F402677

General Info

Members Datasets Scaffolds Average Seq Length
314 177 628 340

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10030913|Ga0105246_100309132
Length 378
Sequence MYFSFVFIQQKSSLKQLIMKQIIGRCKSRVIIYLTLLLCIAATDVNAQKSKKASKTQAPAVATNALTSDKIQAALDEAYDKFKDLKEGKNADYIKELANVDPNIFGIALITVDGQVYTKGDIQSMVSIQSVSKVFTMARVLEEQGPKAVQDKIGVDATGMRFNSIVAVELQRGKEINPLVNPGAIASSSLINGADSAAKWKSIVDIQSQFAGRPLSLNMPVYISEAGDNLRNQAIAHLLYAYGRMYFDPVQSTDIYTKQCALNVNAKDLATMAATLANGGVNPVTKKKVVSPETVMYTLPVMATAGLYDDSGIWLFNSGLPAKSGVGGGLLAVCPGKFGIAVVSPPLDAAGNSVKAQKVIDYVVAKLKVNPYLVEPKN

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
175 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
176 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
177 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0.32
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0.64
Rhizoplane 2.23
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 12.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10030913 3300011119 Bacteria 3541
2 rootH1_10231578 3300003323 Bacteria 1474
3 Ga0058860_12246627 3300004801 Bacteria 1602
4 Ga0065712_10070589 3300005290 Bacteria 5873
5 Ga0065712_10079337 3300005290 Bacteria 3229
6 Ga0065712_10101081 3300005290 Bacteria 2045
7 Ga0065712_10134942 3300005290 Unclassified 1507
8 Ga0065715_10007911 3300005293 Bacteria 4791
9 Ga0065715_10145727 3300005293 Bacteria 1791
10 Ga0065707_10211891 3300005295 Bacteria 1262
11 Ga0070676_10041852 3300005328 Bacteria 2658
12 Ga0070683_100002959 3300005329 Bacteria 13616
13 Ga0070683_100011201 3300005329 Bacteria 7737
14 Ga0070683_100096963 3300005329 Bacteria 2774
15 Ga0070690_100006644 3300005330 Bacteria 6570
16 Ga0070670_100002111 3300005331 Bacteria 16313
17 Ga0070670_100057056 3300005331 Unclassified 3352
18 Ga0068869_100003205 3300005334 Bacteria 9999
19 Ga0070666_10000946 3300005335 Bacteria 17683
20 Ga0068868_100009435 3300005338 Bacteria 7022
21 Ga0068868_100010013 3300005338 Bacteria 6850
22 Ga0068868_100380394 3300005338 Unclassified 1215
23 Ga0070689_100030062 3300005340 Bacteria 4120
24 Ga0070689_100085141 3300005340 Bacteria 2485
25 Ga0070689_100121150 3300005340 Bacteria 2090
26 Ga0070691_10021658 3300005341 Bacteria 2975
27 Ga0070661_100001891 3300005344 Bacteria 14504
28 Ga0070661_100004444 3300005344 Bacteria 9666
29 Ga0070669_100124208 3300005353 Bacteria 1973
30 Ga0070669_100368299 3300005353 Bacteria 1170
31 Ga0070675_100022858 3300005354 Bacteria 4996
32 Ga0070675_100023224 3300005354 Bacteria 4956
33 Ga0070675_100034988 3300005354 Unclassified 4079
34 Ga0070675_100147618 3300005354 Bacteria 2014
35 Ga0070675_100420345 3300005354 Bacteria 1195
36 Ga0070671_100137285 3300005355 Bacteria 2062
37 Ga0070673_100131116 3300005364 Bacteria 2103
38 Ga0070673_100189004 3300005364 Unclassified 1768
39 Ga0070667_100029691 3300005367 Bacteria 4558
40 Ga0070667_100228855 3300005367 Bacteria 1657
41 Ga0070705_100000092 3300005440 Bacteria 50020
42 Ga0070708_100142735 3300005445 Bacteria 2222
43 Ga0070678_100131766 3300005456 Unclassified 1987
44 Ga0070662_100055538 3300005457 Unclassified 2873
45 Ga0070662_100098413 3300005457 Bacteria 2209
46 Ga0068867_100046720 3300005459 Bacteria 3181
47 Ga0070685_10188510 3300005466 Bacteria 1332
48 Ga0070707_100022233 3300005468 Bacteria 5995
49 Ga0070679_100058082 3300005530 Unclassified 3856
50 Ga0070684_100002611 3300005535 Bacteria 13310
51 Ga0070684_100121563 3300005535 Bacteria 2349
52 Ga0068853_100019187 3300005539 Bacteria 5666
53 Ga0068853_100193680 3300005539 Bacteria 1848
54 Ga0070672_100049998 3300005543 Bacteria 3255
55 Ga0070672_100178036 3300005543 Bacteria 1771
56 Ga0070686_100206763 3300005544 Unclassified 1410
57 Ga0070695_100000002 3300005545 Bacteria 128335
58 Ga0070695_100157946 3300005545 Bacteria 1589
59 Ga0070696_100000679 3300005546 Bacteria 21808
60 Ga0070665_100197639 3300005548 Unclassified 2012
61 Ga0070664_100000443 3300005564 Bacteria 31206
62 Ga0070664_100002629 3300005564 Bacteria 14481
63 Ga0070664_100029976 3300005564 Bacteria 4537
64 Ga0070664_100094049 3300005564 Bacteria 2599
65 Ga0068857_100026892 3300005577 Bacteria 5073
66 Ga0068857_100060972 3300005577 Bacteria 3351
67 Ga0070702_100026796 3300005615 Bacteria 3102
68 Ga0068852_100023523 3300005616 Bacteria 4960
69 Ga0068852_100194102 3300005616 Unclassified 1918
70 Ga0068864_100003482 3300005618 Bacteria 13006
71 Ga0068864_100106256 3300005618 Bacteria 2496
72 Ga0068866_10110080 3300005718 Bacteria 1535
73 Ga0068861_100099127 3300005719 Bacteria 2314
74 Ga0068851_10000071 3300005834 Bacteria 57578
75 Ga0068863_100000546 3300005841 Bacteria 38297
76 Ga0068863_100020117 3300005841 Bacteria 6385
77 Ga0068863_100030210 3300005841 Bacteria 5176
78 Ga0068863_100131694 3300005841 Unclassified 2388
79 Ga0068863_100185744 3300005841 Bacteria 1996
80 Ga0068863_100207315 3300005841 Bacteria 1887
81 Ga0068863_100299391 3300005841 Unclassified 1560
82 Ga0068858_100262615 3300005842 Bacteria 1641
83 Ga0068858_100305748 3300005842 Unclassified 1518
84 Ga0068860_100000650 3300005843 Bacteria 40578
85 Ga0068860_100114313 3300005843 Bacteria 2581
86 Ga0068860_100137594 3300005843 Unclassified 2346
87 Ga0068860_100450556 3300005843 Bacteria 1279
88 Ga0070712_100276488 3300006175 Bacteria 1351
89 Ga0097621_100017294 3300006237 Bacteria 5472
90 Ga0097621_100075454 3300006237 Bacteria 2795
91 Ga0097621_100192443 3300006237 Unclassified 1767
92 Ga0068871_100108050 3300006358 Bacteria 2337
93 Ga0075428_100012893 3300006844 Bacteria 9299
94 Ga0075434_100000752 3300006871 Bacteria 25541
95 Ga0075434_100280020 3300006871 Bacteria 1687
96 Ga0079104_1000463 3300006946 Bacteria 45836
97 Ga0075435_100123983 3300007076 Bacteria 2158
98 Ga0105245_10094886 3300009098 Bacteria 2751
99 Ga0114129_10002377 3300009147 Bacteria 26132
100 Ga0114129_10019340 3300009147 Bacteria 9699
101 Ga0105242_10004177 3300009176 Bacteria 11252
102 Ga0105242_10332723 3300009176 Unclassified 1397
103 Ga0105248_10013368 3300009177 Bacteria 9034
104 Ga0105248_10035227 3300009177 Bacteria 5599
105 Ga0105249_10274899 3300009553 Bacteria 1680
106 Ga0105249_10276363 3300009553 Bacteria 1675
107 Ga0105239_10177873 3300010375 Unclassified 2380
108 Ga0157373_10025360 3300013100 Bacteria 4289
109 Ga0157370_10073504 3300013104 Bacteria 3226
110 Ga0157370_10123038 3300013104 Bacteria 2422
111 Ga0157370_10476333 3300013104 Unclassified 1147
112 Ga0157374_10003633 3300013296 Bacteria 12972
113 Ga0157374_10047194 3300013296 Bacteria 3992
114 Ga0157374_10081850 3300013296 Bacteria 3064
115 Ga0157374_10110099 3300013296 Unclassified 2649
116 Ga0157374_10140557 3300013296 Bacteria 2344
117 Ga0157374_10191671 3300013296 Bacteria 2000
118 Ga0157378_10185556 3300013297 Unclassified 1959
119 Ga0163162_10000157 3300013306 Bacteria 62611
120 Ga0163162_10000715 3300013306 Bacteria 30803
121 Ga0163162_10015906 3300013306 Bacteria 7353
122 Ga0163162_10044889 3300013306 Bacteria 4428
123 Ga0163162_10050746 3300013306 Bacteria 4160
124 Ga0163162_10076614 3300013306 Unclassified 3407
125 Ga0163162_10175785 3300013306 Unclassified 2267
126 Ga0157372_10074071 3300013307 Bacteria 3838
127 Ga0157375_10002361 3300013308 Bacteria 16314
128 Ga0157375_10004861 3300013308 Bacteria 11676
129 Ga0157375_10015692 3300013308 Bacteria 6785
130 Ga0157375_10230367 3300013308 Unclassified 2012
131 Ga0157375_10303030 3300013308 Bacteria 1762
132 Ga0157375_10519291 3300013308 Unclassified 1354
133 Ga0163163_10000017 3300014325 Bacteria 208781
134 Ga0163163_10000495 3300014325 Bacteria 35470
135 Ga0163163_10001144 3300014325 Bacteria 22578
136 Ga0163163_10007804 3300014325 Bacteria 9460
137 Ga0163163_10010216 3300014325 Bacteria 8428
138 Ga0163163_10035758 3300014325 Bacteria 4821
139 Ga0163163_10059011 3300014325 Unclassified 3794
140 Ga0157380_10002057 3300014326 Bacteria 13459
141 Ga0157379_10004827 3300014968 Bacteria 11587
142 Ga0157379_10193278 3300014968 Unclassified 1839
143 Ga0157379_10247715 3300014968 Unclassified 1617
144 Ga0157376_10000068 3300014969 Bacteria 83824
145 Ga0157376_10019567 3300014969 Bacteria 5221
146 Ga0157376_10133397 3300014969 Bacteria 2219
147 Ga0157376_10164369 3300014969 Bacteria 2015
148 Ga0157376_10255441 3300014969 Bacteria 1639
149 Ga0182006_1009717 3300015261 Bacteria 4301
150 Ga0182006_1028419 3300015261 Bacteria 2274
151 Ga0182006_1040392 3300015261 Bacteria 1837
152 Ga0163161_10002013 3300017792 Bacteria 14703
153 Ga0163161_10018751 3300017792 Bacteria 4849
154 Ga0163161_10024582 3300017792 Unclassified 4257
155 Ga0207656_10000891 3300025321 Bacteria 9745
156 Ga0207656_10117905 3300025321 Bacteria 1233
157 Ga0207682_10048017 3300025893 Bacteria 1759
158 Ga0207680_10009970 3300025903 Bacteria 4733
159 Ga0207645_10040499 3300025907 Bacteria 2983
160 Ga0207645_10188380 3300025907 Unclassified 1355
161 Ga0207693_10055312 3300025915 Bacteria 3114
162 Ga0207662_10282588 3300025918 Bacteria 1098
163 Ga0207657_10062235 3300025919 Bacteria 3196
164 Ga0207649_10001696 3300025920 Bacteria 12706
165 Ga0207649_10011024 3300025920 Bacteria 4974
166 Ga0207652_10112252 3300025921 Bacteria 2418
167 Ga0207681_10095948 3300025923 Bacteria 2128
168 Ga0207650_10002431 3300025925 Bacteria 12967
169 Ga0207650_10006829 3300025925 Bacteria 7786
170 Ga0207650_10041782 3300025925 Unclassified 3361
171 Ga0207659_10015802 3300025926 Bacteria 4903
172 Ga0207644_10137689 3300025931 Bacteria 1876
173 Ga0207706_10082386 3300025933 Unclassified 2828
174 Ga0207686_10002939 3300025934 Bacteria 9182
175 Ga0207670_10009696 3300025936 Bacteria 5508
176 Ga0207670_10190126 3300025936 Bacteria 1553
177 Ga0207704_10053357 3300025938 Bacteria 2457
178 Ga0207691_10064738 3300025940 Bacteria 3311
179 Ga0207691_10255379 3300025940 Bacteria 1512
180 Ga0207711_10023130 3300025941 Bacteria 5202
181 Ga0207689_10003244 3300025942 Bacteria 14908
182 Ga0207661_10002094 3300025944 Bacteria 13733
183 Ga0207661_10023102 3300025944 Bacteria 4695
184 Ga0207661_10073629 3300025944 Bacteria 2798
185 Ga0207679_10001688 3300025945 Bacteria 13745
186 Ga0207679_10014801 3300025945 Bacteria 5138
187 Ga0207679_10229228 3300025945 Bacteria 1567
188 Ga0207651_10148276 3300025960 Unclassified 1822
189 Ga0207712_10027810 3300025961 Bacteria 3778
190 Ga0207668_10071744 3300025972 Bacteria 2475
191 Ga0207640_10104651 3300025981 Bacteria 1993
192 Ga0207658_10021472 3300025986 Bacteria 4483
193 Ga0207677_10024263 3300026023 Bacteria 3764
194 Ga0207677_10036625 3300026023 Bacteria 3200
195 Ga0207677_10037529 3300026023 Bacteria 3168
196 Ga0207703_10033563 3300026035 Unclassified 4070
197 Ga0207703_10155928 3300026035 Bacteria 1995
198 Ga0207639_10014110 3300026041 Bacteria 5610
199 Ga0207641_10000539 3300026088 Bacteria 42499
200 Ga0207641_10038914 3300026088 Unclassified 3976
201 Ga0207641_10109849 3300026088 Bacteria 2443
202 Ga0207641_10160404 3300026088 Bacteria 2044
203 Ga0207648_10022158 3300026089 Bacteria 5707
204 Ga0207676_10085019 3300026095 Bacteria 2580
205 Ga0207674_10009074 3300026116 Bacteria 11419
206 Ga0207674_10011804 3300026116 Bacteria 9801
207 Ga0207674_10236078 3300026116 Bacteria 1776
208 Ga0207683_10086316 3300026121 Bacteria 2790
209 Ga0207683_10102677 3300026121 Bacteria 2554
210 Ga0207698_10169664 3300026142 Unclassified 1920
211 Ga0209281_1000158 3300027111 Bacteria 162280
212 Ga0268264_10000809 3300028381 Bacteria 33699
213 Ga0268264_10071656 3300028381 Bacteria 2937
214 Ga0268264_10461003 3300028381 Bacteria 1233
215 Ga0265327_10000055 3300031251 Bacteria 247188
216 Ga0307513_10293313 3300031456 Bacteria 1397
217 Ga0307509_10005400 3300031507 Bacteria 17788
218 Ga0307509_10308483 3300031507 Bacteria 1326
219 Ga0307405_10360430 3300031731 Bacteria 1125
220 Ga0373956_0024748 3300035119 Bacteria 2590
221 Ga0373937_0091021 3300036401 Bacteria 2826
222 Ga0373937_0139852 3300036401 Bacteria 2264
223 Ga0373937_0248194 3300036401 Bacteria 1678
224 Ga0395905_0002208 3300037471 Bacteria 21964
225 Ga0395905_0120987 3300037471 Bacteria 2461
226 Ga0451853_0679548 3300041512 Bacteria 2675
227 Ga0451577_0007475 3300042876 Bacteria 10732
228 Ga0451577_0015990 3300042876 Bacteria 6961
229 Ga0451577_0052029 3300042876 Bacteria 3657
230 Ga0451577_0279128 3300042876 Bacteria 1513
231 Ga0451577_0391320 3300042876 Bacteria 1262
232 Ga0453683_0000061 3300044673 Bacteria 185470
233 Ga0453683_0001251 3300044673 Bacteria 22656
234 Ga0453684_0018867 3300044712 Bacteria 10552
235 Ga0453684_0042477 3300044712 Bacteria 6128
236 Ga0453684_0083382 3300044712 Bacteria 3979
237 Ga0453684_0157497 3300044712 Bacteria 2691
238 Ga0451576_0003195 3300045051 Bacteria 22866
239 Ga0451576_0006895 3300045051 Bacteria 13754
240 Ga0451576_0013001 3300045051 Bacteria 9324
241 Ga0451576_0019279 3300045051 Bacteria 7447
242 Ga0451576_0089345 3300045051 Bacteria 3204
243 Ga0495592_0017846 3300046454 Bacteria 5394
244 Ga0495592_0018627 3300046454 Bacteria 5284
245 Ga0495580_0000804 3300046472 Bacteria 27141
246 Ga0495580_0002063 3300046472 Bacteria 17655
247 Ga0495580_0127816 3300046472 Bacteria 1764
248 Ga0495582_0116228 3300046473 Bacteria 1505
249 Ga0495608_0022834 3300046511 Bacteria 4292
250 Ga0495616_0023519 3300046513 Bacteria 3314
251 Ga0495618_0137899 3300046514 Bacteria 1560
252 Ga0495630_0104894 3300046517 Bacteria 2140
253 Ga0495630_0124887 3300046517 Bacteria 1953
254 Ga0495643_0001113 3300046522 Bacteria 26671
255 Ga0495663_0025389 3300046525 Bacteria 1727
256 Ga0495642_0043983 3300046528 Bacteria 1822
257 Ga0495609_0024327 3300046538 Bacteria 2779
258 Ga0495621_0000305 3300046539 Bacteria 11855
259 Ga0495621_0004823 3300046539 Bacteria 3824
260 Ga0495633_0129560 3300046558 Bacteria 1167
261 Ga0495667_0006441 3300046559 Bacteria 7966
262 Ga0495634_0024593 3300046642 Bacteria 4224
263 Ga0495625_0144952 3300046660 Bacteria 1599
264 Ga0495659_0009340 3300046664 Bacteria 3129
265 Ga0495659_0023741 3300046664 Bacteria 2086
266 Ga0495657_0001591 3300046675 Bacteria 19526
267 Ga0495647_0021202 3300046681 Bacteria 2338
268 Ga0495658_0077014 3300046683 Bacteria 1950
269 Ga0495658_0243528 3300046683 Bacteria 1130
270 Ga0495669_0005093 3300046684 Bacteria 5471
271 Ga0495613_0003659 3300046689 Bacteria 11521
272 Ga0495636_0000113 3300047318 Bacteria 33691
273 Ga0495674_0035758 3300047319 Bacteria 4478
274 Ga0495672_0082764 3300047320 Unclassified 1784
275 Ga0495677_0072800 3300047445 Bacteria 1282
276 Ga0495684_0023703 3300047471 Bacteria 4720
277 Ga0495684_0026884 3300047471 Bacteria 4421
278 Ga0495684_0094925 3300047471 Bacteria 2258
279 Ga0495684_0117668 3300047471 Bacteria 2003
280 Ga0495602_0056091 3300048088 Bacteria 3467
281 Ga0495602_0194627 3300048088 Bacteria 1552
282 Ga0496100_0108017 3300048903 Bacteria 1929
283 Ga0496102_0342545 3300048905 Bacteria 1408
284 Ga0496105_0184264 3300048908 Bacteria 1709
285 Ga0496109_0244388 3300048912 Bacteria 1690
286 Ga0496110_0082166 3300048913 Bacteria 2873
287 Ga0496114_0000077 3300048917 Bacteria 70285
288 Ga0496114_0095320 3300048917 Bacteria 2532
289 Ga0501036_0022041 3300049572 Bacteria 5357
290 Ga0501042_0014389 3300049578 Bacteria 5400
291 Ga0501048_0084344 3300049582 Bacteria 2240
292 Ga0501074_0240668 3300049590 Bacteria 1287
293 Ga0501076_0004526 3300049592 Bacteria 9901
294 Ga0501044_0427529 3300049823 Bacteria 1234
295 Ga0501045_0050762 3300049824 Bacteria 3027
296 Ga0501045_0184991 3300049824 Bacteria 1552
297 nmdc:mga08y16_155932_c1 3300050511 Bacteria 2373
298 nmdc:mga0n895_270450_c1 3300050512 Bacteria 1724
299 nmdc:mga08x19_187818_c1 3300050514 Bacteria 1413
300 nmdc:mga0a205_15367_c1 3300050515 Bacteria 7154
301 nmdc:mga0a205_405340_c1 3300050515 Bacteria 1227
302 Ga0495619_0118539 3300053085 Bacteria 1814
303 Ga0495619_0180985 3300053085 Bacteria 1458
304 Ga0500578_0000003 3300053086 Bacteria 266033
305 Ga0500583_0000038 3300053092 Bacteria 89399
306 Ga0500583_0008626 3300053092 Bacteria 3672
307 Ga0500568_0046665 3300053139 Bacteria 1718
308 Ga0500622_0003243 3300053156 Bacteria 11048
309 Ga0500622_0021758 3300053156 Unclassified 3402
310 Ga0500584_050998 3300053726 Bacteria 1873
311 2958459932 2958458903 Bacteria 5301041
312 8055419233 8055419101 Bacteria 5289643
313 8055419731 8055419101 Bacteria 5289643
314 8055595997 8055592153 Bacteria 5961247
315 Ga0105246_10030913
316 rootH1_10231578
317 Ga0058860_12246627
318 Ga0065712_10070589
319 Ga0065712_10079337
320 Ga0065712_10101081
321 Ga0065712_10134942
322 Ga0065715_10007911
323 Ga0065715_10145727
324 Ga0065707_10211891
325 Ga0070676_10041852
326 Ga0070683_100002959
327 Ga0070683_100011201
328 Ga0070683_100096963
329 Ga0070690_100006644
330 Ga0070670_100002111
331 Ga0070670_100057056
332 Ga0068869_100003205
333 Ga0070666_10000946
334 Ga0068868_100009435
335 Ga0068868_100010013
336 Ga0068868_100380394
337 Ga0070689_100030062
338 Ga0070689_100085141
339 Ga0070689_100121150
340 Ga0070691_10021658
341 Ga0070661_100001891
342 Ga0070661_100004444
343 Ga0070669_100124208
344 Ga0070669_100368299
345 Ga0070675_100022858
346 Ga0070675_100023224
347 Ga0070675_100034988
348 Ga0070675_100147618
349 Ga0070675_100420345
350 Ga0070671_100137285
351 Ga0070673_100131116
352 Ga0070673_100189004
353 Ga0070667_100029691
354 Ga0070667_100228855
355 Ga0070705_100000092
356 Ga0070708_100142735
357 Ga0070678_100131766
358 Ga0070662_100055538
359 Ga0070662_100098413
360 Ga0068867_100046720
361 Ga0070685_10188510
362 Ga0070707_100022233
363 Ga0070679_100058082
364 Ga0070684_100002611
365 Ga0070684_100121563
366 Ga0068853_100019187
367 Ga0068853_100193680
368 Ga0070672_100049998
369 Ga0070672_100178036
370 Ga0070686_100206763
371 Ga0070695_100000002
372 Ga0070695_100157946
373 Ga0070696_100000679
374 Ga0070665_100197639
375 Ga0070664_100000443
376 Ga0070664_100002629
377 Ga0070664_100029976
378 Ga0070664_100094049
379 Ga0068857_100026892
380 Ga0068857_100060972
381 Ga0070702_100026796
382 Ga0068852_100023523
383 Ga0068852_100194102
384 Ga0068864_100003482
385 Ga0068864_100106256
386 Ga0068866_10110080
387 Ga0068861_100099127
388 Ga0068851_10000071
389 Ga0068863_100000546
390 Ga0068863_100020117
391 Ga0068863_100030210
392 Ga0068863_100131694
393 Ga0068863_100185744
394 Ga0068863_100207315
395 Ga0068863_100299391
396 Ga0068858_100262615
397 Ga0068858_100305748
398 Ga0068860_100000650
399 Ga0068860_100114313
400 Ga0068860_100137594
401 Ga0068860_100450556
402 Ga0070712_100276488
403 Ga0097621_100017294
404 Ga0097621_100075454
405 Ga0097621_100192443
406 Ga0068871_100108050
407 Ga0075428_100012893
408 Ga0075434_100000752
409 Ga0075434_100280020
410 Ga0079104_1000463
411 Ga0075435_100123983
412 Ga0105245_10094886
413 Ga0114129_10002377
414 Ga0114129_10019340
415 Ga0105242_10004177
416 Ga0105242_10332723
417 Ga0105248_10013368
418 Ga0105248_10035227
419 Ga0105249_10274899
420 Ga0105249_10276363
421 Ga0105239_10177873
422 Ga0157373_10025360
423 Ga0157370_10073504
424 Ga0157370_10123038
425 Ga0157370_10476333
426 Ga0157374_10003633
427 Ga0157374_10047194
428 Ga0157374_10081850
429 Ga0157374_10110099
430 Ga0157374_10140557
431 Ga0157374_10191671
432 Ga0157378_10185556
433 Ga0163162_10000157
434 Ga0163162_10000715
435 Ga0163162_10015906
436 Ga0163162_10044889
437 Ga0163162_10050746
438 Ga0163162_10076614
439 Ga0163162_10175785
440 Ga0157372_10074071
441 Ga0157375_10002361
442 Ga0157375_10004861
443 Ga0157375_10015692
444 Ga0157375_10230367
445 Ga0157375_10303030
446 Ga0157375_10519291
447 Ga0163163_10000017
448 Ga0163163_10000495
449 Ga0163163_10001144
450 Ga0163163_10007804
451 Ga0163163_10010216
452 Ga0163163_10035758
453 Ga0163163_10059011
454 Ga0157380_10002057
455 Ga0157379_10004827
456 Ga0157379_10193278
457 Ga0157379_10247715
458 Ga0157376_10000068
459 Ga0157376_10019567
460 Ga0157376_10133397
461 Ga0157376_10164369
462 Ga0157376_10255441
463 Ga0182006_1009717
464 Ga0182006_1028419
465 Ga0182006_1040392
466 Ga0163161_10002013
467 Ga0163161_10018751
468 Ga0163161_10024582
469 Ga0207656_10000891
470 Ga0207656_10117905
471 Ga0207682_10048017
472 Ga0207680_10009970
473 Ga0207645_10040499
474 Ga0207645_10188380
475 Ga0207693_10055312
476 Ga0207662_10282588
477 Ga0207657_10062235
478 Ga0207649_10001696
479 Ga0207649_10011024
480 Ga0207652_10112252
481 Ga0207681_10095948
482 Ga0207650_10002431
483 Ga0207650_10006829
484 Ga0207650_10041782
485 Ga0207659_10015802
486 Ga0207644_10137689
487 Ga0207706_10082386
488 Ga0207686_10002939
489 Ga0207670_10009696
490 Ga0207670_10190126
491 Ga0207704_10053357
492 Ga0207691_10064738
493 Ga0207691_10255379
494 Ga0207711_10023130
495 Ga0207689_10003244
496 Ga0207661_10002094
497 Ga0207661_10023102
498 Ga0207661_10073629
499 Ga0207679_10001688
500 Ga0207679_10014801
501 Ga0207679_10229228
502 Ga0207651_10148276
503 Ga0207712_10027810
504 Ga0207668_10071744
505 Ga0207640_10104651
506 Ga0207658_10021472
507 Ga0207677_10024263
508 Ga0207677_10036625
509 Ga0207677_10037529
510 Ga0207703_10033563
511 Ga0207703_10155928
512 Ga0207639_10014110
513 Ga0207641_10000539
514 Ga0207641_10038914
515 Ga0207641_10109849
516 Ga0207641_10160404
517 Ga0207648_10022158
518 Ga0207676_10085019
519 Ga0207674_10009074
520 Ga0207674_10011804
521 Ga0207674_10236078
522 Ga0207683_10086316
523 Ga0207683_10102677
524 Ga0207698_10169664
525 Ga0209281_1000158
526 Ga0268264_10000809
527 Ga0268264_10071656
528 Ga0268264_10461003
529 Ga0265327_10000055
530 Ga0307513_10293313
531 Ga0307509_10005400
532 Ga0307509_10308483
533 Ga0307405_10360430
534 Ga0373956_0024748
535 Ga0373937_0091021
536 Ga0373937_0139852
537 Ga0373937_0248194
538 Ga0395905_0002208
539 Ga0395905_0120987
540 Ga0451853_0679548
541 Ga0451577_0007475
542 Ga0451577_0015990
543 Ga0451577_0052029
544 Ga0451577_0279128
545 Ga0451577_0391320
546 Ga0453683_0000061
547 Ga0453683_0001251
548 Ga0453684_0018867
549 Ga0453684_0042477
550 Ga0453684_0083382
551 Ga0453684_0157497
552 Ga0451576_0003195
553 Ga0451576_0006895
554 Ga0451576_0013001
555 Ga0451576_0019279
556 Ga0451576_0089345
557 Ga0495592_0017846
558 Ga0495592_0018627
559 Ga0495580_0000804
560 Ga0495580_0002063
561 Ga0495580_0127816
562 Ga0495582_0116228
563 Ga0495608_0022834
564 Ga0495616_0023519
565 Ga0495618_0137899
566 Ga0495630_0104894
567 Ga0495630_0124887
568 Ga0495643_0001113
569 Ga0495663_0025389
570 Ga0495642_0043983
571 Ga0495609_0024327
572 Ga0495621_0000305
573 Ga0495621_0004823
574 Ga0495633_0129560
575 Ga0495667_0006441
576 Ga0495634_0024593
577 Ga0495625_0144952
578 Ga0495659_0009340
579 Ga0495659_0023741
580 Ga0495657_0001591
581 Ga0495647_0021202
582 Ga0495658_0077014
583 Ga0495658_0243528
584 Ga0495669_0005093
585 Ga0495613_0003659
586 Ga0495636_0000113
587 Ga0495674_0035758
588 Ga0495672_0082764
589 Ga0495677_0072800
590 Ga0495684_0023703
591 Ga0495684_0026884
592 Ga0495684_0094925
593 Ga0495684_0117668
594 Ga0495602_0056091
595 Ga0495602_0194627
596 Ga0496100_0108017
597 Ga0496102_0342545
598 Ga0496105_0184264
599 Ga0496109_0244388
600 Ga0496110_0082166
601 Ga0496114_0000077
602 Ga0496114_0095320
603 Ga0501036_0022041
604 Ga0501042_0014389
605 Ga0501048_0084344
606 Ga0501074_0240668
607 Ga0501076_0004526
608 Ga0501044_0427529
609 Ga0501045_0050762
610 Ga0501045_0184991
611 nmdc:mga08y16_155932_c1
612 nmdc:mga0n895_270450_c1
613 nmdc:mga08x19_187818_c1
614 nmdc:mga0a205_15367_c1
615 nmdc:mga0a205_405340_c1
616 Ga0495619_0118539
617 Ga0495619_0180985
618 Ga0500578_0000003
619 Ga0500583_0000038
620 Ga0500583_0008626
621 Ga0500568_0046665
622 Ga0500622_0003243
623 Ga0500622_0021758
624 Ga0500584_050998
625 2958459932
626 8055419233
627 8055419731
628 8055595997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04960

Glutaminase

Glutaminase

88

372

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u60-assembly1.cif.gz_A mcsg apc5046 probable glutaminase ybas 0.9605 19 307
2pby-assembly1.cif.gz_D probable glutaminase from geobacillus kaustophilus hta426 0.9564 22 307
1mki-assembly1.cif.gz_A crystal structure of bacillus subtilis probable glutaminase, apc1040 0.9548 44 306
2pby-assembly1.cif.gz_B probable glutaminase from geobacillus kaustophilus hta426 0.9528 22 307
2pby-assembly1.cif.gz_C probable glutaminase from geobacillus kaustophilus hta426 0.9509 22 307
ID Description Score Start End Superfamily
1u60D00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9838 28 307 3.40.710.10
af_P0A6W0_5_308_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9432 22 307 3.40.710.10
3ih9B01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9397 22 308 3.40.710.10
2pbyD01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9302 22 305 3.40.710.10
1mkiB02 Mainly Alpha;Orthogonal Bundle;Probable Glutaminase Ybgj; Chain: A, domain 2; 0.9287 71 201 1.10.1500.10
ID Description Score Start End GO Terms
AF-A0A0Q7UHB1-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9915 27 305 GO:0004359
GO:0006537
GO:0006543
AF-A0A1Z8LZI9-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9913 26 307 GO:0004359
GO:0006537
GO:0006543
AF-A0A7Y5FID7-F1-model_v4 deleted 0.9913 200 307
AF-A0A539DPU2-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9897 116 307 GO:0004359
GO:0006537
GO:0006543
AF-A0A2W4LZ36-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9897 209 307 GO:0004359
GO:0006537
GO:0006543

Map