F402738
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 215 | 295 | 409 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10009739|Ga0265334_100097392 |
| Length | 456 |
| Sequence | VSGTPGVGQGVRGAALPPGEGGPRVDLTDPGVFGAGVPHEEFARLRREDPVSWTPEPHGRGFWSVTRYSDVVTVHREVGTYSSQVGATALEDLEPDALAARASMLDLDPPEHTRLRRTVAPEFTRRSVGGYRTRVQDVVRQVLAEVLPSGGETVEFEAVSRVATTIPIRVLCQVLGVPEKDEPLLIELGDRMIGNTDPDLAQVLLDSQESDAYRLLPFRSPAALQMHAYGRELAVRKQRDPGSDLVTALVQGRAPGTPRLAGAEFDAMFLLLVVAGNETTRSALALGLQAFAEYPDQWDLLAARVEAGDPEAIAAAAEEVLRWTTPLHHFRRTATRDTELAGQVIAAEDKVVVWYPSANRDGTVFTDPDRFDVTRTPNQHVSFGRGGPHRCLGEHLARLEIQVVLEELLPRVVRFEVAGPVRRVRSNFVHGLKSLPLRAVPRRPTDPLTSHLGSRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 5 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 6 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 7 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 8 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 9 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 10 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 11 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 12 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 13 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 14 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 45 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 99 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 100 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 109 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 114 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 177 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 178 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 179 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 180 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 183 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 206 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 207 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 208 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 210 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 212 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 213 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 214 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 215 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.63 |
| Metatranscriptomes | 0.32 |
| Isolates | 6.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 5.41 |
| Rhizoplane | 2.87 |
| Rhizosphere | 74.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1001476 | 3300002073 | Bacteria | 2286 |
| 2 | Ga0065165_1000348 | 3300005262 | Bacteria | 75762 |
| 3 | Ga0065165_1004345 | 3300005262 | Bacteria | 8892 |
| 4 | Ga0070658_10115297 | 3300005327 | Bacteria | 2229 |
| 5 | Ga0070683_100264140 | 3300005329 | Bacteria | 1637 |
| 6 | Ga0070682_100035472 | 3300005337 | Bacteria | 3045 |
| 7 | Ga0070668_100031848 | 3300005347 | Bacteria | 4013 |
| 8 | Ga0070714_100035896 | 3300005435 | Bacteria | 4155 |
| 9 | Ga0070711_100113994 | 3300005439 | Bacteria | 1988 |
| 10 | Ga0070708_100009605 | 3300005445 | Bacteria | 7800 |
| 11 | Ga0070708_100127141 | 3300005445 | Bacteria | 2357 |
| 12 | Ga0070662_100007619 | 3300005457 | Bacteria | 7028 |
| 13 | Ga0070681_10047761 | 3300005458 | Bacteria | 4278 |
| 14 | Ga0068867_100187888 | 3300005459 | Bacteria | 1647 |
| 15 | Ga0070707_100012901 | 3300005468 | Bacteria | 7805 |
| 16 | Ga0070698_100005127 | 3300005471 | Bacteria | 14336 |
| 17 | Ga0070665_100063215 | 3300005548 | Bacteria | 3711 |
| 18 | Ga0068854_100030316 | 3300005578 | Bacteria | 3751 |
| 19 | Ga0068856_100328657 | 3300005614 | Bacteria | 1546 |
| 20 | Ga0068852_100212967 | 3300005616 | Bacteria | 1834 |
| 21 | Ga0068859_100000043 | 3300005617 | Bacteria | 156893 |
| 22 | Ga0068864_100042615 | 3300005618 | Bacteria | 3884 |
| 23 | Ga0068864_100116021 | 3300005618 | Bacteria | 2388 |
| 24 | Ga0068861_100060339 | 3300005719 | Bacteria | 2906 |
| 25 | Ga0068863_100066248 | 3300005841 | Bacteria | 3416 |
| 26 | Ga0068858_100026189 | 3300005842 | Bacteria | 5422 |
| 27 | Ga0068858_100072336 | 3300005842 | Bacteria | 3199 |
| 28 | Ga0068862_100000037 | 3300005844 | Bacteria | 172796 |
| 29 | Ga0081540_1001522 | 3300005983 | Bacteria | 19920 |
| 30 | Ga0070717_10106463 | 3300006028 | Bacteria | 2388 |
| 31 | Ga0070717_10106707 | 3300006028 | Bacteria | 2385 |
| 32 | Ga0070717_10156006 | 3300006028 | Bacteria | 1978 |
| 33 | Ga0075364_10092014 | 3300006051 | Bacteria | 2013 |
| 34 | Ga0075436_100021238 | 3300006914 | Bacteria | 4455 |
| 35 | Ga0097620_100000043 | 3300006931 | Bacteria | 156893 |
| 36 | Ga0099824_1013698 | 3300006942 | Bacteria | 8327 |
| 37 | Ga0099822_1016891 | 3300006943 | Bacteria | 7921 |
| 38 | Ga0075435_100046925 | 3300007076 | Bacteria | 3467 |
| 39 | Ga0111539_10039387 | 3300009094 | Bacteria | 5697 |
| 40 | Ga0111539_10062415 | 3300009094 | Bacteria | 4411 |
| 41 | Ga0105245_10029952 | 3300009098 | Bacteria | 4812 |
| 42 | Ga0105245_10102140 | 3300009098 | Bacteria | 2655 |
| 43 | Ga0105245_10160931 | 3300009098 | Bacteria | 2130 |
| 44 | Ga0114129_10032676 | 3300009147 | Bacteria | 7353 |
| 45 | Ga0105248_10138350 | 3300009177 | Bacteria | 2747 |
| 46 | Ga0105237_10209350 | 3300009545 | Bacteria | 1950 |
| 47 | Ga0105238_10116573 | 3300009551 | Bacteria | 2650 |
| 48 | Ga0105239_10144015 | 3300010375 | Bacteria | 2657 |
| 49 | Ga0105239_10347200 | 3300010375 | Bacteria | 1675 |
| 50 | Ga0157370_10054448 | 3300013104 | Bacteria | 3814 |
| 51 | Ga0157369_10001394 | 3300013105 | Bacteria | 29676 |
| 52 | Ga0157369_10351513 | 3300013105 | Bacteria | 1531 |
| 53 | Ga0163162_10047604 | 3300013306 | Bacteria | 4297 |
| 54 | Ga0157372_10290920 | 3300013307 | Bacteria | 1900 |
| 55 | Ga0157375_10128739 | 3300013308 | Bacteria | 2650 |
| 56 | Ga0163163_10011103 | 3300014325 | Bacteria | 8152 |
| 57 | Ga0157376_10088316 | 3300014969 | Bacteria | 2678 |
| 58 | Ga0157376_10209934 | 3300014969 | Bacteria | 1797 |
| 59 | Ga0213876_10028039 | 3300021384 | Bacteria | 2969 |
| 60 | Ga0209256_1004731 | 3300025299 | Bacteria | 8327 |
| 61 | Ga0207692_10051172 | 3300025898 | Bacteria | 2093 |
| 62 | Ga0207692_10092644 | 3300025898 | Bacteria | 1642 |
| 63 | Ga0207688_10002122 | 3300025901 | Bacteria | 10654 |
| 64 | Ga0207680_10192684 | 3300025903 | Bacteria | 1385 |
| 65 | Ga0207647_10073442 | 3300025904 | Bacteria | 2061 |
| 66 | Ga0207645_10054063 | 3300025907 | Bacteria | 2565 |
| 67 | Ga0207643_10021007 | 3300025908 | Bacteria | 3585 |
| 68 | Ga0207684_10029666 | 3300025910 | Bacteria | 4656 |
| 69 | Ga0207684_10318107 | 3300025910 | Bacteria | 1341 |
| 70 | Ga0207695_10046758 | 3300025913 | Bacteria | 4585 |
| 71 | Ga0207671_10049209 | 3300025914 | Bacteria | 3120 |
| 72 | Ga0207660_10150597 | 3300025917 | Bacteria | 1787 |
| 73 | Ga0207662_10050034 | 3300025918 | Bacteria | 2481 |
| 74 | Ga0207649_10030062 | 3300025920 | Bacteria | 3213 |
| 75 | Ga0207646_10068906 | 3300025922 | Bacteria | 3159 |
| 76 | Ga0207646_10257538 | 3300025922 | Bacteria | 1577 |
| 77 | Ga0207687_10066367 | 3300025927 | Bacteria | 2565 |
| 78 | Ga0207700_10079674 | 3300025928 | Bacteria | 2551 |
| 79 | Ga0207664_10096486 | 3300025929 | Bacteria | 2434 |
| 80 | Ga0207644_10208385 | 3300025931 | Bacteria | 1545 |
| 81 | Ga0207706_10028318 | 3300025933 | Bacteria | 5004 |
| 82 | Ga0207691_10160004 | 3300025940 | Bacteria | 1976 |
| 83 | Ga0207679_10075109 | 3300025945 | Bacteria | 2563 |
| 84 | Ga0207651_10102372 | 3300025960 | Bacteria | 2129 |
| 85 | Ga0207668_10029075 | 3300025972 | Bacteria | 3620 |
| 86 | Ga0207640_10120641 | 3300025981 | Bacteria | 1877 |
| 87 | Ga0207677_10006844 | 3300026023 | Bacteria | 6262 |
| 88 | Ga0207677_10065898 | 3300026023 | Bacteria | 2529 |
| 89 | Ga0207703_10237376 | 3300026035 | Bacteria | 1637 |
| 90 | Ga0207678_10008155 | 3300026067 | Bacteria | 9236 |
| 91 | Ga0207648_10184695 | 3300026089 | Bacteria | 1846 |
| 92 | Ga0207683_10152233 | 3300026121 | Bacteria | 2088 |
| 93 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 94 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 95 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 96 | Ga0207428_10051544 | 3300027907 | Bacteria | 3289 |
| 97 | Ga0268266_10001761 | 3300028379 | Bacteria | 24672 |
| 98 | Ga0268266_10057306 | 3300028379 | Bacteria | 3352 |
| 99 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 100 | Ga0268265_10023154 | 3300028380 | Bacteria | 4375 |
| 101 | Ga0265334_10009739 | 3300028573 | Bacteria | 4061 |
| 102 | Ga0316176_1169744 | 3300030732 | Bacteria | 4626 |
| 103 | Ga0314311_1144588 | 3300030733 | Bacteria | 4452 |
| 104 | Ga0265330_10002892 | 3300031235 | Bacteria | 9165 |
| 105 | Ga0265330_10002983 | 3300031235 | Bacteria | 9004 |
| 106 | Ga0265332_10013493 | 3300031238 | Bacteria | 3621 |
| 107 | Ga0265340_10009123 | 3300031247 | Bacteria | 5332 |
| 108 | Ga0265316_10026828 | 3300031344 | Bacteria | 4784 |
| 109 | Ga0307508_10056650 | 3300031616 | Bacteria | 3470 |
| 110 | Ga0265342_10013148 | 3300031712 | Bacteria | 5568 |
| 111 | Ga0307507_10009914 | 3300033179 | Bacteria | 12520 |
| 112 | Ga0307510_10067943 | 3300033180 | Bacteria | 3582 |
| 113 | Ga0373926_0000968 | 3300035083 | Bacteria | 8327 |
| 114 | Ga0373944_0001498 | 3300035089 | Bacteria | 5906 |
| 115 | Ga0373949_0000130 | 3300035090 | Bacteria | 28037 |
| 116 | Ga0373949_0005849 | 3300035090 | Bacteria | 2734 |
| 117 | Ga0373923_0003251 | 3300035111 | Bacteria | 5178 |
| 118 | Ga0373923_0004090 | 3300035111 | Bacteria | 4796 |
| 119 | Ga0373945_0007470 | 3300035116 | Bacteria | 3543 |
| 120 | Ga0373953_0000253 | 3300035117 | Bacteria | 14472 |
| 121 | Ga0373953_0044144 | 3300035117 | Bacteria | 1781 |
| 122 | Ga0373954_0000158 | 3300035118 | Bacteria | 24163 |
| 123 | Ga0373954_0004156 | 3300035118 | Bacteria | 6203 |
| 124 | Ga0373956_0002522 | 3300035119 | Bacteria | 7452 |
| 125 | Ga0373957_0000195 | 3300035120 | Bacteria | 15514 |
| 126 | Ga0373957_0009869 | 3300035120 | Bacteria | 3135 |
| 127 | Ga0373943_0003163 | 3300035170 | Bacteria | 7478 |
| 128 | Ga0373946_0000689 | 3300035171 | Bacteria | 11383 |
| 129 | Ga0373946_0060108 | 3300035171 | Bacteria | 1614 |
| 130 | Ga0373924_0002631 | 3300035410 | Bacteria | 6058 |
| 131 | Ga0373924_0020322 | 3300035410 | Bacteria | 2580 |
| 132 | Ga0373935_0000080 | 3300035692 | Bacteria | 41767 |
| 133 | Ga0373927_0003721 | 3300035695 | Bacteria | 10842 |
| 134 | Ga0373927_0156715 | 3300035695 | Bacteria | 1491 |
| 135 | Ga0373933_0000601 | 3300035724 | Bacteria | 22512 |
| 136 | Ga0373947_0036403 | 3300035725 | Bacteria | 2918 |
| 137 | Ga0373947_0057069 | 3300035725 | Bacteria | 2361 |
| 138 | Ga0373937_0007563 | 3300036401 | Bacteria | 9409 |
| 139 | Ga0373925_0004002 | 3300037068 | Bacteria | 11216 |
| 140 | Ga0373925_0129338 | 3300037068 | Bacteria | 1967 |
| 141 | Ga0373925_0137301 | 3300037068 | Bacteria | 1911 |
| 142 | Ga0395898_0039026 | 3300037466 | Bacteria | 4703 |
| 143 | Ga0395898_0071071 | 3300037466 | Bacteria | 3364 |
| 144 | Ga0436364_0239060 | 3300037853 | Bacteria | 6151 |
| 145 | Ga0395901_0086721 | 3300038443 | Bacteria | 3273 |
| 146 | Ga0436365_0144819 | 3300039437 | Bacteria | 2026 |
| 147 | Ga0436365_0226807 | 3300039437 | Bacteria | 2334 |
| 148 | Ga0436365_1507128 | 3300039437 | Bacteria | 5766 |
| 149 | Ga0436361_0987735 | 3300039447 | Bacteria | 6425 |
| 150 | Ga0436362_0560646 | 3300039453 | Bacteria | 5108 |
| 151 | Ga0466959_0016591 | 3300045049 | Bacteria | 5385 |
| 152 | Ga0466967_0126047 | 3300045976 | Bacteria | 2372 |
| 153 | Ga0495592_0000710 | 3300046454 | Bacteria | 23301 |
| 154 | Ga0495592_0006080 | 3300046454 | Bacteria | 8969 |
| 155 | Ga0495592_0028589 | 3300046454 | Bacteria | 4221 |
| 156 | Ga0495592_0214993 | 3300046454 | Bacteria | 1289 |
| 157 | Ga0495603_0094245 | 3300046455 | Bacteria | 1749 |
| 158 | Ga0495629_0001171 | 3300046459 | Bacteria | 20704 |
| 159 | Ga0495629_0007376 | 3300046459 | Bacteria | 8107 |
| 160 | Ga0495629_0069015 | 3300046459 | Bacteria | 2466 |
| 161 | Ga0495638_0009160 | 3300046460 | Bacteria | 6963 |
| 162 | Ga0495641_0016337 | 3300046461 | Bacteria | 3914 |
| 163 | Ga0495651_0006358 | 3300046462 | Bacteria | 9039 |
| 164 | Ga0495651_0083267 | 3300046462 | Bacteria | 2412 |
| 165 | Ga0495651_0085485 | 3300046462 | Bacteria | 2375 |
| 166 | Ga0495653_0020680 | 3300046463 | Bacteria | 5331 |
| 167 | Ga0495653_0135539 | 3300046463 | Bacteria | 1737 |
| 168 | Ga0495580_0076616 | 3300046472 | Bacteria | 2332 |
| 169 | Ga0495582_0019865 | 3300046473 | Bacteria | 3674 |
| 170 | Ga0495582_0045562 | 3300046473 | Bacteria | 2415 |
| 171 | Ga0495639_0052530 | 3300046475 | Bacteria | 1855 |
| 172 | Ga0495664_0022203 | 3300046477 | Bacteria | 3675 |
| 173 | Ga0495664_0054208 | 3300046477 | Bacteria | 2384 |
| 174 | Ga0495584_0078546 | 3300046491 | Bacteria | 1661 |
| 175 | Ga0495608_0000921 | 3300046511 | Bacteria | 20621 |
| 176 | Ga0495608_0035126 | 3300046511 | Bacteria | 3382 |
| 177 | Ga0495628_0037221 | 3300046516 | Bacteria | 3901 |
| 178 | Ga0495630_0054687 | 3300046517 | Bacteria | 2990 |
| 179 | Ga0495630_0067779 | 3300046517 | Bacteria | 2682 |
| 180 | Ga0495652_0013119 | 3300046529 | Bacteria | 7461 |
| 181 | Ga0495652_0022915 | 3300046529 | Bacteria | 5539 |
| 182 | Ga0495652_0134280 | 3300046529 | Bacteria | 1954 |
| 183 | Ga0495640_0122553 | 3300046533 | Bacteria | 1688 |
| 184 | Ga0495640_0146088 | 3300046533 | Bacteria | 1521 |
| 185 | Ga0495587_0004018 | 3300046536 | Bacteria | 9748 |
| 186 | Ga0495667_0007861 | 3300046559 | Bacteria | 7226 |
| 187 | Ga0495667_0027431 | 3300046559 | Bacteria | 3837 |
| 188 | Ga0495634_0040260 | 3300046642 | Bacteria | 3179 |
| 189 | Ga0495634_0080005 | 3300046642 | Bacteria | 2139 |
| 190 | Ga0495634_0123501 | 3300046642 | Bacteria | 1656 |
| 191 | Ga0495635_0036387 | 3300046663 | Bacteria | 3412 |
| 192 | Ga0495635_0043124 | 3300046663 | Bacteria | 3113 |
| 193 | Ga0495657_0004554 | 3300046675 | Bacteria | 11078 |
| 194 | Ga0495657_0057814 | 3300046675 | Bacteria | 2577 |
| 195 | Ga0495657_0068343 | 3300046675 | Bacteria | 2328 |
| 196 | Ga0495599_0009351 | 3300046678 | Bacteria | 5987 |
| 197 | Ga0495599_0038739 | 3300046678 | Bacteria | 2995 |
| 198 | Ga0495623_0029843 | 3300046679 | Bacteria | 3509 |
| 199 | Ga0495646_0082271 | 3300046680 | Bacteria | 1873 |
| 200 | Ga0495658_0007648 | 3300046683 | Bacteria | 5357 |
| 201 | Ga0495613_0032541 | 3300046689 | Bacteria | 3874 |
| 202 | Ga0495613_0201836 | 3300046689 | Bacteria | 1402 |
| 203 | Ga0495600_0000750 | 3300046809 | Bacteria | 17105 |
| 204 | Ga0495600_0031839 | 3300046809 | Bacteria | 3419 |
| 205 | Ga0495600_0039153 | 3300046809 | Bacteria | 3087 |
| 206 | Ga0495600_0041569 | 3300046809 | Bacteria | 2996 |
| 207 | Ga0495581_0016452 | 3300047315 | Bacteria | 4299 |
| 208 | Ga0495604_0003228 | 3300047317 | Bacteria | 13034 |
| 209 | Ga0495674_0005457 | 3300047319 | Bacteria | 12218 |
| 210 | Ga0495674_0090624 | 3300047319 | Bacteria | 2612 |
| 211 | Ga0495676_0017028 | 3300047321 | Bacteria | 6433 |
| 212 | Ga0495680_0009909 | 3300047322 | Bacteria | 8541 |
| 213 | Ga0495680_0010921 | 3300047322 | Bacteria | 8068 |
| 214 | Ga0495680_0015301 | 3300047322 | Bacteria | 6619 |
| 215 | Ga0495680_0024512 | 3300047322 | Bacteria | 5004 |
| 216 | Ga0495680_0048043 | 3300047322 | Bacteria | 3353 |
| 217 | Ga0495675_0002709 | 3300047444 | Bacteria | 10614 |
| 218 | Ga0495675_0026238 | 3300047444 | Bacteria | 3715 |
| 219 | Ga0495684_0000104 | 3300047471 | Bacteria | 59909 |
| 220 | Ga0495684_0002271 | 3300047471 | Bacteria | 15407 |
| 221 | Ga0495684_0008921 | 3300047471 | Bacteria | 7747 |
| 222 | Ga0495684_0018222 | 3300047471 | Bacteria | 5412 |
| 223 | Ga0495602_0021846 | 3300048088 | Bacteria | 6282 |
| 224 | Ga0495602_0116946 | 3300048088 | Bacteria | 2153 |
| 225 | Ga0496102_0136380 | 3300048905 | Bacteria | 2300 |
| 226 | Ga0496104_0106907 | 3300048907 | Bacteria | 2681 |
| 227 | Ga0496104_0371659 | 3300048907 | Unclassified | 1342 |
| 228 | Ga0496108_0035326 | 3300048911 | Bacteria | 4154 |
| 229 | Ga0496110_0040432 | 3300048913 | Bacteria | 4064 |
| 230 | Ga0496110_0087546 | 3300048913 | Bacteria | 2782 |
| 231 | Ga0496112_0209492 | 3300048915 | Bacteria | 1907 |
| 232 | Ga0496113_0075375 | 3300048916 | Bacteria | 2575 |
| 233 | Ga0496113_0190827 | 3300048916 | Bacteria | 1626 |
| 234 | Ga0496116_0000190 | 3300048919 | Bacteria | 122544 |
| 235 | Ga0496116_0031515 | 3300048919 | Bacteria | 3794 |
| 236 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 237 | Ga0496117_0004705 | 3300048920 | Bacteria | 14819 |
| 238 | Ga0496117_0014726 | 3300048920 | Bacteria | 6716 |
| 239 | Ga0496117_0015568 | 3300048920 | Bacteria | 6473 |
| 240 | Ga0496118_0000734 | 3300048921 | Bacteria | 52990 |
| 241 | Ga0496118_0014089 | 3300048921 | Bacteria | 7502 |
| 242 | Ga0496118_0015761 | 3300048921 | Bacteria | 6975 |
| 243 | Ga0496119_0004695 | 3300048922 | Bacteria | 13445 |
| 244 | Ga0496119_0105565 | 3300048922 | Bacteria | 1573 |
| 245 | Ga0496120_0002211 | 3300048923 | Bacteria | 20521 |
| 246 | Ga0496120_0006237 | 3300048923 | Bacteria | 9212 |
| 247 | Ga0496121_0000015 | 3300048924 | Bacteria | 571958 |
| 248 | Ga0496121_0123680 | 3300048924 | Bacteria | 1949 |
| 249 | Ga0496122_0000111 | 3300048925 | Bacteria | 189920 |
| 250 | Ga0496122_0007603 | 3300048925 | Bacteria | 11977 |
| 251 | Ga0496122_0029084 | 3300048925 | Bacteria | 4671 |
| 252 | Ga0496123_0000006 | 3300048926 | Bacteria | 647258 |
| 253 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 254 | Ga0496123_0087986 | 3300048926 | Bacteria | 1856 |
| 255 | Ga0496124_0001161 | 3300048927 | Bacteria | 41252 |
| 256 | Ga0496124_0003438 | 3300048927 | Bacteria | 19387 |
| 257 | Ga0496125_0004248 | 3300048928 | Bacteria | 16693 |
| 258 | Ga0496125_0022922 | 3300048928 | Bacteria | 5784 |
| 259 | Ga0496125_0180614 | 3300048928 | Bacteria | 1406 |
| 260 | Ga0496126_0000040 | 3300048929 | Bacteria | 345144 |
| 261 | Ga0496126_0000436 | 3300048929 | Bacteria | 83469 |
| 262 | Ga0496126_0005549 | 3300048929 | Bacteria | 14349 |
| 263 | Ga0496126_0027334 | 3300048929 | Bacteria | 5451 |
| 264 | Ga0496126_0147955 | 3300048929 | Bacteria | 2015 |
| 265 | Ga0501038_0076832 | 3300049574 | Bacteria | 2821 |
| 266 | Ga0501039_0110999 | 3300049575 | Bacteria | 2144 |
| 267 | Ga0501046_0011197 | 3300049580 | Bacteria | 7683 |
| 268 | Ga0501047_0003643 | 3300049581 | Bacteria | 14515 |
| 269 | Ga0501047_0190022 | 3300049581 | Bacteria | 1917 |
| 270 | Ga0501068_0156242 | 3300049584 | Bacteria | 1436 |
| 271 | Ga0501070_0056075 | 3300049586 | Bacteria | 3266 |
| 272 | Ga0501070_0059779 | 3300049586 | Bacteria | 3159 |
| 273 | Ga0501070_0335296 | 3300049586 | Bacteria | 1229 |
| 274 | Ga0501073_0087629 | 3300049589 | Bacteria | 2165 |
| 275 | Ga0501074_0041256 | 3300049590 | Bacteria | 3342 |
| 276 | Ga0501080_0097047 | 3300049742 | Bacteria | 2736 |
| 277 | Ga0501035_0196379 | 3300049822 | Bacteria | 1733 |
| 278 | nmdc:mga00v17_72506_c1 | 3300050491 | Bacteria | 2137 |
| 279 | nmdc:mga08y16_113430_c1 | 3300050511 | Bacteria | 2821 |
| 280 | nmdc:mga0rr50_112919_c1 | 3300050513 | Bacteria | 2152 |
| 281 | nmdc:mga0a205_156807_c1 | 3300050515 | Bacteria | 2175 |
| 282 | Ga0495601_0014775 | 3300053077 | Bacteria | 4711 |
| 283 | Ga0495601_0137935 | 3300053077 | Bacteria | 1590 |
| 284 | Ga0495612_0049901 | 3300053078 | Bacteria | 1717 |
| 285 | Ga0495612_0071950 | 3300053078 | Bacteria | 1443 |
| 286 | Ga0495595_0002348 | 3300053084 | Bacteria | 7372 |
| 287 | Ga0495595_0004285 | 3300053084 | Bacteria | 5739 |
| 288 | Ga0495619_0000727 | 3300053085 | Bacteria | 21527 |
| 289 | Ga0495619_0048162 | 3300053085 | Bacteria | 2808 |
| 290 | Ga0500556_0002927 | 3300053104 | Bacteria | 5165 |
| 291 | Ga0500562_009410 | 3300053108 | Bacteria | 2470 |
| 292 | Ga0500655_008264 | 3300053133 | Bacteria | 1873 |
| 293 | Ga0500616_0045445 | 3300053153 | Bacteria | 2340 |
| 294 | Ga0500633_0016081 | 3300053160 | Bacteria | 2163 |
| 295 | Ga0587072_000638 | 3300059643 | Bacteria | 3730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046559 | Ga0495667_0027431 | Ga0495667_0027431_2798_3820 | 316 |
| 2 | 3300048907 | Ga0496104_0371659 | Ga0496104_0371659_203_1294 | 349 |
| 3 | 3300025907 | Ga0207645_10054063 | Ga0207645_100540631 | 358 |
| 4 | 3300049586 | Ga0501070_0335296 | Ga0501070_0335296_17_1138 | 360 |
| 5 | iso_pu_bacteria | 8056207758 | 8056210171 | 364 |
| 6 | 3300005983 | Ga0081540_1001522 | Ga0081540_10015225 | 368 |
| 7 | 3300006914 | Ga0075436_100021238 | Ga0075436_1000212385 | 369 |
| 8 | 3300007076 | Ga0075435_100046925 | Ga0075435_1000469253 | 369 |
| 9 | 3300009094 | Ga0111539_10062415 | Ga0111539_100624154 | 369 |
| 10 | 3300009147 | Ga0114129_10032676 | Ga0114129_100326764 | 369 |
| 11 | 3300025922 | Ga0207646_10257538 | Ga0207646_102575382 | 369 |
| 12 | 3300027907 | Ga0207428_10051544 | Ga0207428_100515442 | 369 |
| 13 | 3300035118 | Ga0373954_0004156 | Ga0373954_0004156_3926_5164 | 369 |
| 14 | 3300035120 | Ga0373957_0009869 | Ga0373957_0009869_1270_2508 | 369 |
| 15 | 3300035171 | Ga0373946_0060108 | Ga0373946_0060108_173_1411 | 369 |
| 16 | 3300035695 | Ga0373927_0156715 | Ga0373927_0156715_216_1454 | 369 |
| 17 | 3300037068 | Ga0373925_0129338 | Ga0373925_0129338_326_1564 | 369 |
| 18 | 3300037068 | Ga0373925_0137301 | Ga0373925_0137301_545_1783 | 369 |
| 19 | 3300046454 | Ga0495592_0028589 | Ga0495592_0028589_2652_3890 | 369 |
| 20 | 3300046459 | Ga0495629_0007376 | Ga0495629_0007376_3638_4876 | 369 |
| 21 | 3300046459 | Ga0495629_0069015 | Ga0495629_0069015_303_1541 | 369 |
| 22 | 3300046462 | Ga0495651_0083267 | Ga0495651_0083267_129_1367 | 369 |
| 23 | 3300046463 | Ga0495653_0135539 | Ga0495653_0135539_109_1347 | 369 |
| 24 | 3300046472 | Ga0495580_0076616 | Ga0495580_0076616_939_2177 | 369 |
| 25 | 3300046473 | Ga0495582_0019865 | Ga0495582_0019865_1967_3205 | 369 |
| 26 | 3300046473 | Ga0495582_0045562 | Ga0495582_0045562_1030_2268 | 369 |
| 27 | 3300046475 | Ga0495639_0052530 | Ga0495639_0052530_411_1649 | 369 |
| 28 | 3300046511 | Ga0495608_0035126 | Ga0495608_0035126_1674_2912 | 369 |
| 29 | 3300046516 | Ga0495628_0037221 | Ga0495628_0037221_2241_3479 | 369 |
| 30 | 3300046517 | Ga0495630_0067779 | Ga0495630_0067779_257_1495 | 369 |
| 31 | 3300046529 | Ga0495652_0134280 | Ga0495652_0134280_374_1612 | 369 |
| 32 | 3300046533 | Ga0495640_0122553 | Ga0495640_0122553_116_1354 | 369 |
| 33 | 3300046642 | Ga0495634_0123501 | Ga0495634_0123501_303_1541 | 369 |
| 34 | 3300046663 | Ga0495635_0036387 | Ga0495635_0036387_124_1362 | 369 |
| 35 | 3300046675 | Ga0495657_0057814 | Ga0495657_0057814_1046_2284 | 369 |
| 36 | 3300046678 | Ga0495599_0038739 | Ga0495599_0038739_1040_2278 | 369 |
| 37 | 3300046680 | Ga0495646_0082271 | Ga0495646_0082271_262_1500 | 369 |
| 38 | 3300046683 | Ga0495658_0007648 | Ga0495658_0007648_361_1599 | 369 |
| 39 | 3300046689 | Ga0495613_0032541 | Ga0495613_0032541_1176_2414 | 369 |
| 40 | 3300046689 | Ga0495613_0201836 | Ga0495613_0201836_31_1269 | 369 |
| 41 | 3300047315 | Ga0495581_0016452 | Ga0495581_0016452_237_1475 | 369 |
| 42 | 3300047322 | Ga0495680_0015301 | Ga0495680_0015301_238_1476 | 369 |
| 43 | 3300047444 | Ga0495675_0026238 | Ga0495675_0026238_944_2182 | 369 |
| 44 | 3300047471 | Ga0495684_0018222 | Ga0495684_0018222_3545_4783 | 369 |
| 45 | 3300048088 | Ga0495602_0116946 | Ga0495602_0116946_374_1612 | 369 |
| 46 | 3300050511 | nmdc:mga08y16_113430_c1 | nmdc:mga08y16_113430_c1_402_1640 | 369 |
| 47 | 3300050515 | nmdc:mga0a205_156807_c1 | nmdc:mga0a205_156807_c1_834_2072 | 369 |
| 48 | 3300053077 | Ga0495601_0137935 | Ga0495601_0137935_191_1429 | 369 |
| 49 | 3300053078 | Ga0495612_0049901 | Ga0495612_0049901_460_1698 | 369 |
| 50 | 3300053085 | Ga0495619_0048162 | Ga0495619_0048162_581_1819 | 369 |
| 51 | 3300005439 | Ga0070711_100113994 | Ga0070711_1001139942 | 371 |
| 52 | 3300048920 | Ga0496117_0014726 | Ga0496117_0014726_832_2079 | 377 |
| 53 | 3300048921 | Ga0496118_0015761 | Ga0496118_0015761_3258_4505 | 377 |
| 54 | 3300048925 | Ga0496122_0007603 | Ga0496122_0007603_9130_10377 | 377 |
| 55 | 3300048926 | Ga0496123_0000009 | Ga0496123_0000009_39030_40277 | 377 |
| 56 | 3300048927 | Ga0496124_0001161 | Ga0496124_0001161_9315_10562 | 377 |
| 57 | 3300048928 | Ga0496125_0022922 | Ga0496125_0022922_1335_2582 | 377 |
| 58 | 3300005445 | Ga0070708_100009605 | Ga0070708_1000096053 | 379 |
| 59 | 3300005445 | Ga0070708_100127141 | Ga0070708_1001271412 | 379 |
| 60 | 3300025898 | Ga0207692_10051172 | Ga0207692_100511722 | 379 |
| 61 | 3300046491 | Ga0495584_0078546 | Ga0495584_0078546_244_1434 | 379 |
| 62 | iso_pu_bacteria | 2773857933 | 2774901803 | 381 |
| 63 | 3300005435 | Ga0070714_100035896 | Ga0070714_1000358963 | 382 |
| 64 | 3300025929 | Ga0207664_10096486 | Ga0207664_100964862 | 382 |
| 65 | 3300030732 | Ga0316176_1169744 | Ga0316176_11697443 | 382 |
| 66 | 3300030733 | Ga0314311_1144588 | Ga0314311_11445884 | 382 |
| 67 | 3300033179 | Ga0307507_10009914 | Ga0307507_1000991411 | 382 |
| 68 | iso_pu_bacteria | 8047710418 | 8047716383 | 382 |
| 69 | 3300046809 | Ga0495600_0031839 | Ga0495600_0031839_837_2075 | 383 |
| 70 | 3300005458 | Ga0070681_10047761 | Ga0070681_100477612 | 384 |
| 71 | 3300039437 | Ga0436365_1507128 | Ga0436365_1507128_469_1692 | 384 |
| 72 | 3300039453 | Ga0436362_0560646 | Ga0436362_0560646_1028_2251 | 384 |
| 73 | 3300048919 | Ga0496116_0031515 | Ga0496116_0031515_1658_2905 | 384 |
| 74 | 3300048920 | Ga0496117_0000028 | Ga0496117_0000028_237838_239085 | 384 |
| 75 | 3300048920 | Ga0496117_0015568 | Ga0496117_0015568_1166_2413 | 384 |
| 76 | 3300048921 | Ga0496118_0014089 | Ga0496118_0014089_4591_5838 | 384 |
| 77 | 3300048922 | Ga0496119_0004695 | Ga0496119_0004695_1674_2921 | 384 |
| 78 | 3300048922 | Ga0496119_0105565 | Ga0496119_0105565_48_1295 | 384 |
| 79 | 3300048923 | Ga0496120_0002211 | Ga0496120_0002211_17611_18858 | 384 |
| 80 | 3300048923 | Ga0496120_0006237 | Ga0496120_0006237_7374_8621 | 384 |
| 81 | 3300048925 | Ga0496122_0000111 | Ga0496122_0000111_77905_79152 | 384 |
| 82 | 3300048925 | Ga0496122_0029084 | Ga0496122_0029084_297_1544 | 384 |
| 83 | 3300048926 | Ga0496123_0000006 | Ga0496123_0000006_77762_79009 | 384 |
| 84 | 3300048926 | Ga0496123_0087986 | Ga0496123_0087986_72_1319 | 384 |
| 85 | 3300048927 | Ga0496124_0003438 | Ga0496124_0003438_17643_18890 | 384 |
| 86 | 3300048928 | Ga0496125_0004248 | Ga0496125_0004248_4922_6169 | 384 |
| 87 | 3300048928 | Ga0496125_0180614 | Ga0496125_0180614_99_1346 | 384 |
| 88 | 3300048929 | Ga0496126_0000436 | Ga0496126_0000436_60_1307 | 384 |
| 89 | 3300048929 | Ga0496126_0005549 | Ga0496126_0005549_2943_4187 | 384 |
| 90 | iso_pu_bacteria | 2513237098 | 2513677284 | 384 |
| 91 | iso_pu_bacteria | 2757320536 | 2758224361 | 384 |
| 92 | 3300005468 | Ga0070707_100012901 | Ga0070707_1000129016 | 385 |
| 93 | 3300005614 | Ga0068856_100328657 | Ga0068856_1003286571 | 385 |
| 94 | 3300005842 | Ga0068858_100026189 | Ga0068858_1000261892 | 385 |
| 95 | 3300009098 | Ga0105245_10102140 | Ga0105245_101021402 | 385 |
| 96 | 3300009177 | Ga0105248_10138350 | Ga0105248_101383502 | 385 |
| 97 | 3300009545 | Ga0105237_10209350 | Ga0105237_102093502 | 385 |
| 98 | 3300010375 | Ga0105239_10144015 | Ga0105239_101440151 | 385 |
| 99 | 3300013105 | Ga0157369_10351513 | Ga0157369_103515131 | 385 |
| 100 | 3300013306 | Ga0163162_10047604 | Ga0163162_100476043 | 385 |
| 101 | 3300013308 | Ga0157375_10128739 | Ga0157375_101287392 | 385 |
| 102 | 3300014969 | Ga0157376_10088316 | Ga0157376_100883162 | 385 |
| 103 | 3300025898 | Ga0207692_10092644 | Ga0207692_100926441 | 385 |
| 104 | 3300025917 | Ga0207660_10150597 | Ga0207660_101505972 | 385 |
| 105 | 3300025922 | Ga0207646_10068906 | Ga0207646_100689061 | 385 |
| 106 | 3300025928 | Ga0207700_10079674 | Ga0207700_100796742 | 385 |
| 107 | 3300035083 | Ga0373926_0000968 | Ga0373926_0000968_1058_2302 | 385 |
| 108 | 3300035089 | Ga0373944_0001498 | Ga0373944_0001498_3191_4435 | 385 |
| 109 | 3300035090 | Ga0373949_0005849 | Ga0373949_0005849_1345_2583 | 385 |
| 110 | 3300035111 | Ga0373923_0003251 | Ga0373923_0003251_803_2047 | 385 |
| 111 | 3300035116 | Ga0373945_0007470 | Ga0373945_0007470_363_1607 | 385 |
| 112 | 3300035117 | Ga0373953_0044144 | Ga0373953_0044144_17_1264 | 385 |
| 113 | 3300035170 | Ga0373943_0003163 | Ga0373943_0003163_1045_2289 | 385 |
| 114 | 3300035171 | Ga0373946_0000689 | Ga0373946_0000689_7888_9132 | 385 |
| 115 | 3300035410 | Ga0373924_0020322 | Ga0373924_0020322_366_1610 | 385 |
| 116 | 3300035692 | Ga0373935_0000080 | Ga0373935_0000080_700_1944 | 385 |
| 117 | 3300035695 | Ga0373927_0003721 | Ga0373927_0003721_7359_8603 | 385 |
| 118 | 3300035725 | Ga0373947_0036403 | Ga0373947_0036403_1225_2469 | 385 |
| 119 | 3300035725 | Ga0373947_0057069 | Ga0373947_0057069_649_1893 | 385 |
| 120 | 3300037068 | Ga0373925_0004002 | Ga0373925_0004002_5007_6251 | 385 |
| 121 | 3300037853 | Ga0436364_0239060 | Ga0436364_0239060_1334_2581 | 385 |
| 122 | 3300039437 | Ga0436365_0144819 | Ga0436365_0144819_258_1508 | 385 |
| 123 | 3300039437 | Ga0436365_0226807 | Ga0436365_0226807_845_2104 | 385 |
| 124 | 3300045976 | Ga0466967_0126047 | Ga0466967_0126047_105_1325 | 385 |
| 125 | 3300046454 | Ga0495592_0006080 | Ga0495592_0006080_1893_3140 | 385 |
| 126 | 3300046455 | Ga0495603_0094245 | Ga0495603_0094245_41_1285 | 385 |
| 127 | 3300046461 | Ga0495641_0016337 | Ga0495641_0016337_1022_2266 | 385 |
| 128 | 3300046462 | Ga0495651_0006358 | Ga0495651_0006358_893_2140 | 385 |
| 129 | 3300046463 | Ga0495653_0020680 | Ga0495653_0020680_1469_2716 | 385 |
| 130 | 3300046477 | Ga0495664_0022203 | Ga0495664_0022203_949_2193 | 385 |
| 131 | 3300046477 | Ga0495664_0054208 | Ga0495664_0054208_627_1871 | 385 |
| 132 | 3300046517 | Ga0495630_0054687 | Ga0495630_0054687_971_2233 | 385 |
| 133 | 3300046529 | Ga0495652_0013119 | Ga0495652_0013119_2947_4194 | 385 |
| 134 | 3300046642 | Ga0495634_0040260 | Ga0495634_0040260_478_1722 | 385 |
| 135 | 3300046642 | Ga0495634_0080005 | Ga0495634_0080005_361_1608 | 385 |
| 136 | 3300046675 | Ga0495657_0068343 | Ga0495657_0068343_697_1959 | 385 |
| 137 | 3300046679 | Ga0495623_0029843 | Ga0495623_0029843_728_1975 | 385 |
| 138 | 3300046809 | Ga0495600_0041569 | Ga0495600_0041569_1009_2256 | 385 |
| 139 | 3300047317 | Ga0495604_0003228 | Ga0495604_0003228_5645_6892 | 385 |
| 140 | 3300047321 | Ga0495676_0017028 | Ga0495676_0017028_4347_5591 | 385 |
| 141 | 3300047322 | Ga0495680_0010921 | Ga0495680_0010921_726_1973 | 385 |
| 142 | 3300047322 | Ga0495680_0048043 | Ga0495680_0048043_1745_2989 | 385 |
| 143 | 3300047471 | Ga0495684_0002271 | Ga0495684_0002271_6791_8038 | 385 |
| 144 | 3300047471 | Ga0495684_0008921 | Ga0495684_0008921_253_1515 | 385 |
| 145 | 3300048907 | Ga0496104_0106907 | Ga0496104_0106907_1266_2510 | 385 |
| 146 | 3300048911 | Ga0496108_0035326 | Ga0496108_0035326_2462_3706 | 385 |
| 147 | 3300048913 | Ga0496110_0040432 | Ga0496110_0040432_1562_2806 | 385 |
| 148 | 3300048915 | Ga0496112_0209492 | Ga0496112_0209492_477_1721 | 385 |
| 149 | 3300048916 | Ga0496113_0190827 | Ga0496113_0190827_57_1301 | 385 |
| 150 | 3300048924 | Ga0496121_0000015 | Ga0496121_0000015_382834_384084 | 385 |
| 151 | 3300048929 | Ga0496126_0000040 | Ga0496126_0000040_264917_266134 | 385 |
| 152 | 3300050513 | nmdc:mga0rr50_112919_c1 | nmdc:mga0rr50_112919_c1_729_1973 | 385 |
| 153 | 3300053077 | Ga0495601_0014775 | Ga0495601_0014775_1468_2715 | 385 |
| 154 | 3300053078 | Ga0495612_0071950 | Ga0495612_0071950_124_1371 | 385 |
| 155 | 3300053084 | Ga0495595_0004285 | Ga0495595_0004285_3397_4644 | 385 |
| 156 | 3300059643 | Ga0587072_000638 | Ga0587072_000638_946_2202 | 385 |
| 157 | iso_pu_bacteria | 8055037949 | 8055040261 | 385 |
| 158 | 3300028379 | Ga0268266_10001761 | Ga0268266_1000176111 | 386 |
| 159 | 3300028573 | Ga0265334_10009739 | Ga0265334_100097392 | 386 |
| 160 | 3300046454 | Ga0495592_0214993 | Ga0495592_0214993_38_1276 | 386 |
| 161 | 3300046462 | Ga0495651_0085485 | Ga0495651_0085485_83_1339 | 386 |
| 162 | 3300046663 | Ga0495635_0043124 | Ga0495635_0043124_1342_2598 | 386 |
| 163 | 3300046809 | Ga0495600_0039153 | Ga0495600_0039153_1664_2920 | 386 |
| 164 | 3300047319 | Ga0495674_0090624 | Ga0495674_0090624_411_1649 | 386 |
| 165 | 3300047322 | Ga0495680_0024512 | Ga0495680_0024512_3041_4297 | 386 |
| 166 | 3300048905 | Ga0496102_0136380 | Ga0496102_0136380_291_1562 | 386 |
| 167 | 3300048919 | Ga0496116_0000190 | Ga0496116_0000190_2842_4113 | 386 |
| 168 | 3300048920 | Ga0496117_0004705 | Ga0496117_0004705_1396_2667 | 386 |
| 169 | 3300048921 | Ga0496118_0000734 | Ga0496118_0000734_48920_50191 | 386 |
| 170 | iso_pu_bacteria | 2517572101 | 2517763279 | 386 |
| 171 | iso_pu_bacteria | 8002784119 | 8002787425 | 386 |
| 172 | 3300035090 | Ga0373949_0000130 | Ga0373949_0000130_23777_24976 | 387 |
| 173 | 3300005471 | Ga0070698_100005127 | Ga0070698_10000512711 | 388 |
| 174 | 3300005616 | Ga0068852_100212967 | Ga0068852_1002129672 | 388 |
| 175 | 3300005617 | Ga0068859_100000043 | Ga0068859_10000004342 | 388 |
| 176 | 3300005844 | Ga0068862_100000037 | Ga0068862_10000003732 | 388 |
| 177 | 3300006051 | Ga0075364_10092014 | Ga0075364_100920142 | 388 |
| 178 | 3300006931 | Ga0097620_100000043 | Ga0097620_10000004392 | 388 |
| 179 | 3300014325 | Ga0163163_10011103 | Ga0163163_100111031 | 388 |
| 180 | 3300025910 | Ga0207684_10318107 | Ga0207684_103181072 | 388 |
| 181 | 3300028380 | Ga0268265_10000008 | Ga0268265_10000008295 | 388 |
| 182 | 3300049586 | Ga0501070_0056075 | Ga0501070_0056075_1081_2283 | 388 |
| 183 | 3300050491 | nmdc:mga00v17_72506_c1 | nmdc:mga00v17_72506_c1_565_1836 | 388 |
| 184 | iso_pu_bacteria | 2508501039 | 2508674321 | 388 |
| 185 | iso_pu_bacteria | 2671180195 | 2671836946 | 388 |
| 186 | iso_pu_bacteria | 2675902999 | 2676199239 | 388 |
| 187 | iso_pu_bacteria | 2687453737 | 2689957651 | 388 |
| 188 | iso_pu_bacteria | 2773857921 | 2774843817 | 388 |
| 189 | iso_pu_bacteria | 2773857922 | 2774855102 | 388 |
| 190 | iso_pu_bacteria | 8002775197 | 8002776460 | 388 |
| 191 | iso_pu_bacteria | 2915358134 | 2915363295 | 389 |
| 192 | 3300005262 | Ga0065165_1000348 | Ga0065165_100034823 | 393 |
| 193 | 3300005262 | Ga0065165_1004345 | Ga0065165_10043451 | 393 |
| 194 | 3300006028 | Ga0070717_10106707 | Ga0070717_101067072 | 393 |
| 195 | 3300006942 | Ga0099824_1013698 | Ga0099824_10136987 | 393 |
| 196 | 3300006943 | Ga0099822_1016891 | Ga0099822_10168914 | 393 |
| 197 | 3300013104 | Ga0157370_10054448 | Ga0157370_100544483 | 393 |
| 198 | 3300013105 | Ga0157369_10001394 | Ga0157369_1000139416 | 393 |
| 199 | 3300025299 | Ga0209256_1004731 | Ga0209256_10047313 | 393 |
| 200 | 3300025910 | Ga0207684_10029666 | Ga0207684_100296661 | 393 |
| 201 | 3300025913 | Ga0207695_10046758 | Ga0207695_100467585 | 393 |
| 202 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001366 | 393 |
| 203 | 3300027361 | Ga0209489_100001 | Ga0209489_100001366 | 393 |
| 204 | 3300027363 | Ga0209700_100001 | Ga0209700_100001366 | 393 |
| 205 | 3300031235 | Ga0265330_10002892 | Ga0265330_100028928 | 393 |
| 206 | 3300031235 | Ga0265330_10002983 | Ga0265330_100029834 | 393 |
| 207 | 3300031238 | Ga0265332_10013493 | Ga0265332_100134932 | 393 |
| 208 | 3300031247 | Ga0265340_10009123 | Ga0265340_100091233 | 393 |
| 209 | 3300031344 | Ga0265316_10026828 | Ga0265316_100268283 | 393 |
| 210 | 3300031616 | Ga0307508_10056650 | Ga0307508_100566502 | 393 |
| 211 | 3300031712 | Ga0265342_10013148 | Ga0265342_100131482 | 393 |
| 212 | 3300033180 | Ga0307510_10067943 | Ga0307510_100679432 | 393 |
| 213 | 3300035111 | Ga0373923_0004090 | Ga0373923_0004090_2550_3785 | 393 |
| 214 | 3300035117 | Ga0373953_0000253 | Ga0373953_0000253_12058_13293 | 393 |
| 215 | 3300035118 | Ga0373954_0000158 | Ga0373954_0000158_18031_19266 | 393 |
| 216 | 3300035119 | Ga0373956_0002522 | Ga0373956_0002522_4405_5640 | 393 |
| 217 | 3300035120 | Ga0373957_0000195 | Ga0373957_0000195_2627_3862 | 393 |
| 218 | 3300035410 | Ga0373924_0002631 | Ga0373924_0002631_3936_5171 | 393 |
| 219 | 3300035724 | Ga0373933_0000601 | Ga0373933_0000601_16674_17909 | 393 |
| 220 | 3300036401 | Ga0373937_0007563 | Ga0373937_0007563_5201_6436 | 393 |
| 221 | 3300037466 | Ga0395898_0039026 | Ga0395898_0039026_745_1986 | 393 |
| 222 | 3300037466 | Ga0395898_0071071 | Ga0395898_0071071_1129_2364 | 393 |
| 223 | 3300038443 | Ga0395901_0086721 | Ga0395901_0086721_59_1294 | 393 |
| 224 | 3300039447 | Ga0436361_0987735 | Ga0436361_0987735_2398_3633 | 393 |
| 225 | 3300045049 | Ga0466959_0016591 | Ga0466959_0016591_76_1311 | 393 |
| 226 | 3300046454 | Ga0495592_0000710 | Ga0495592_0000710_13371_14606 | 393 |
| 227 | 3300046459 | Ga0495629_0001171 | Ga0495629_0001171_5222_6457 | 393 |
| 228 | 3300046460 | Ga0495638_0009160 | Ga0495638_0009160_4306_5541 | 393 |
| 229 | 3300046511 | Ga0495608_0000921 | Ga0495608_0000921_18131_19366 | 393 |
| 230 | 3300046529 | Ga0495652_0022915 | Ga0495652_0022915_904_2139 | 393 |
| 231 | 3300046533 | Ga0495640_0146088 | Ga0495640_0146088_39_1274 | 393 |
| 232 | 3300046536 | Ga0495587_0004018 | Ga0495587_0004018_5201_6436 | 393 |
| 233 | 3300046559 | Ga0495667_0007861 | Ga0495667_0007861_3401_4636 | 393 |
| 234 | 3300046675 | Ga0495657_0004554 | Ga0495657_0004554_4515_5750 | 393 |
| 235 | 3300046678 | Ga0495599_0009351 | Ga0495599_0009351_428_1663 | 393 |
| 236 | 3300046809 | Ga0495600_0000750 | Ga0495600_0000750_2628_3863 | 393 |
| 237 | 3300047319 | Ga0495674_0005457 | Ga0495674_0005457_10091_11326 | 393 |
| 238 | 3300047322 | Ga0495680_0009909 | Ga0495680_0009909_3023_4258 | 393 |
| 239 | 3300047444 | Ga0495675_0002709 | Ga0495675_0002709_37_1272 | 393 |
| 240 | 3300047471 | Ga0495684_0000104 | Ga0495684_0000104_35936_37171 | 393 |
| 241 | 3300048088 | Ga0495602_0021846 | Ga0495602_0021846_4620_5855 | 393 |
| 242 | 3300048924 | Ga0496121_0123680 | Ga0496121_0123680_594_1868 | 393 |
| 243 | 3300048929 | Ga0496126_0027334 | Ga0496126_0027334_2317_3552 | 393 |
| 244 | 3300048929 | Ga0496126_0147955 | Ga0496126_0147955_330_1604 | 393 |
| 245 | 3300049574 | Ga0501038_0076832 | Ga0501038_0076832_114_1355 | 393 |
| 246 | 3300049575 | Ga0501039_0110999 | Ga0501039_0110999_414_1655 | 393 |
| 247 | 3300049580 | Ga0501046_0011197 | Ga0501046_0011197_5180_6415 | 393 |
| 248 | 3300049581 | Ga0501047_0003643 | Ga0501047_0003643_12495_13730 | 393 |
| 249 | 3300049581 | Ga0501047_0190022 | Ga0501047_0190022_417_1658 | 393 |
| 250 | 3300049584 | Ga0501068_0156242 | Ga0501068_0156242_78_1319 | 393 |
| 251 | 3300049586 | Ga0501070_0059779 | Ga0501070_0059779_595_1830 | 393 |
| 252 | 3300049589 | Ga0501073_0087629 | Ga0501073_0087629_720_1955 | 393 |
| 253 | 3300049590 | Ga0501074_0041256 | Ga0501074_0041256_1253_2494 | 393 |
| 254 | 3300049742 | Ga0501080_0097047 | Ga0501080_0097047_1384_2619 | 393 |
| 255 | 3300049822 | Ga0501035_0196379 | Ga0501035_0196379_291_1526 | 393 |
| 256 | 3300053084 | Ga0495595_0002348 | Ga0495595_0002348_841_2076 | 393 |
| 257 | 3300053085 | Ga0495619_0000727 | Ga0495619_0000727_6882_8117 | 393 |
| 258 | 3300053104 | Ga0500556_0002927 | Ga0500556_0002927_2793_4028 | 393 |
| 259 | 3300053108 | Ga0500562_009410 | Ga0500562_009410_389_1624 | 393 |
| 260 | 3300053133 | Ga0500655_008264 | Ga0500655_008264_170_1405 | 393 |
| 261 | 3300053153 | Ga0500616_0045445 | Ga0500616_0045445_399_1634 | 393 |
| 262 | 3300053160 | Ga0500633_0016081 | Ga0500633_0016081_301_1536 | 393 |
| 263 | iso_pu_bacteria | 2513237094 | 2513641360 | 393 |
| 264 | iso_pu_bacteria | 2847930680 | 2847935615 | 393 |
| 265 | iso_pu_bacteria | 2881665667 | 2881673366 | 393 |
| 266 | 3300006028 | Ga0070717_10106463 | Ga0070717_101064632 | 406 |
| 267 | 3300002073 | JGI24745J21846_1001476 | JGI24745J21846_10014762 | 407 |
| 268 | 3300005327 | Ga0070658_10115297 | Ga0070658_101152972 | 407 |
| 269 | 3300005329 | Ga0070683_100264140 | Ga0070683_1002641402 | 407 |
| 270 | 3300005337 | Ga0070682_100035472 | Ga0070682_1000354722 | 407 |
| 271 | 3300005347 | Ga0070668_100031848 | Ga0070668_1000318482 | 407 |
| 272 | 3300005457 | Ga0070662_100007619 | Ga0070662_1000076195 | 407 |
| 273 | 3300005459 | Ga0068867_100187888 | Ga0068867_1001878882 | 407 |
| 274 | 3300005548 | Ga0070665_100063215 | Ga0070665_1000632153 | 407 |
| 275 | 3300005578 | Ga0068854_100030316 | Ga0068854_1000303162 | 407 |
| 276 | 3300005618 | Ga0068864_100042615 | Ga0068864_1000426152 | 407 |
| 277 | 3300005618 | Ga0068864_100116021 | Ga0068864_1001160212 | 407 |
| 278 | 3300005719 | Ga0068861_100060339 | Ga0068861_1000603392 | 407 |
| 279 | 3300005841 | Ga0068863_100066248 | Ga0068863_1000662482 | 407 |
| 280 | 3300005842 | Ga0068858_100072336 | Ga0068858_1000723362 | 407 |
| 281 | 3300006028 | Ga0070717_10156006 | Ga0070717_101560062 | 407 |
| 282 | 3300009094 | Ga0111539_10039387 | Ga0111539_100393875 | 407 |
| 283 | 3300009098 | Ga0105245_10029952 | Ga0105245_100299522 | 407 |
| 284 | 3300009098 | Ga0105245_10160931 | Ga0105245_101609311 | 407 |
| 285 | 3300009551 | Ga0105238_10116573 | Ga0105238_101165732 | 407 |
| 286 | 3300010375 | Ga0105239_10347200 | Ga0105239_103472002 | 407 |
| 287 | 3300013307 | Ga0157372_10290920 | Ga0157372_102909202 | 407 |
| 288 | 3300014969 | Ga0157376_10209934 | Ga0157376_102099341 | 407 |
| 289 | 3300021384 | Ga0213876_10028039 | Ga0213876_100280392 | 407 |
| 290 | 3300025901 | Ga0207688_10002122 | Ga0207688_100021222 | 407 |
| 291 | 3300025903 | Ga0207680_10192684 | Ga0207680_101926841 | 407 |
| 292 | 3300025904 | Ga0207647_10073442 | Ga0207647_100734421 | 407 |
| 293 | 3300025908 | Ga0207643_10021007 | Ga0207643_100210071 | 407 |
| 294 | 3300025914 | Ga0207671_10049209 | Ga0207671_100492092 | 407 |
| 295 | 3300025918 | Ga0207662_10050034 | Ga0207662_100500342 | 407 |
| 296 | 3300025920 | Ga0207649_10030062 | Ga0207649_100300622 | 407 |
| 297 | 3300025927 | Ga0207687_10066367 | Ga0207687_100663672 | 407 |
| 298 | 3300025931 | Ga0207644_10208385 | Ga0207644_102083852 | 407 |
| 299 | 3300025933 | Ga0207706_10028318 | Ga0207706_100283182 | 407 |
| 300 | 3300025940 | Ga0207691_10160004 | Ga0207691_101600042 | 407 |
| 301 | 3300025945 | Ga0207679_10075109 | Ga0207679_100751092 | 407 |
| 302 | 3300025960 | Ga0207651_10102372 | Ga0207651_101023721 | 407 |
| 303 | 3300025972 | Ga0207668_10029075 | Ga0207668_100290752 | 407 |
| 304 | 3300025981 | Ga0207640_10120641 | Ga0207640_101206412 | 407 |
| 305 | 3300026023 | Ga0207677_10006844 | Ga0207677_100068442 | 407 |
| 306 | 3300026023 | Ga0207677_10065898 | Ga0207677_100658982 | 407 |
| 307 | 3300026035 | Ga0207703_10237376 | Ga0207703_102373762 | 407 |
| 308 | 3300026067 | Ga0207678_10008155 | Ga0207678_100081554 | 407 |
| 309 | 3300026089 | Ga0207648_10184695 | Ga0207648_101846952 | 407 |
| 310 | 3300026121 | Ga0207683_10152233 | Ga0207683_101522332 | 407 |
| 311 | 3300028379 | Ga0268266_10057306 | Ga0268266_100573062 | 407 |
| 312 | 3300028380 | Ga0268265_10023154 | Ga0268265_100231543 | 407 |
| 313 | 3300048913 | Ga0496110_0087546 | Ga0496110_0087546_486_1709 | 407 |
| 314 | 3300048916 | Ga0496113_0075375 | Ga0496113_0075375_812_2035 | 407 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l94-assembly2.cif.gz_B | the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone | 0.9522 | 16 | 407 |
| 5l94-assembly2.cif.gz_B | the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone | 0.9471 | 16 | 407 |
| 5l92-assembly2.cif.gz_B | the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone | 0.9394 | 11 | 407 |
| 6kbh-assembly1.cif.gz_A | crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase | 0.9391 | 4 | 406 |
| 5l92-assembly2.cif.gz_B | the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone | 0.9369 | 11 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5l92B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9394 | 11 | 407 | 1.10.630.10 |
| 5l92B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9369 | 11 | 407 | 1.10.630.10 |
| 6gmfA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9368 | 6 | 405 | 1.10.630.10 |
| 5xjnA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9292 | 4 | 406 | 1.10.630.10 |
| 5xjnA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9226 | 4 | 406 | 1.10.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535F343-F1-model_v4 | Cytochrome P450 | 0.9619 | 198 | 406 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A7C3QNC8-F1-model_v4 | Cytochrome P450 | 0.9618 | 251 | 404 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A4Q3IEJ9-F1-model_v4 | Cytochrome P450 | 0.9556 | 229 | 405 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A4Q3CSH2-F1-model_v4 | Cytochrome P450 | 0.9546 | 230 | 406 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A7Y4IPM7-F1-model_v4 | Cytochrome P450 | 0.9541 | 4 | 406 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar