga0070683_100001620 Ga0070683_10000162014 249
107 3300005337 Ga0070682_100000290 Ga0070682_10000029018 249
108 3300005347 Ga0070668_100023749 Ga0070668_1000237494 249
109 3300005535 Ga0070684_100049595 Ga0070684_1000495953 249
110 3300005563 Ga0068855_100042959 Ga0068855_1000429591 249
111 3300005614 Ga0068856_100078685 Ga0068856_1000786854 249
112 3300005614 Ga0068856_100537522 Ga0068856_1005375221 249
113 3300006942 Ga0099824_1005721 Ga0099824_100572110 249
114 3300006946 Ga0079104_1000271 Ga0079104_10002713 249
115 3300006948 Ga0099826_10004388 Ga0099826_100043884 249
116 3300009036 Ga0105244_10000226 Ga0105244_1000022630 249
117 3300009093 Ga0105240_10836097 Ga0105240_108360971 249
118 3300009148 Ga0105243_10000268 Ga0105243_1000026822 249
119 3300009148 Ga0105243_10078217 Ga0105243_100782171 249
120 3300013100 Ga0157373_10000012 Ga0157373_1000001251 249
121 3300013100 Ga0157373_10000019 Ga0157373_1000001957 249
122 3300013100 Ga0157373_10281194 Ga0157373_102811942 249
123 3300013102 Ga0157371_10005701 Ga0157371_100057014 249
124 3300013104 Ga0157370_10000135 Ga0157370_1000013543 249
125 3300013104 Ga0157370_10000451 Ga0157370_1000045128 249
126 3300013104 Ga0157370_10004907 Ga0157370_1000490711 249
127 3300013104 Ga0157370_10026347 Ga0157370_100263472 249
128 3300013104 Ga0157370_10036238 Ga0157370_100362382 249
129 3300013104 Ga0157370_10046804 Ga0157370_100468044 249
130 3300013104 Ga0157370_10050208 Ga0157370_100502082 249
131 3300013104 Ga0157370_10058529 Ga0157370_100585293 249
132 3300013104 Ga0157370_10072632 Ga0157370_100726324 249
133 3300013105 Ga0157369_10053373 Ga0157369_100533732 249
134 3300013105 Ga0157369_10097810 Ga0157369_100978104 249
135 3300013306 Ga0163162_10119986 Ga0163162_101199863 249
136 3300013308 Ga0157375_10000150 Ga0157375_100001506 249
137 3300013308 Ga0157375_10120095 Ga0157375_101200952 249
138 3300014497 Ga0182008_10000015 Ga0182008_1000001591 249
139 3300015261 Ga0182006_1000015 Ga0182006_1000015229 249
140 3300015261 Ga0182006_1001418 Ga0182006_100141811 249
141 3300015261 Ga0182006_1087439 Ga0182006_10874392 249
142 3300017792 Ga0163161_10000177 Ga0163161_1000017719 249
143 3300017792 Ga0163161_10001295 Ga0163161_100012955 249
144 3300017792 Ga0163161_10013685 Ga0163161_100136852 249
145 3300017792 Ga0163161_10027579 Ga0163161_100275793 249
146 3300025291 Ga0209675_1000042 Ga0209675_100004266 249
147 3300025728 Ga0207655_1000010 Ga0207655_1000010400 249
148 3300025728 Ga0207655_1000517 Ga0207655_10005174 249
149 3300025935 Ga0207709_10001541 Ga0207709_100015414 249
150 3300025935 Ga0207709_10071092 Ga0207709_100710921 249
151 3300025944 Ga0207661_10001955 Ga0207661_1000195511 249
152 3300025949 Ga0207667_10144013 Ga0207667_101440134 249
153 3300025949 Ga0207667_10436899 Ga0207667_104368992 249
154 3300026078 Ga0207702_10081784 Ga0207702_100817844 249
155 3300027111 Ga0209281_1000396 Ga0209281_10003962 249
156 3300027361 Ga0209489_118617 Ga0209489_1186172 249
157 3300027526 Ga0209968_1001575 Ga0209968_10015753 249
158 3300027617 Ga0210002_1006852 Ga0210002_10068522 249
159 3300027666 Ga0209282_1015972 Ga0209282_10159722 249
160 3300028556 Ga0265337_1058254 Ga0265337_10582542 249
161 3300031251 Ga0265327_10075893 Ga0265327_100758932 249
162 3300031548 Ga0307408_100000121 Ga0307408_10000012122 249
163 3300031548 Ga0307408_100023531 Ga0307408_1000235312 249
164 3300031727 Ga0316576_10063123 Ga0316576_100631232 249
165 3300031731 Ga0307405_10000001 Ga0307405_100000011388 249
166 3300031731 Ga0307405_10020171 Ga0307405_100201715 249
167 3300031731 Ga0307405_10590417 Ga0307405_105904172 249
168 3300031852 Ga0307410_10000055 Ga0307410_1000005524 249
169 3300031901 Ga0307406_10000009 Ga0307406_1000000983 249
170 3300031911 Ga0307412_10000134 Ga0307412_1000013437 249
171 3300031911 Ga0307412_10000692 Ga0307412_100006925 249
172 3300031911 Ga0307412_10002630 Ga0307412_100026303 249
173 3300031995 Ga0307409_100376140 Ga0307409_1003761402 249
174 3300032002 Ga0307416_100000004 Ga0307416_100000004347 249
175 3300032002 Ga0307416_100003636 Ga0307416_1000036363 249
176 3300032004 Ga0307414_10000001 Ga0307414_10000001415 249
177 3300032004 Ga0307414_10000032 Ga0307414_1000003219 249
178 3300032004 Ga0307414_10003821 Ga0307414_100038212 249
179 3300032004 Ga0307414_10027305 Ga0307414_100273053 249
180 3300032004 Ga0307414_10231934 Ga0307414_102319342 249
181 3300032005 Ga0307411_10000005 Ga0307411_10000005234 249
182 3300036647 Ga0316582_0059701 Ga0316582_0059701_1004_1816 249
183 3300036712 Ga0316584_0142563 Ga0316584_0142563_651_1406 249
184 3300036712 Ga0316584_0221880 Ga0316584_0221880_193_1005 249
185 3300036712 Ga0316584_0236579 Ga0316584_0236579_285_1055 249
186 3300041407 Ga0439447_000239 Ga0439447_000239_12151_12915 249
187 3300041413 Ga0439465_0031379 Ga0439465_0031379_538_1308 249
188 3300042876 Ga0451577_0000043 Ga0451577_0000043_327777_328547 249
189 3300042876 Ga0451577_0000048 Ga0451577_0000048_214997_215791 249
190 3300042876 Ga0451577_0000097 Ga0451577_0000097_57551_58336 249
191 3300042876 Ga0451577_0004966 Ga0451577_0004966_1287_2060 249
192 3300042876 Ga0451577_0009407 Ga0451577_0009407_963_1733 249
193 3300042876 Ga0451577_0017237 Ga0451577_0017237_3156_3929 249
194 3300042876 Ga0451577_0079267 Ga0451577_0079267_1747_2520 249
195 3300042876 Ga0451577_0083753 Ga0451577_0083753_284_1054 249
196 3300042876 Ga0451577_0213337 Ga0451577_0213337_77_850 249
197 3300042876 Ga0451577_0265398 Ga0451577_0265398_712_1485 249
198 3300042876 Ga0451577_0550003 Ga0451577_0550003_173_946 249
199 3300044673 Ga0453683_0000045 Ga0453683_0000045_101492_102265 249
200 3300044673 Ga0453683_0000078 Ga0453683_0000078_93587_94381 249
201 3300044673 Ga0453683_0000426 Ga0453683_0000426_17150_17920 249
202 3300044673 Ga0453683_0002803 Ga0453683_0002803_22_792 249
203 3300044673 Ga0453683_0003781 Ga0453683_0003781_4610_5380 249
204 3300044673 Ga0453683_0008256 Ga0453683_0008256_4638_5411 249
205 3300044673 Ga0453683_0008625 Ga0453683_0008625_5897_6670 249
206 3300044673 Ga0453683_0013923 Ga0453683_0013923_2827_3597 249
207 3300044673 Ga0453683_0038493 Ga0453683_0038493_2172_2945 249
208 3300044673 Ga0453683_0050817 Ga0453683_0050817_248_1021 249
209 3300044673 Ga0453683_0233776 Ga0453683_0233776_120_890 249
210 3300044712 Ga0453684_0000133 Ga0453684_0000133_327773_328543 249
211 3300044712 Ga0453684_0000161 Ga0453684_0000161_203795_204589 249
212 3300044712 Ga0453684_0000226 Ga0453684_0000226_201052_201825 249
213 3300044712 Ga0453684_0000846 Ga0453684_0000846_46654_47427 249
214 3300044712 Ga0453684_0008122 Ga0453684_0008122_123_899 249
215 3300044712 Ga0453684_0014987 Ga0453684_0014987_7048_7821 249
216 3300044712 Ga0453684_0019413 Ga0453684_0019413_6188_6958 249
217 3300044712 Ga0453684_0036315 Ga0453684_0036315_358_1131 249
218 3300044712 Ga0453684_0072853 Ga0453684_0072853_2172_2942 249
219 3300044712 Ga0453684_0105752 Ga0453684_0105752_2073_2843 249
220 3300044712 Ga0453684_0109424 Ga0453684_0109424_1473_2243 249
221 3300045051 Ga0451576_0000059 Ga0451576_0000059_93587_94381 249
222 3300045051 Ga0451576_0000097 Ga0451576_0000097_218813_219583 249
223 3300045051 Ga0451576_0000175 Ga0451576_0000175_105405_106178 249
224 3300045051 Ga0451576_0000403 Ga0451576_0000403_30528_31298 249
225 3300045051 Ga0451576_0000639 Ga0451576_0000639_3024_3800 249
226 3300045051 Ga0451576_0001255 Ga0451576_0001255_42105_42875 249
227 3300045051 Ga0451576_0016384 Ga0451576_0016384_6749_7522 249
228 3300045051 Ga0451576_0017890 Ga0451576_0017890_3399_4175 249
229 3300045051 Ga0451576_0108290 Ga0451576_0108290_1417_2187 249
230 3300045051 Ga0451576_0122551 Ga0451576_0122551_1867_2637 249
231 3300045051 Ga0451576_0278233 Ga0451576_0278233_156_926 249
232 3300046453 Ga0495627_000071 Ga0495627_000071_93061_93837 249
233 3300046453 Ga0495627_005191 Ga0495627_005191_611_1387 249
234 3300046453 Ga0495627_016762 Ga0495627_016762_1585_2358 249
235 3300046500 Ga0495596_0003697 Ga0495596_0003697_5739_6515 249
236 3300046507 Ga0495606_0019355 Ga0495606_0019355_2876_3646 249
237 3300046507 Ga0495606_0043605 Ga0495606_0043605_1504_2271 249
238 3300046512 Ga0495610_0000001 Ga0495610_0000001_658232_659002 249
239 3300046512 Ga0495610_0095303 Ga0495610_0095303_563_1327 249
240 3300046513 Ga0495616_0023208 Ga0495616_0023208_1058_1834 249
241 3300046519 Ga0495632_0005369 Ga0495632_0005369_314_1087 249
242 3300046522 Ga0495643_0000597 Ga0495643_0000597_37301_38077 249
243 3300046522 Ga0495643_0046937 Ga0495643_0046937_453_1226 249
244 3300046525 Ga0495663_0000010 Ga0495663_0000010_59215_59982 249
245 3300046525 Ga0495663_0014602 Ga0495663_0014602_998_1765 249
246 3300046530 Ga0495654_0000001 Ga0495654_0000001_89376_90152 249
247 3300046538 Ga0495609_0000060 Ga0495609_0000060_24658_25428 249
248 3300046558 Ga0495633_0000018 Ga0495633_0000018_89845_90618 249
249 3300046558 Ga0495633_0000909 Ga0495633_0000909_21361_22134 249
250 3300046660 Ga0495625_0001819 Ga0495625_0001819_14523_15296 249
251 3300046660 Ga0495625_0008145 Ga0495625_0008145_3787_4563 249
252 3300046660 Ga0495625_0213051 Ga0495625_0213051_78_842 249
253 3300047472 Ga0495686_0000022 Ga0495686_0000022_256794_257567 249
254 3300047472 Ga0495686_0008895 Ga0495686_0008895_5643_6419 249
255 3300048918 Ga0496115_0014425 Ga0496115_0014425_2229_3005 249
256 3300048919 Ga0496116_0000027 Ga0496116_0000027_206966_207742 249
257 3300048919 Ga0496116_0000041 Ga0496116_0000041_250644_251408 249
258 3300048920 Ga0496117_0000021 Ga0496117_0000021_238504_239280 249
259 3300048920 Ga0496117_0101034 Ga0496117_0101034_949_1713 249
260 3300048921 Ga0496118_0000330 Ga0496118_0000330_36499_37275 249
261 3300048921 Ga0496118_0106691 Ga0496118_0106691_732_1496 249
262 3300048922 Ga0496119_0000004 Ga0496119_0000004_204900_205676 249
263 3300048923 Ga0496120_0142934 Ga0496120_0142934_281_1057 249
264 3300048924 Ga0496121_0037115 Ga0496121_0037115_2576_3352 249
265 3300048924 Ga0496121_0059321 Ga0496121_0059321_2253_3017 249
266 3300048924 Ga0496121_0085977 Ga0496121_0085977_117_881 249
267 3300048925 Ga0496122_0000154 Ga0496122_0000154_148900_149670 249
268 3300048925 Ga0496122_0002108 Ga0496122_0002108_24524_25300 249
269 3300048925 Ga0496122_0002780 Ga0496122_0002780_10452_11222 249
270 3300048925 Ga0496122_0007390 Ga0496122_0007390_7214_7990 249
271 3300048925 Ga0496122_0061140 Ga0496122_0061140_1917_2687 249
272 3300048926 Ga0496123_0001697 Ga0496123_0001697_24494_25270 249
273 3300048926 Ga0496123_0012771 Ga0496123_0012771_3479_4255 249
274 3300048927 Ga0496124_0001176 Ga0496124_0001176_32320_33096 249
275 3300048927 Ga0496124_0005888 Ga0496124_0005888_11272_12036 249
276 3300048928 Ga0496125_0000036 Ga0496125_0000036_10145_10909 249
277 3300048928 Ga0496125_0000457 Ga0496125_0000457_47927_48703 249
278 3300048928 Ga0496125_0001300 Ga0496125_0001300_2352_3128 249
279 3300048928 Ga0496125_0037105 Ga0496125_0037105_2919_3689 249
280 3300048928 Ga0496125_0122445 Ga0496125_0122445_1000_1776 249
281 3300048929 Ga0496126_0003451 Ga0496126_0003451_8684_9460 249
282 3300048929 Ga0496126_0008262 Ga0496126_0008262_257_1021 249
283 3300048929 Ga0496126_0097872 Ga0496126_0097872_1559_2335 249
284 3300048929 Ga0496126_0314960 Ga0496126_0314960_24_800 249
285 3300049671 Ga0501238_002326 Ga0501238_002326_528_1292 249
286 3300049679 Ga0501249_000003 Ga0501249_000003_175408_176172 249
287 3300049679 Ga0501249_008705 Ga0501249_008705_808_1572 249
288 3300049758 Ga0501241_000024 Ga0501241_000024_45720_46490 249
289 3300049758 Ga0501241_001121 Ga0501241_001121_2787_3560 249
290 3300049763 Ga0501266_000025 Ga0501266_000025_54409_55173 249
291 3300049766 Ga0501269_000170 Ga0501269_000170_11787_12557 249
292 3300049776 Ga0501280_002632 Ga0501280_002632_400_1164 249
293 3300053090 Ga0500646_0035713 Ga0500646_0035713_546_1310 249
294 3300053096 Ga0500641_0000030 Ga0500641_0000030_58335_59099 249
295 3300053096 Ga0500641_0000166 Ga0500641_0000166_4972_5736 249
296 3300053096 Ga0500641_0000345 Ga0500641_0000345_10661_11437 249
297 3300053134 Ga0500658_0000008 Ga0500658_0000008_113693_114457 249
298 3300053156 Ga0500622_0039684 Ga0500622_0039684_523_1299 249
299 iso_pu_bacteria 2881247448 2881248021 249
300 iso_pu_bacteria 2958512119 2958512223 249
301 2162886007 SwRhRL2b_contig_1392192 SwRhRL2b_0292.00008890 250
302 3300005289 Ga0065704_10093972 Ga0065704_100939721 250
303 3300005614 Ga0068856_100060683 Ga0068856_1000606834 250
304 3300013307 Ga0157372_10199995 Ga0157372_101999953 250
305 3300026078 Ga0207702_10062467 Ga0207702_100624674 250
306 3300042876 Ga0451577_0009856 Ga0451577_0009856_130_930 250
307 3300044673 Ga0453683_0296977 Ga0453683_0296977_57_833 250
308 3300044712 Ga0453684_0000051 Ga0453684_0000051_283208_283999 250
309 3300044712 Ga0453684_0000143 Ga0453684_0000143_136223_137023 250
310 3300044712 Ga0453684_0000630 Ga0453684_0000630_116072_116869 250
311 3300044712 Ga0453684_0009690 Ga0453684_0009690_885_1664 250
312 3300045051 Ga0451576_0085524 Ga0451576_0085524_945_1745 250
313 3300049571 Ga0501034_0454659 Ga0501034_0454659_194_967 250
314 3300049649 Ga0501198_001197 Ga0501198_001197_1903_2655 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09674

DUF2400

Protein of unknown function (DUF2400)

57

282

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n0u-assembly3.cif.gz_C crystal structure of tm1821, the 8-oxoguanine dna glycosylase of thermotoga maritima 0.5627 4 248
3n0u-assembly3.cif.gz_C crystal structure of tm1821, the 8-oxoguanine dna glycosylase of thermotoga maritima 0.5479 4 248
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.5294 37 186
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.5233 41 186
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.5176 41 186
ID Description Score Start End Superfamily
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5605 41 152 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5388 34 152 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5281 35 152 1.10.340.30
af_A0A0P0WH57_6_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.4666 195 228 3.30.420.10
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.4522 41 137 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A5C8A9J9-F1-model_v4 DUF2400 family protein 0.9835 2 167
AF-A0A645HW04-F1-model_v4 DUF2400 domain-containing protein 0.9783 164 245
AF-A0A6N8TLP8-F1-model_v4 TIGR02757 family protein 0.9753 5 248
AF-A0A7D3XNW1-F1-model_v4 TIGR02757 family protein 0.9746 2 248
AF-A0A1V6B4X3-F1-model_v4 TIGR02757 family protein 0.9735 160 248

Feature Viewer

pLDDT pTM Quality
94.77 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map