F402738

General Info

Members Datasets Scaffolds Average Seq Length
314 215 295 409

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10009739|Ga0265334_100097392
Length 456
Sequence VSGTPGVGQGVRGAALPPGEGGPRVDLTDPGVFGAGVPHEEFARLRREDPVSWTPEPHGRGFWSVTRYSDVVTVHREVGTYSSQVGATALEDLEPDALAARASMLDLDPPEHTRLRRTVAPEFTRRSVGGYRTRVQDVVRQVLAEVLPSGGETVEFEAVSRVATTIPIRVLCQVLGVPEKDEPLLIELGDRMIGNTDPDLAQVLLDSQESDAYRLLPFRSPAALQMHAYGRELAVRKQRDPGSDLVTALVQGRAPGTPRLAGAEFDAMFLLLVVAGNETTRSALALGLQAFAEYPDQWDLLAARVEAGDPEAIAAAAEEVLRWTTPLHHFRRTATRDTELAGQVIAAEDKVVVWYPSANRDGTVFTDPDRFDVTRTPNQHVSFGRGGPHRCLGEHLARLEIQVVLEELLPRVVRFEVAGPVRRVRSNFVHGLKSLPLRAVPRRPTDPLTSHLGSRP

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2517572101 Frankia sp. DC12 Isolate Nodule
5 2671180195 Frankia sp. CcI49 Isolate Nodule
6 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
7 2687453737 Frankia sp. BMG5.36 Isolate Nodule
8 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
9 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
10 2773857922 Frankia sp. CcI49 Isolate Nodule
11 2773857933 Frankia sp. BMG5.30 Isolate Nodule
12 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
13 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
14 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
45 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
92 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
93 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
207 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 8002775197 Frankia nepalensis CN7 Isolate Nodule
212 8002784119 Frankia sp. AgB1.9 Isolate Nodule
213 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
214 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
215 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.63
Metatranscriptomes 0.32
Isolates 6.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 5.41
Rhizoplane 2.87
Rhizosphere 74.52
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1001476 3300002073 Bacteria 2286
2 Ga0065165_1000348 3300005262 Bacteria 75762
3 Ga0065165_1004345 3300005262 Bacteria 8892
4 Ga0070658_10115297 3300005327 Bacteria 2229
5 Ga0070683_100264140 3300005329 Bacteria 1637
6 Ga0070682_100035472 3300005337 Bacteria 3045
7 Ga0070668_100031848 3300005347 Bacteria 4013
8 Ga0070714_100035896 3300005435 Bacteria 4155
9 Ga0070711_100113994 3300005439 Bacteria 1988
10 Ga0070708_100009605 3300005445 Bacteria 7800
11 Ga0070708_100127141 3300005445 Bacteria 2357
12 Ga0070662_100007619 3300005457 Bacteria 7028
13 Ga0070681_10047761 3300005458 Bacteria 4278
14 Ga0068867_100187888 3300005459 Bacteria 1647
15 Ga0070707_100012901 3300005468 Bacteria 7805
16 Ga0070698_100005127 3300005471 Bacteria 14336
17 Ga0070665_100063215 3300005548 Bacteria 3711
18 Ga0068854_100030316 3300005578 Bacteria 3751
19 Ga0068856_100328657 3300005614 Bacteria 1546
20 Ga0068852_100212967 3300005616 Bacteria 1834
21 Ga0068859_100000043 3300005617 Bacteria 156893
22 Ga0068864_100042615 3300005618 Bacteria 3884
23 Ga0068864_100116021 3300005618 Bacteria 2388
24 Ga0068861_100060339 3300005719 Bacteria 2906
25 Ga0068863_100066248 3300005841 Bacteria 3416
26 Ga0068858_100026189 3300005842 Bacteria 5422
27 Ga0068858_100072336 3300005842 Bacteria 3199
28 Ga0068862_100000037 3300005844 Bacteria 172796
29 Ga0081540_1001522 3300005983 Bacteria 19920
30 Ga0070717_10106463 3300006028 Bacteria 2388
31 Ga0070717_10106707 3300006028 Bacteria 2385
32 Ga0070717_10156006 3300006028 Bacteria 1978
33 Ga0075364_10092014 3300006051 Bacteria 2013
34 Ga0075436_100021238 3300006914 Bacteria 4455
35 Ga0097620_100000043 3300006931 Bacteria 156893
36 Ga0099824_1013698 3300006942 Bacteria 8327
37 Ga0099822_1016891 3300006943 Bacteria 7921
38 Ga0075435_100046925 3300007076 Bacteria 3467
39 Ga0111539_10039387 3300009094 Bacteria 5697
40 Ga0111539_10062415 3300009094 Bacteria 4411
41 Ga0105245_10029952 3300009098 Bacteria 4812
42 Ga0105245_10102140 3300009098 Bacteria 2655
43 Ga0105245_10160931 3300009098 Bacteria 2130
44 Ga0114129_10032676 3300009147 Bacteria 7353
45 Ga0105248_10138350 3300009177 Bacteria 2747
46 Ga0105237_10209350 3300009545 Bacteria 1950
47 Ga0105238_10116573 3300009551 Bacteria 2650
48 Ga0105239_10144015 3300010375 Bacteria 2657
49 Ga0105239_10347200 3300010375 Bacteria 1675
50 Ga0157370_10054448 3300013104 Bacteria 3814
51 Ga0157369_10001394 3300013105 Bacteria 29676
52 Ga0157369_10351513 3300013105 Bacteria 1531
53 Ga0163162_10047604 3300013306 Bacteria 4297
54 Ga0157372_10290920 3300013307 Bacteria 1900
55 Ga0157375_10128739 3300013308 Bacteria 2650
56 Ga0163163_10011103 3300014325 Bacteria 8152
57 Ga0157376_10088316 3300014969 Bacteria 2678
58 Ga0157376_10209934 3300014969 Bacteria 1797
59 Ga0213876_10028039 3300021384 Bacteria 2969
60 Ga0209256_1004731 3300025299 Bacteria 8327
61 Ga0207692_10051172 3300025898 Bacteria 2093
62 Ga0207692_10092644 3300025898 Bacteria 1642
63 Ga0207688_10002122 3300025901 Bacteria 10654
64 Ga0207680_10192684 3300025903 Bacteria 1385
65 Ga0207647_10073442 3300025904 Bacteria 2061
66 Ga0207645_10054063 3300025907 Bacteria 2565
67 Ga0207643_10021007 3300025908 Bacteria 3585
68 Ga0207684_10029666 3300025910 Bacteria 4656
69 Ga0207684_10318107 3300025910 Bacteria 1341
70 Ga0207695_10046758 3300025913 Bacteria 4585
71 Ga0207671_10049209 3300025914 Bacteria 3120
72 Ga0207660_10150597 3300025917 Bacteria 1787
73 Ga0207662_10050034 3300025918 Bacteria 2481
74 Ga0207649_10030062 3300025920 Bacteria 3213
75 Ga0207646_10068906 3300025922 Bacteria 3159
76 Ga0207646_10257538 3300025922 Bacteria 1577
77 Ga0207687_10066367 3300025927 Bacteria 2565
78 Ga0207700_10079674 3300025928 Bacteria 2551
79 Ga0207664_10096486 3300025929 Bacteria 2434
80 Ga0207644_10208385 3300025931 Bacteria 1545
81 Ga0207706_10028318 3300025933 Bacteria 5004
82 Ga0207691_10160004 3300025940 Bacteria 1976
83 Ga0207679_10075109 3300025945 Bacteria 2563
84 Ga0207651_10102372 3300025960 Bacteria 2129
85 Ga0207668_10029075 3300025972 Bacteria 3620
86 Ga0207640_10120641 3300025981 Bacteria 1877
87 Ga0207677_10006844 3300026023 Bacteria 6262
88 Ga0207677_10065898 3300026023 Bacteria 2529
89 Ga0207703_10237376 3300026035 Bacteria 1637
90 Ga0207678_10008155 3300026067 Bacteria 9236
91 Ga0207648_10184695 3300026089 Bacteria 1846
92 Ga0207683_10152233 3300026121 Bacteria 2088
93 Ga0209589_1000001 3300027357 Bacteria 794224
94 Ga0209489_100001 3300027361 Bacteria 794224
95 Ga0209700_100001 3300027363 Bacteria 794224
96 Ga0207428_10051544 3300027907 Bacteria 3289
97 Ga0268266_10001761 3300028379 Bacteria 24672
98 Ga0268266_10057306 3300028379 Bacteria 3352
99 Ga0268265_10000008 3300028380 Bacteria 417328
100 Ga0268265_10023154 3300028380 Bacteria 4375
101 Ga0265334_10009739 3300028573 Bacteria 4061
102 Ga0316176_1169744 3300030732 Bacteria 4626
103 Ga0314311_1144588 3300030733 Bacteria 4452
104 Ga0265330_10002892 3300031235 Bacteria 9165
105 Ga0265330_10002983 3300031235 Bacteria 9004
106 Ga0265332_10013493 3300031238 Bacteria 3621
107 Ga0265340_10009123 3300031247 Bacteria 5332
108 Ga0265316_10026828 3300031344 Bacteria 4784
109 Ga0307508_10056650 3300031616 Bacteria 3470
110 Ga0265342_10013148 3300031712 Bacteria 5568
111 Ga0307507_10009914 3300033179 Bacteria 12520
112 Ga0307510_10067943 3300033180 Bacteria 3582
113 Ga0373926_0000968 3300035083 Bacteria 8327
114 Ga0373944_0001498 3300035089 Bacteria 5906
115 Ga0373949_0000130 3300035090 Bacteria 28037
116 Ga0373949_0005849 3300035090 Bacteria 2734
117 Ga0373923_0003251 3300035111 Bacteria 5178
118 Ga0373923_0004090 3300035111 Bacteria 4796
119 Ga0373945_0007470 3300035116 Bacteria 3543
120 Ga0373953_0000253 3300035117 Bacteria 14472
121 Ga0373953_0044144 3300035117 Bacteria 1781
122 Ga0373954_0000158 3300035118 Bacteria 24163
123 Ga0373954_0004156 3300035118 Bacteria 6203
124 Ga0373956_0002522 3300035119 Bacteria 7452
125 Ga0373957_0000195 3300035120 Bacteria 15514
126 Ga0373957_0009869 3300035120 Bacteria 3135
127 Ga0373943_0003163 3300035170 Bacteria 7478
128 Ga0373946_0000689 3300035171 Bacteria 11383
129 Ga0373946_0060108 3300035171 Bacteria 1614
130 Ga0373924_0002631 3300035410 Bacteria 6058
131 Ga0373924_0020322 3300035410 Bacteria 2580
132 Ga0373935_0000080 3300035692 Bacteria 41767
133 Ga0373927_0003721 3300035695 Bacteria 10842
134 Ga0373927_0156715 3300035695 Bacteria 1491
135 Ga0373933_0000601 3300035724 Bacteria 22512
136 Ga0373947_0036403 3300035725 Bacteria 2918
137 Ga0373947_0057069 3300035725 Bacteria 2361
138 Ga0373937_0007563 3300036401 Bacteria 9409
139 Ga0373925_0004002 3300037068 Bacteria 11216
140 Ga0373925_0129338 3300037068 Bacteria 1967
141 Ga0373925_0137301 3300037068 Bacteria 1911
142 Ga0395898_0039026 3300037466 Bacteria 4703
143 Ga0395898_0071071 3300037466 Bacteria 3364
144 Ga0436364_0239060 3300037853 Bacteria 6151
145 Ga0395901_0086721 3300038443 Bacteria 3273
146 Ga0436365_0144819 3300039437 Bacteria 2026
147 Ga0436365_0226807 3300039437 Bacteria 2334
148 Ga0436365_1507128 3300039437 Bacteria 5766
149 Ga0436361_0987735 3300039447 Bacteria 6425
150 Ga0436362_0560646 3300039453 Bacteria 5108
151 Ga0466959_0016591 3300045049 Bacteria 5385
152 Ga0466967_0126047 3300045976 Bacteria 2372
153 Ga0495592_0000710 3300046454 Bacteria 23301
154 Ga0495592_0006080 3300046454 Bacteria 8969
155 Ga0495592_0028589 3300046454 Bacteria 4221
156 Ga0495592_0214993 3300046454 Bacteria 1289
157 Ga0495603_0094245 3300046455 Bacteria 1749
158 Ga0495629_0001171 3300046459 Bacteria 20704
159 Ga0495629_0007376 3300046459 Bacteria 8107
160 Ga0495629_0069015 3300046459 Bacteria 2466
161 Ga0495638_0009160 3300046460 Bacteria 6963
162 Ga0495641_0016337 3300046461 Bacteria 3914
163 Ga0495651_0006358 3300046462 Bacteria 9039
164 Ga0495651_0083267 3300046462 Bacteria 2412
165 Ga0495651_0085485 3300046462 Bacteria 2375
166 Ga0495653_0020680 3300046463 Bacteria 5331
167 Ga0495653_0135539 3300046463 Bacteria 1737
168 Ga0495580_0076616 3300046472 Bacteria 2332
169 Ga0495582_0019865 3300046473 Bacteria 3674
170 Ga0495582_0045562 3300046473 Bacteria 2415
171 Ga0495639_0052530 3300046475 Bacteria 1855
172 Ga0495664_0022203 3300046477 Bacteria 3675
173 Ga0495664_0054208 3300046477 Bacteria 2384
174 Ga0495584_0078546 3300046491 Bacteria 1661
175 Ga0495608_0000921 3300046511 Bacteria 20621
176 Ga0495608_0035126 3300046511 Bacteria 3382
177 Ga0495628_0037221 3300046516 Bacteria 3901
178 Ga0495630_0054687 3300046517 Bacteria 2990
179 Ga0495630_0067779 3300046517 Bacteria 2682
180 Ga0495652_0013119 3300046529 Bacteria 7461
181 Ga0495652_0022915 3300046529 Bacteria 5539
182 Ga0495652_0134280 3300046529 Bacteria 1954
183 Ga0495640_0122553 3300046533 Bacteria 1688
184 Ga0495640_0146088 3300046533 Bacteria 1521
185 Ga0495587_0004018 3300046536 Bacteria 9748
186 Ga0495667_0007861 3300046559 Bacteria 7226
187 Ga0495667_0027431 3300046559 Bacteria 3837
188 Ga0495634_0040260 3300046642 Bacteria 3179
189 Ga0495634_0080005 3300046642 Bacteria 2139
190 Ga0495634_0123501 3300046642 Bacteria 1656
191 Ga0495635_0036387 3300046663 Bacteria 3412
192 Ga0495635_0043124 3300046663 Bacteria 3113
193 Ga0495657_0004554 3300046675 Bacteria 11078
194 Ga0495657_0057814 3300046675 Bacteria 2577
195 Ga0495657_0068343 3300046675 Bacteria 2328
196 Ga0495599_0009351 3300046678 Bacteria 5987
197 Ga0495599_0038739 3300046678 Bacteria 2995
198 Ga0495623_0029843 3300046679 Bacteria 3509
199 Ga0495646_0082271 3300046680 Bacteria 1873
200 Ga0495658_0007648 3300046683 Bacteria 5357
201 Ga0495613_0032541 3300046689 Bacteria 3874
202 Ga0495613_0201836 3300046689 Bacteria 1402
203 Ga0495600_0000750 3300046809 Bacteria 17105
204 Ga0495600_0031839 3300046809 Bacteria 3419
205 Ga0495600_0039153 3300046809 Bacteria 3087
206 Ga0495600_0041569 3300046809 Bacteria 2996
207 Ga0495581_0016452 3300047315 Bacteria 4299
208 Ga0495604_0003228 3300047317 Bacteria 13034
209 Ga0495674_0005457 3300047319 Bacteria 12218
210 Ga0495674_0090624 3300047319 Bacteria 2612
211 Ga0495676_0017028 3300047321 Bacteria 6433
212 Ga0495680_0009909 3300047322 Bacteria 8541
213 Ga0495680_0010921 3300047322 Bacteria 8068
214 Ga0495680_0015301 3300047322 Bacteria 6619
215 Ga0495680_0024512 3300047322 Bacteria 5004
216 Ga0495680_0048043 3300047322 Bacteria 3353
217 Ga0495675_0002709 3300047444 Bacteria 10614
218 Ga0495675_0026238 3300047444 Bacteria 3715
219 Ga0495684_0000104 3300047471 Bacteria 59909
220 Ga0495684_0002271 3300047471 Bacteria 15407
221 Ga0495684_0008921 3300047471 Bacteria 7747
222 Ga0495684_0018222 3300047471 Bacteria 5412
223 Ga0495602_0021846 3300048088 Bacteria 6282
224 Ga0495602_0116946 3300048088 Bacteria 2153
225 Ga0496102_0136380 3300048905 Bacteria 2300
226 Ga0496104_0106907 3300048907 Bacteria 2681
227 Ga0496104_0371659 3300048907 Unclassified 1342
228 Ga0496108_0035326 3300048911 Bacteria 4154
229 Ga0496110_0040432 3300048913 Bacteria 4064
230 Ga0496110_0087546 3300048913 Bacteria 2782
231 Ga0496112_0209492 3300048915 Bacteria 1907
232 Ga0496113_0075375 3300048916 Bacteria 2575
233 Ga0496113_0190827 3300048916 Bacteria 1626
234 Ga0496116_0000190 3300048919 Bacteria 122544
235 Ga0496116_0031515 3300048919 Bacteria 3794
236 Ga0496117_0000028 3300048920 Bacteria 407392
237 Ga0496117_0004705 3300048920 Bacteria 14819
238 Ga0496117_0014726 3300048920 Bacteria 6716
239 Ga0496117_0015568 3300048920 Bacteria 6473
240 Ga0496118_0000734 3300048921 Bacteria 52990
241 Ga0496118_0014089 3300048921 Bacteria 7502
242 Ga0496118_0015761 3300048921 Bacteria 6975
243 Ga0496119_0004695 3300048922 Bacteria 13445
244 Ga0496119_0105565 3300048922 Bacteria 1573
245 Ga0496120_0002211 3300048923 Bacteria 20521
246 Ga0496120_0006237 3300048923 Bacteria 9212
247 Ga0496121_0000015 3300048924 Bacteria 571958
248 Ga0496121_0123680 3300048924 Bacteria 1949
249 Ga0496122_0000111 3300048925 Bacteria 189920
250 Ga0496122_0007603 3300048925 Bacteria 11977
251 Ga0496122_0029084 3300048925 Bacteria 4671
252 Ga0496123_0000006 3300048926 Bacteria 647258
253 Ga0496123_0000009 3300048926 Bacteria 509486
254 Ga0496123_0087986 3300048926 Bacteria 1856
255 Ga0496124_0001161 3300048927 Bacteria 41252
256 Ga0496124_0003438 3300048927 Bacteria 19387
257 Ga0496125_0004248 3300048928 Bacteria 16693
258 Ga0496125_0022922 3300048928 Bacteria 5784
259 Ga0496125_0180614 3300048928 Bacteria 1406
260 Ga0496126_0000040 3300048929 Bacteria 345144
261 Ga0496126_0000436 3300048929 Bacteria 83469
262 Ga0496126_0005549 3300048929 Bacteria 14349
263 Ga0496126_0027334 3300048929 Bacteria 5451
264 Ga0496126_0147955 3300048929 Bacteria 2015
265 Ga0501038_0076832 3300049574 Bacteria 2821
266 Ga0501039_0110999 3300049575 Bacteria 2144
267 Ga0501046_0011197 3300049580 Bacteria 7683
268 Ga0501047_0003643 3300049581 Bacteria 14515
269 Ga0501047_0190022 3300049581 Bacteria 1917
270 Ga0501068_0156242 3300049584 Bacteria 1436
271 Ga0501070_0056075 3300049586 Bacteria 3266
272 Ga0501070_0059779 3300049586 Bacteria 3159
273 Ga0501070_0335296 3300049586 Bacteria 1229
274 Ga0501073_0087629 3300049589 Bacteria 2165
275 Ga0501074_0041256 3300049590 Bacteria 3342
276 Ga0501080_0097047 3300049742 Bacteria 2736
277 Ga0501035_0196379 3300049822 Bacteria 1733
278 nmdc:mga00v17_72506_c1 3300050491 Bacteria 2137
279 nmdc:mga08y16_113430_c1 3300050511 Bacteria 2821
280 nmdc:mga0rr50_112919_c1 3300050513 Bacteria 2152
281 nmdc:mga0a205_156807_c1 3300050515 Bacteria 2175
282 Ga0495601_0014775 3300053077 Bacteria 4711
283 Ga0495601_0137935 3300053077 Bacteria 1590
284 Ga0495612_0049901 3300053078 Bacteria 1717
285 Ga0495612_0071950 3300053078 Bacteria 1443
286 Ga0495595_0002348 3300053084 Bacteria 7372
287 Ga0495595_0004285 3300053084 Bacteria 5739
288 Ga0495619_0000727 3300053085 Bacteria 21527
289 Ga0495619_0048162 3300053085 Bacteria 2808
290 Ga0500556_0002927 3300053104 Bacteria 5165
291 Ga0500562_009410 3300053108 Bacteria 2470
292 Ga0500655_008264 3300053133 Bacteria 1873
293 Ga0500616_0045445 3300053153 Bacteria 2340
294 Ga0500633_0016081 3300053160 Bacteria 2163
295 Ga0587072_000638 3300059643 Bacteria 3730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0027431 Ga0495667_0027431_2798_3820 316
2 3300048907 Ga0496104_0371659 Ga0496104_0371659_203_1294 349
3 3300025907 Ga0207645_10054063 Ga0207645_100540631 358
4 3300049586 Ga0501070_0335296 Ga0501070_0335296_17_1138 360
5 iso_pu_bacteria 8056207758 8056210171 364
6 3300005983 Ga0081540_1001522 Ga0081540_10015225 368
7 3300006914 Ga0075436_100021238 Ga0075436_1000212385 369
8 3300007076 Ga0075435_100046925 Ga0075435_1000469253 369
9 3300009094 Ga0111539_10062415 Ga0111539_100624154 369
10 3300009147 Ga0114129_10032676 Ga0114129_100326764 369
11 3300025922 Ga0207646_10257538 Ga0207646_102575382 369
12 3300027907 Ga0207428_10051544 Ga0207428_100515442 369
13 3300035118 Ga0373954_0004156 Ga0373954_0004156_3926_5164 369
14 3300035120 Ga0373957_0009869 Ga0373957_0009869_1270_2508 369
15 3300035171 Ga0373946_0060108 Ga0373946_0060108_173_1411 369
16 3300035695 Ga0373927_0156715 Ga0373927_0156715_216_1454 369
17 3300037068 Ga0373925_0129338 Ga0373925_0129338_326_1564 369
18 3300037068 Ga0373925_0137301 Ga0373925_0137301_545_1783 369
19 3300046454 Ga0495592_0028589 Ga0495592_0028589_2652_3890 369
20 3300046459 Ga0495629_0007376 Ga0495629_0007376_3638_4876 369
21 3300046459 Ga0495629_0069015 Ga0495629_0069015_303_1541 369
22 3300046462 Ga0495651_0083267 Ga0495651_0083267_129_1367 369
23 3300046463 Ga0495653_0135539 Ga0495653_0135539_109_1347 369
24 3300046472 Ga0495580_0076616 Ga0495580_0076616_939_2177 369
25 3300046473 Ga0495582_0019865 Ga0495582_0019865_1967_3205 369
26 3300046473 Ga0495582_0045562 Ga0495582_0045562_1030_2268 369
27 3300046475 Ga0495639_0052530 Ga0495639_0052530_411_1649 369
28 3300046511 Ga0495608_0035126 Ga0495608_0035126_1674_2912 369
29 3300046516 Ga0495628_0037221 Ga0495628_0037221_2241_3479 369
30 3300046517 Ga0495630_0067779 Ga0495630_0067779_257_1495 369
31 3300046529 Ga0495652_0134280 Ga0495652_0134280_374_1612 369
32 3300046533 Ga0495640_0122553 Ga0495640_0122553_116_1354 369
33 3300046642 Ga0495634_0123501 Ga0495634_0123501_303_1541 369
34 3300046663 Ga0495635_0036387 Ga0495635_0036387_124_1362 369
35 3300046675 Ga0495657_0057814 Ga0495657_0057814_1046_2284 369
36 3300046678 Ga0495599_0038739 Ga0495599_0038739_1040_2278 369
37 3300046680 Ga0495646_0082271 Ga0495646_0082271_262_1500 369
38 3300046683 Ga0495658_0007648 Ga0495658_0007648_361_1599 369
39 3300046689 Ga0495613_0032541 Ga0495613_0032541_1176_2414 369
40 3300046689 Ga0495613_0201836 Ga0495613_0201836_31_1269 369
41 3300047315 Ga0495581_0016452 Ga0495581_0016452_237_1475 369
42 3300047322 Ga0495680_0015301 Ga0495680_0015301_238_1476 369
43 3300047444 Ga0495675_0026238 Ga0495675_0026238_944_2182 369
44 3300047471 Ga0495684_0018222 Ga0495684_0018222_3545_4783 369
45 3300048088 Ga0495602_0116946 Ga0495602_0116946_374_1612 369
46 3300050511 nmdc:mga08y16_113430_c1 nmdc:mga08y16_113430_c1_402_1640 369
47 3300050515 nmdc:mga0a205_156807_c1 nmdc:mga0a205_156807_c1_834_2072 369
48 3300053077 Ga0495601_0137935 Ga0495601_0137935_191_1429 369
49 3300053078 Ga0495612_0049901 Ga0495612_0049901_460_1698 369
50 3300053085 Ga0495619_0048162 Ga0495619_0048162_581_1819 369
51 3300005439 Ga0070711_100113994 Ga0070711_1001139942 371
52 3300048920 Ga0496117_0014726 Ga0496117_0014726_832_2079 377
53 3300048921 Ga0496118_0015761 Ga0496118_0015761_3258_4505 377
54 3300048925 Ga0496122_0007603 Ga0496122_0007603_9130_10377 377
55 3300048926 Ga0496123_0000009 Ga0496123_0000009_39030_40277 377
56 3300048927 Ga0496124_0001161 Ga0496124_0001161_9315_10562 377
57 3300048928 Ga0496125_0022922 Ga0496125_0022922_1335_2582 377
58 3300005445 Ga0070708_100009605 Ga0070708_1000096053 379
59 3300005445 Ga0070708_100127141 Ga0070708_1001271412 379
60 3300025898 Ga0207692_10051172 Ga0207692_100511722 379
61 3300046491 Ga0495584_0078546 Ga0495584_0078546_244_1434 379
62 iso_pu_bacteria 2773857933 2774901803 381
63 3300005435 Ga0070714_100035896 Ga0070714_1000358963 382
64 3300025929 Ga0207664_10096486 Ga0207664_100964862 382
65 3300030732 Ga0316176_1169744 Ga0316176_11697443 382
66 3300030733 Ga0314311_1144588 Ga0314311_11445884 382
67 3300033179 Ga0307507_10009914 Ga0307507_1000991411 382
68 iso_pu_bacteria 8047710418 8047716383 382
69 3300046809 Ga0495600_0031839 Ga0495600_0031839_837_2075 383
70 3300005458 Ga0070681_10047761 Ga0070681_100477612 384
71 3300039437 Ga0436365_1507128 Ga0436365_1507128_469_1692 384
72 3300039453 Ga0436362_0560646 Ga0436362_0560646_1028_2251 384
73 3300048919 Ga0496116_0031515 Ga0496116_0031515_1658_2905 384
74 3300048920 Ga0496117_0000028 Ga0496117_0000028_237838_239085 384
75 3300048920 Ga0496117_0015568 Ga0496117_0015568_1166_2413 384
76 3300048921 Ga0496118_0014089 Ga0496118_0014089_4591_5838 384
77 3300048922 Ga0496119_0004695 Ga0496119_0004695_1674_2921 384
78 3300048922 Ga0496119_0105565 Ga0496119_0105565_48_1295 384
79 3300048923 Ga0496120_0002211 Ga0496120_0002211_17611_18858 384
80 3300048923 Ga0496120_0006237 Ga0496120_0006237_7374_8621 384
81 3300048925 Ga0496122_0000111 Ga0496122_0000111_77905_79152 384
82 3300048925 Ga0496122_0029084 Ga0496122_0029084_297_1544 384
83 3300048926 Ga0496123_0000006 Ga0496123_0000006_77762_79009 384
84 3300048926 Ga0496123_0087986 Ga0496123_0087986_72_1319 384
85 3300048927 Ga0496124_0003438 Ga0496124_0003438_17643_18890 384
86 3300048928 Ga0496125_0004248 Ga0496125_0004248_4922_6169 384
87 3300048928 Ga0496125_0180614 Ga0496125_0180614_99_1346 384
88 3300048929 Ga0496126_0000436 Ga0496126_0000436_60_1307 384
89 3300048929 Ga0496126_0005549 Ga0496126_0005549_2943_4187 384
90 iso_pu_bacteria 2513237098 2513677284 384
91 iso_pu_bacteria 2757320536 2758224361 384
92 3300005468 Ga0070707_100012901 Ga0070707_1000129016 385
93 3300005614 Ga0068856_100328657 Ga0068856_1003286571 385
94 3300005842 Ga0068858_100026189 Ga0068858_1000261892 385
95 3300009098 Ga0105245_10102140 Ga0105245_101021402 385
96 3300009177 Ga0105248_10138350 Ga0105248_101383502 385
97 3300009545 Ga0105237_10209350 Ga0105237_102093502 385
98 3300010375 Ga0105239_10144015 Ga0105239_101440151 385
99 3300013105 Ga0157369_10351513 Ga0157369_103515131 385
100 3300013306 Ga0163162_10047604 Ga0163162_100476043 385
101 3300013308 Ga0157375_10128739 Ga0157375_101287392 385
102 3300014969 Ga0157376_10088316 Ga0157376_100883162 385
103 3300025898 Ga0207692_10092644 Ga0207692_100926441 385
104 3300025917 Ga0207660_10150597 Ga0207660_101505972 385
105 3300025922 Ga0207646_10068906 Ga0207646_100689061 385
106 3300025928 Ga0207700_10079674 Ga0207700_100796742 385
107 3300035083 Ga0373926_0000968 Ga0373926_0000968_1058_2302 385
108 3300035089 Ga0373944_0001498 Ga0373944_0001498_3191_4435 385
109 3300035090 Ga0373949_0005849 Ga0373949_0005849_1345_2583 385
110 3300035111 Ga0373923_0003251 Ga0373923_0003251_803_2047 385
111 3300035116 Ga0373945_0007470 Ga0373945_0007470_363_1607 385
112 3300035117 Ga0373953_0044144 Ga0373953_0044144_17_1264 385
113 3300035170 Ga0373943_0003163 Ga0373943_0003163_1045_2289 385
114 3300035171 Ga0373946_0000689 Ga0373946_0000689_7888_9132 385
115 3300035410 Ga0373924_0020322 Ga0373924_0020322_366_1610 385
116 3300035692 Ga0373935_0000080 Ga0373935_0000080_700_1944 385
117 3300035695 Ga0373927_0003721 Ga0373927_0003721_7359_8603 385
118 3300035725 Ga0373947_0036403 Ga0373947_0036403_1225_2469 385
119 3300035725 Ga0373947_0057069 Ga0373947_0057069_649_1893 385
120 3300037068 Ga0373925_0004002 Ga0373925_0004002_5007_6251 385
121 3300037853 Ga0436364_0239060 Ga0436364_0239060_1334_2581 385
122 3300039437 Ga0436365_0144819 Ga0436365_0144819_258_1508 385
123 3300039437 Ga0436365_0226807 Ga0436365_0226807_845_2104 385
124 3300045976 Ga0466967_0126047 Ga0466967_0126047_105_1325 385
125 3300046454 Ga0495592_0006080 Ga0495592_0006080_1893_3140 385
126 3300046455 Ga0495603_0094245 Ga0495603_0094245_41_1285 385
127 3300046461 Ga0495641_0016337 Ga0495641_0016337_1022_2266 385
128 3300046462 Ga0495651_0006358 Ga0495651_0006358_893_2140 385
129 3300046463 Ga0495653_0020680 Ga0495653_0020680_1469_2716 385
130 3300046477 Ga0495664_0022203 Ga0495664_0022203_949_2193 385
131 3300046477 Ga0495664_0054208 Ga0495664_0054208_627_1871 385
132 3300046517 Ga0495630_0054687 Ga0495630_0054687_971_2233 385
133 3300046529 Ga0495652_0013119 Ga0495652_0013119_2947_4194 385
134 3300046642 Ga0495634_0040260 Ga0495634_0040260_478_1722 385
135 3300046642 Ga0495634_0080005 Ga0495634_0080005_361_1608 385
136 3300046675 Ga0495657_0068343 Ga0495657_0068343_697_1959 385
137 3300046679 Ga0495623_0029843 Ga0495623_0029843_728_1975 385
138 3300046809 Ga0495600_0041569 Ga0495600_0041569_1009_2256 385
139 3300047317 Ga0495604_0003228 Ga0495604_0003228_5645_6892 385
140 3300047321 Ga0495676_0017028 Ga0495676_0017028_4347_5591 385
141 3300047322 Ga0495680_0010921 Ga0495680_0010921_726_1973 385
142 3300047322 Ga0495680_0048043 Ga0495680_0048043_1745_2989 385
143 3300047471 Ga0495684_0002271 Ga0495684_0002271_6791_8038 385
144 3300047471 Ga0495684_0008921 Ga0495684_0008921_253_1515 385
145 3300048907 Ga0496104_0106907 Ga0496104_0106907_1266_2510 385
146 3300048911 Ga0496108_0035326 Ga0496108_0035326_2462_3706 385
147 3300048913 Ga0496110_0040432 Ga0496110_0040432_1562_2806 385
148 3300048915 Ga0496112_0209492 Ga0496112_0209492_477_1721 385
149 3300048916 Ga0496113_0190827 Ga0496113_0190827_57_1301 385
150 3300048924 Ga0496121_0000015 Ga0496121_0000015_382834_384084 385
151 3300048929 Ga0496126_0000040 Ga0496126_0000040_264917_266134 385
152 3300050513 nmdc:mga0rr50_112919_c1 nmdc:mga0rr50_112919_c1_729_1973 385
153 3300053077 Ga0495601_0014775 Ga0495601_0014775_1468_2715 385
154 3300053078 Ga0495612_0071950 Ga0495612_0071950_124_1371 385
155 3300053084 Ga0495595_0004285 Ga0495595_0004285_3397_4644 385
156 3300059643 Ga0587072_000638 Ga0587072_000638_946_2202 385
157 iso_pu_bacteria 8055037949 8055040261 385
158 3300028379 Ga0268266_10001761 Ga0268266_1000176111 386
159 3300028573 Ga0265334_10009739 Ga0265334_100097392 386
160 3300046454 Ga0495592_0214993 Ga0495592_0214993_38_1276 386
161 3300046462 Ga0495651_0085485 Ga0495651_0085485_83_1339 386
162 3300046663 Ga0495635_0043124 Ga0495635_0043124_1342_2598 386
163 3300046809 Ga0495600_0039153 Ga0495600_0039153_1664_2920 386
164 3300047319 Ga0495674_0090624 Ga0495674_0090624_411_1649 386
165 3300047322 Ga0495680_0024512 Ga0495680_0024512_3041_4297 386
166 3300048905 Ga0496102_0136380 Ga0496102_0136380_291_1562 386
167 3300048919 Ga0496116_0000190 Ga0496116_0000190_2842_4113 386
168 3300048920 Ga0496117_0004705 Ga0496117_0004705_1396_2667 386
169 3300048921 Ga0496118_0000734 Ga0496118_0000734_48920_50191 386
170 iso_pu_bacteria 2517572101 2517763279 386
171 iso_pu_bacteria 8002784119 8002787425 386
172 3300035090 Ga0373949_0000130 Ga0373949_0000130_23777_24976 387
173 3300005471 Ga0070698_100005127 Ga0070698_10000512711 388
174 3300005616 Ga0068852_100212967 Ga0068852_1002129672 388
175 3300005617 Ga0068859_100000043 Ga0068859_10000004342 388
176 3300005844 Ga0068862_100000037 Ga0068862_10000003732 388
177 3300006051 Ga0075364_10092014 Ga0075364_100920142 388
178 3300006931 Ga0097620_100000043 Ga0097620_10000004392 388
179 3300014325 Ga0163163_10011103 Ga0163163_100111031 388
180 3300025910 Ga0207684_10318107 Ga0207684_103181072 388
181 3300028380 Ga0268265_10000008 Ga0268265_10000008295 388
182 3300049586 Ga0501070_0056075 Ga0501070_0056075_1081_2283 388
183 3300050491 nmdc:mga00v17_72506_c1 nmdc:mga00v17_72506_c1_565_1836 388
184 iso_pu_bacteria 2508501039 2508674321 388
185 iso_pu_bacteria 2671180195 2671836946 388
186 iso_pu_bacteria 2675902999 2676199239 388
187 iso_pu_bacteria 2687453737 2689957651 388
188 iso_pu_bacteria 2773857921 2774843817 388
189 iso_pu_bacteria 2773857922 2774855102 388
190 iso_pu_bacteria 8002775197 8002776460 388
191 iso_pu_bacteria 2915358134 2915363295 389
192 3300005262 Ga0065165_1000348 Ga0065165_100034823 393
193 3300005262 Ga0065165_1004345 Ga0065165_10043451 393
194 3300006028 Ga0070717_10106707 Ga0070717_101067072 393
195 3300006942 Ga0099824_1013698 Ga0099824_10136987 393
196 3300006943 Ga0099822_1016891 Ga0099822_10168914 393
197 3300013104 Ga0157370_10054448 Ga0157370_100544483 393
198 3300013105 Ga0157369_10001394 Ga0157369_1000139416 393
199 3300025299 Ga0209256_1004731 Ga0209256_10047313 393
200 3300025910 Ga0207684_10029666 Ga0207684_100296661 393
201 3300025913 Ga0207695_10046758 Ga0207695_100467585 393
202 3300027357 Ga0209589_1000001 Ga0209589_1000001366 393
203 3300027361 Ga0209489_100001 Ga0209489_100001366 393
204 3300027363 Ga0209700_100001 Ga0209700_100001366 393
205 3300031235 Ga0265330_10002892 Ga0265330_100028928 393
206 3300031235 Ga0265330_10002983 Ga0265330_100029834 393
207 3300031238 Ga0265332_10013493 Ga0265332_100134932 393
208 3300031247 Ga0265340_10009123 Ga0265340_100091233 393
209 3300031344 Ga0265316_10026828 Ga0265316_100268283 393
210 3300031616 Ga0307508_10056650 Ga0307508_100566502 393
211 3300031712 Ga0265342_10013148 Ga0265342_100131482 393
212 3300033180 Ga0307510_10067943 Ga0307510_100679432 393
213 3300035111 Ga0373923_0004090 Ga0373923_0004090_2550_3785 393
214 3300035117 Ga0373953_0000253 Ga0373953_0000253_12058_13293 393
215 3300035118 Ga0373954_0000158 Ga0373954_0000158_18031_19266 393
216 3300035119 Ga0373956_0002522 Ga0373956_0002522_4405_5640 393
217 3300035120 Ga0373957_0000195 Ga0373957_0000195_2627_3862 393
218 3300035410 Ga0373924_0002631 Ga0373924_0002631_3936_5171 393
219 3300035724 Ga0373933_0000601 Ga0373933_0000601_16674_17909 393
220 3300036401 Ga0373937_0007563 Ga0373937_0007563_5201_6436 393
221 3300037466 Ga0395898_0039026 Ga0395898_0039026_745_1986 393
222 3300037466 Ga0395898_0071071 Ga0395898_0071071_1129_2364 393
223 3300038443 Ga0395901_0086721 Ga0395901_0086721_59_1294 393
224 3300039447 Ga0436361_0987735 Ga0436361_0987735_2398_3633 393
225 3300045049 Ga0466959_0016591 Ga0466959_0016591_76_1311 393
226 3300046454 Ga0495592_0000710 Ga0495592_0000710_13371_14606 393
227 3300046459 Ga0495629_0001171 Ga0495629_0001171_5222_6457 393
228 3300046460 Ga0495638_0009160 Ga0495638_0009160_4306_5541 393
229 3300046511 Ga0495608_0000921 Ga0495608_0000921_18131_19366 393
230 3300046529 Ga0495652_0022915 Ga0495652_0022915_904_2139 393
231 3300046533 Ga0495640_0146088 Ga0495640_0146088_39_1274 393
232 3300046536 Ga0495587_0004018 Ga0495587_0004018_5201_6436 393
233 3300046559 Ga0495667_0007861 Ga0495667_0007861_3401_4636 393
234 3300046675 Ga0495657_0004554 Ga0495657_0004554_4515_5750 393
235 3300046678 Ga0495599_0009351 Ga0495599_0009351_428_1663 393
236 3300046809 Ga0495600_0000750 Ga0495600_0000750_2628_3863 393
237 3300047319 Ga0495674_0005457 Ga0495674_0005457_10091_11326 393
238 3300047322 Ga0495680_0009909 Ga0495680_0009909_3023_4258 393
239 3300047444 Ga0495675_0002709 Ga0495675_0002709_37_1272 393
240 3300047471 Ga0495684_0000104 Ga0495684_0000104_35936_37171 393
241 3300048088 Ga0495602_0021846 Ga0495602_0021846_4620_5855 393
242 3300048924 Ga0496121_0123680 Ga0496121_0123680_594_1868 393
243 3300048929 Ga0496126_0027334 Ga0496126_0027334_2317_3552 393
244 3300048929 Ga0496126_0147955 Ga0496126_0147955_330_1604 393
245 3300049574 Ga0501038_0076832 Ga0501038_0076832_114_1355 393
246 3300049575 Ga0501039_0110999 Ga0501039_0110999_414_1655 393
247 3300049580 Ga0501046_0011197 Ga0501046_0011197_5180_6415 393
248 3300049581 Ga0501047_0003643 Ga0501047_0003643_12495_13730 393
249 3300049581 Ga0501047_0190022 Ga0501047_0190022_417_1658 393
250 3300049584 Ga0501068_0156242 Ga0501068_0156242_78_1319 393
251 3300049586 Ga0501070_0059779 Ga0501070_0059779_595_1830 393
252 3300049589 Ga0501073_0087629 Ga0501073_0087629_720_1955 393
253 3300049590 Ga0501074_0041256 Ga0501074_0041256_1253_2494 393
254 3300049742 Ga0501080_0097047 Ga0501080_0097047_1384_2619 393
255 3300049822 Ga0501035_0196379 Ga0501035_0196379_291_1526 393
256 3300053084 Ga0495595_0002348 Ga0495595_0002348_841_2076 393
257 3300053085 Ga0495619_0000727 Ga0495619_0000727_6882_8117 393
258 3300053104 Ga0500556_0002927 Ga0500556_0002927_2793_4028 393
259 3300053108 Ga0500562_009410 Ga0500562_009410_389_1624 393
260 3300053133 Ga0500655_008264 Ga0500655_008264_170_1405 393
261 3300053153 Ga0500616_0045445 Ga0500616_0045445_399_1634 393
262 3300053160 Ga0500633_0016081 Ga0500633_0016081_301_1536 393
263 iso_pu_bacteria 2513237094 2513641360 393
264 iso_pu_bacteria 2847930680 2847935615 393
265 iso_pu_bacteria 2881665667 2881673366 393
266 3300006028 Ga0070717_10106463 Ga0070717_101064632 406
267 3300002073 JGI24745J21846_1001476 JGI24745J21846_10014762 407
268 3300005327 Ga0070658_10115297 Ga0070658_101152972 407
269 3300005329 Ga0070683_100264140 Ga0070683_1002641402 407
270 3300005337 Ga0070682_100035472 Ga0070682_1000354722 407
271 3300005347 Ga0070668_100031848 Ga0070668_1000318482 407
272 3300005457 Ga0070662_100007619 Ga0070662_1000076195 407
273 3300005459 Ga0068867_100187888 Ga0068867_1001878882 407
274 3300005548 Ga0070665_100063215 Ga0070665_1000632153 407
275 3300005578 Ga0068854_100030316 Ga0068854_1000303162 407
276 3300005618 Ga0068864_100042615 Ga0068864_1000426152 407
277 3300005618 Ga0068864_100116021 Ga0068864_1001160212 407
278 3300005719 Ga0068861_100060339 Ga0068861_1000603392 407
279 3300005841 Ga0068863_100066248 Ga0068863_1000662482 407
280 3300005842 Ga0068858_100072336 Ga0068858_1000723362 407
281 3300006028 Ga0070717_10156006 Ga0070717_101560062 407
282 3300009094 Ga0111539_10039387 Ga0111539_100393875 407
283 3300009098 Ga0105245_10029952 Ga0105245_100299522 407
284 3300009098 Ga0105245_10160931 Ga0105245_101609311 407
285 3300009551 Ga0105238_10116573 Ga0105238_101165732 407
286 3300010375 Ga0105239_10347200 Ga0105239_103472002 407
287 3300013307 Ga0157372_10290920 Ga0157372_102909202 407
288 3300014969 Ga0157376_10209934 Ga0157376_102099341 407
289 3300021384 Ga0213876_10028039 Ga0213876_100280392 407
290 3300025901 Ga0207688_10002122 Ga0207688_100021222 407
291 3300025903 Ga0207680_10192684 Ga0207680_101926841 407
292 3300025904 Ga0207647_10073442 Ga0207647_100734421 407
293 3300025908 Ga0207643_10021007 Ga0207643_100210071 407
294 3300025914 Ga0207671_10049209 Ga0207671_100492092 407
295 3300025918 Ga0207662_10050034 Ga0207662_100500342 407
296 3300025920 Ga0207649_10030062 Ga0207649_100300622 407
297 3300025927 Ga0207687_10066367 Ga0207687_100663672 407
298 3300025931 Ga0207644_10208385 Ga0207644_102083852 407
299 3300025933 Ga0207706_10028318 Ga0207706_100283182 407
300 3300025940 Ga0207691_10160004 Ga0207691_101600042 407
301 3300025945 Ga0207679_10075109 Ga0207679_100751092 407
302 3300025960 Ga0207651_10102372 Ga0207651_101023721 407
303 3300025972 Ga0207668_10029075 Ga0207668_100290752 407
304 3300025981 Ga0207640_10120641 Ga0207640_101206412 407
305 3300026023 Ga0207677_10006844 Ga0207677_100068442 407
306 3300026023 Ga0207677_10065898 Ga0207677_100658982 407
307 3300026035 Ga0207703_10237376 Ga0207703_102373762 407
308 3300026067 Ga0207678_10008155 Ga0207678_100081554 407
309 3300026089 Ga0207648_10184695 Ga0207648_101846952 407
310 3300026121 Ga0207683_10152233 Ga0207683_101522332 407
311 3300028379 Ga0268266_10057306 Ga0268266_100573062 407
312 3300028380 Ga0268265_10023154 Ga0268265_100231543 407
313 3300048913 Ga0496110_0087546 Ga0496110_0087546_486_1709 407
314 3300048916 Ga0496113_0075375 Ga0496113_0075375_812_2035 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

311

429

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9522 16 407
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9471 16 407
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.9394 11 407
6kbh-assembly1.cif.gz_A crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase 0.9391 4 406
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.9369 11 407
ID Description Score Start End Superfamily
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9394 11 407 1.10.630.10
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9369 11 407 1.10.630.10
6gmfA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9368 6 405 1.10.630.10
5xjnA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9292 4 406 1.10.630.10
5xjnA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9226 4 406 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A535F343-F1-model_v4 Cytochrome P450 0.9619 198 406 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7C3QNC8-F1-model_v4 Cytochrome P450 0.9618 251 404 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A4Q3IEJ9-F1-model_v4 Cytochrome P450 0.9556 229 405 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A4Q3CSH2-F1-model_v4 Cytochrome P450 0.9546 230 406 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7Y4IPM7-F1-model_v4 Cytochrome P450 0.9541 4 406 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Feature Viewer

pLDDT pTM Quality
87.15 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map