F402591

General Info

Members Datasets Scaffolds Average Seq Length
314 166 628 186

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100432062|Ga0070704_1004320622
Length 185
Sequence MTGLSALWLPILVSAVLVFVASSLIHMASPWHKGDYPKLSNETQVMDALRPLSIPIGDYMMPRPSSREEMRSPAFAERMKAGPVVMFTVMPPEMSMGRNLAMWFGYCVVVGVFAAYIAGRALPPGSQYLQVFRFAGATAFIAYAVALWQMSIWYRRAWATTIKSTADGLIYACLTAGAFGWLWPR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.55
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 30.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100432062 3300005549 Unclassified 1130
2 Ga0065715_10166157 3300005293 Bacteria 1585
3 Ga0065707_10084279 3300005295 Bacteria 7392
4 Ga0070676_10946257 3300005328 Unclassified 644
5 Ga0070683_100002358 3300005329 Bacteria 14998
6 Ga0070690_100548094 3300005330 Bacteria 872
7 Ga0070670_100070631 3300005331 Bacteria 2998
8 Ga0070670_100307934 3300005331 Bacteria 1386
9 Ga0070670_100393758 3300005331 Unclassified 1222
10 Ga0068869_100151747 3300005334 Unclassified 1797
11 Ga0070660_100144000 3300005339 Bacteria 1914
12 Ga0070689_100104059 3300005340 Bacteria 2250
13 Ga0070689_101514151 3300005340 Unclassified 608
14 Ga0070661_100002797 3300005344 Bacteria 11974
15 Ga0070661_100030885 3300005344 Bacteria 3872
16 Ga0070692_10015757 3300005345 Bacteria 3581
17 Ga0070669_100001505 3300005353 Bacteria 16843
18 Ga0070669_100120685 3300005353 Bacteria 1999
19 Ga0070669_100423886 3300005353 Unclassified 1092
20 Ga0070675_100068108 3300005354 Bacteria 2947
21 Ga0070675_100115290 3300005354 Unclassified 2277
22 Ga0070675_100553395 3300005354 Unclassified 1040
23 Ga0070671_100095496 3300005355 Bacteria 2492
24 Ga0070674_100800055 3300005356 Unclassified 814
25 Ga0070673_100030015 3300005364 Unclassified 4062
26 Ga0070673_100075760 3300005364 Bacteria 2715
27 Ga0070688_100825413 3300005365 Unclassified 727
28 Ga0070659_100108303 3300005366 Bacteria 2241
29 Ga0070667_100094005 3300005367 Bacteria 2583
30 Ga0070667_101174325 3300005367 Bacteria 718
31 Ga0070709_10001847 3300005434 Bacteria 11480
32 Ga0070713_100393444 3300005436 Unclassified 1293
33 Ga0070701_10014741 3300005438 Bacteria 3591
34 Ga0070701_10037933 3300005438 Unclassified 2435
35 Ga0070711_100000048 3300005439 Bacteria 74696
36 Ga0070711_100225724 3300005439 Bacteria 1458
37 Ga0070705_100309077 3300005440 Unclassified 1136
38 Ga0070705_101092685 3300005440 Unclassified 652
39 Ga0070700_100203822 3300005441 Bacteria 1391
40 Ga0070700_100213220 3300005441 Unclassified 1364
41 Ga0070694_100114959 3300005444 Bacteria 1922
42 Ga0070708_100056670 3300005445 Unclassified 3487
43 Ga0070708_100086833 3300005445 Bacteria 2842
44 Ga0070663_100086653 3300005455 Bacteria 2313
45 Ga0070662_100001205 3300005457 Bacteria 15896
46 Ga0070662_100005222 3300005457 Bacteria 8285
47 Ga0070662_100092901 3300005457 Unclassified 2269
48 Ga0070662_100296507 3300005457 Bacteria 1312
49 Ga0070681_10135588 3300005458 Bacteria 2392
50 Ga0070681_10168426 3300005458 Bacteria 2113
51 Ga0070706_100444978 3300005467 Unclassified 1206
52 Ga0070706_100458235 3300005467 Unclassified 1186
53 Ga0070707_100012289 3300005468 Bacteria 7996
54 Ga0070707_100345111 3300005468 Bacteria 1446
55 Ga0070698_100058051 3300005471 Bacteria 3913
56 Ga0070698_100213152 3300005471 Bacteria 1865
57 Ga0070698_100431650 3300005471 Unclassified 1252
58 Ga0070699_100011623 3300005518 Bacteria 7599
59 Ga0070699_100185183 3300005518 Bacteria 1849
60 Ga0070699_100186671 3300005518 Unclassified 1841
61 Ga0070699_100241401 3300005518 Bacteria 1613
62 Ga0070699_100299876 3300005518 Bacteria 1442
63 Ga0070699_100551369 3300005518 Bacteria 1049
64 Ga0070684_100001415 3300005535 Bacteria 17264
65 Ga0070684_100350572 3300005535 Unclassified 1358
66 Ga0070697_100012642 3300005536 Bacteria 6612
67 Ga0070697_100140402 3300005536 Unclassified 2031
68 Ga0070697_100510410 3300005536 Unclassified 1052
69 Ga0068853_100170358 3300005539 Bacteria 1969
70 Ga0070672_100033739 3300005543 Bacteria 3879
71 Ga0070672_100675120 3300005543 Unclassified 903
72 Ga0070686_100950072 3300005544 Bacteria 702
73 Ga0070695_100009335 3300005545 Bacteria 5833
74 Ga0070695_100017247 3300005545 Unclassified 4377
75 Ga0070696_100009360 3300005546 Bacteria 6559
76 Ga0070704_100000222 3300005549 Bacteria 23894
77 Ga0070704_100011366 3300005549 Bacteria 5454
78 Ga0068855_100027598 3300005563 Bacteria 6791
79 Ga0070664_100008591 3300005564 Bacteria 8263
80 Ga0070664_100490630 3300005564 Bacteria 1131
81 Ga0068857_100287964 3300005577 Bacteria 1512
82 Ga0068859_100016149 3300005617 Bacteria 7496
83 Ga0068864_100324900 3300005618 Bacteria 1446
84 Ga0068864_100495888 3300005618 Bacteria 1174
85 Ga0068861_100035442 3300005719 Bacteria 3696
86 Ga0068863_100009342 3300005841 Bacteria 9570
87 Ga0068858_100039930 3300005842 Bacteria 4351
88 Ga0068860_100075212 3300005843 Bacteria 3212
89 Ga0068860_100767461 3300005843 Bacteria 976
90 Ga0068862_100016532 3300005844 Bacteria 6142
91 Ga0068862_100047370 3300005844 Bacteria 3668
92 Ga0068862_100119300 3300005844 Unclassified 2323
93 Ga0068862_100253205 3300005844 Bacteria 1605
94 Ga0068862_100570638 3300005844 Unclassified 1083
95 Ga0070716_100065658 3300006173 Bacteria 2114
96 Ga0070716_100211407 3300006173 Bacteria 1296
97 Ga0070712_101192472 3300006175 Unclassified 662
98 Ga0075428_100000058 3300006844 Bacteria 89652
99 Ga0075428_100010885 3300006844 Bacteria 10114
100 Ga0075428_100062937 3300006844 Bacteria 4062
101 Ga0075428_100728961 3300006844 Bacteria 1055
102 Ga0075428_101173084 3300006844 Bacteria 810
103 Ga0075431_100005593 3300006847 Bacteria 12411
104 Ga0075431_100053614 3300006847 Bacteria 4158
105 Ga0075431_100060534 3300006847 Unclassified 3907
106 Ga0075431_100447724 3300006847 Bacteria 1287
107 Ga0075433_10029361 3300006852 Bacteria 4684
108 Ga0075433_10214367 3300006852 Bacteria 1711
109 Ga0075433_10231482 3300006852 Bacteria 1641
110 Ga0075433_10241987 3300006852 Bacteria 1602
111 Ga0075433_10558209 3300006852 Bacteria 1006
112 Ga0075433_10673452 3300006852 Unclassified 907
113 Ga0075434_100013317 3300006871 Bacteria 7822
114 Ga0075434_100044464 3300006871 Bacteria 4406
115 Ga0075434_100094338 3300006871 Bacteria 2997
116 Ga0075434_100195113 3300006871 Unclassified 2045
117 Ga0075434_100689726 3300006871 Bacteria 1039
118 Ga0075434_100691435 3300006871 Bacteria 1038
119 Ga0075429_100000045 3300006880 Bacteria 56854
120 Ga0075429_100080073 3300006880 Bacteria 2847
121 Ga0075429_100103208 3300006880 Bacteria 2490
122 Ga0068865_100319769 3300006881 Unclassified 1248
123 Ga0075436_100004228 3300006914 Bacteria 9855
124 Ga0075436_100012028 3300006914 Bacteria 5936
125 Ga0075436_100030525 3300006914 Bacteria 3710
126 Ga0075436_100086632 3300006914 Unclassified 2175
127 Ga0075436_100132245 3300006914 Bacteria 1750
128 Ga0097620_100016149 3300006931 Bacteria 7496
129 Ga0075435_100063415 3300007076 Bacteria 3001
130 Ga0075435_100095103 3300007076 Bacteria 2464
131 Ga0075435_100227413 3300007076 Bacteria 1585
132 Ga0075435_100898986 3300007076 Unclassified 772
133 Ga0099794_10013127 3300007265 Bacteria 3598
134 Ga0099794_10105963 3300007265 Bacteria 1406
135 Ga0111539_10000691 3300009094 Bacteria 43728
136 Ga0111539_10081621 3300009094 Bacteria 3803
137 Ga0111539_10647416 3300009094 Bacteria 1231
138 Ga0111539_11193795 3300009094 Unclassified 884
139 Ga0105245_10702040 3300009098 Bacteria 1045
140 Ga0105247_10301792 3300009101 Bacteria 1111
141 Ga0114129_10003915 3300009147 Bacteria 21010
142 Ga0114129_10020053 3300009147 Bacteria 9514
143 Ga0114129_10030971 3300009147 Bacteria 7565
144 Ga0114129_10052599 3300009147 Bacteria 5716
145 Ga0114129_10060708 3300009147 Bacteria 5286
146 Ga0114129_10127433 3300009147 Bacteria 3499
147 Ga0114129_10227218 3300009147 Bacteria 2515
148 Ga0114129_10410824 3300009147 Unclassified 1782
149 Ga0114129_11222936 3300009147 Bacteria 935
150 Ga0105248_10039152 3300009177 Bacteria 5309
151 Ga0105249_10016155 3300009553 Bacteria 6619
152 Ga0105249_10026967 3300009553 Bacteria 5181
153 Ga0105249_10798698 3300009553 Unclassified 1008
154 Ga0105249_10799737 3300009553 Bacteria 1007
155 Ga0157374_10675884 3300013296 Bacteria 1045
156 Ga0163162_11017156 3300013306 Unclassified 937
157 Ga0163162_12200957 3300013306 Unclassified 633
158 Ga0157372_10317331 3300013307 Bacteria 1814
159 Ga0157375_10215924 3300013308 Unclassified 2076
160 Ga0163163_10179415 3300014325 Bacteria 2165
161 Ga0163163_10285231 3300014325 Bacteria 1703
162 Ga0157380_10056019 3300014326 Unclassified 3133
163 Ga0157377_10142958 3300014745 Bacteria 1472
164 Ga0157377_10461857 3300014745 Unclassified 879
165 Ga0157379_10080998 3300014968 Unclassified 2908
166 Ga0207697_10261908 3300025315 Unclassified 766
167 Ga0207653_10014388 3300025885 Bacteria 2483
168 Ga0207710_10161312 3300025900 Bacteria 1092
169 Ga0207699_10001042 3300025906 Bacteria 13072
170 Ga0207645_10106000 3300025907 Bacteria 1817
171 Ga0207643_10318504 3300025908 Unclassified 971
172 Ga0207684_10478761 3300025910 Unclassified 1068
173 Ga0207684_10778686 3300025910 Unclassified 810
174 Ga0207707_10247316 3300025912 Bacteria 1549
175 Ga0207663_10000146 3300025916 Bacteria 32603
176 Ga0207663_10422920 3300025916 Bacteria 1023
177 Ga0207649_10039929 3300025920 Bacteria 2848
178 Ga0207649_10529633 3300025920 Bacteria 899
179 Ga0207646_10021234 3300025922 Bacteria 6002
180 Ga0207681_10010294 3300025923 Bacteria 5720
181 Ga0207681_10686582 3300025923 Unclassified 850
182 Ga0207650_10054941 3300025925 Bacteria 2955
183 Ga0207650_10284599 3300025925 Unclassified 1347
184 Ga0207650_10510196 3300025925 Bacteria 1005
185 Ga0207650_10742017 3300025925 Unclassified 831
186 Ga0207659_10104954 3300025926 Unclassified 2137
187 Ga0207659_10262997 3300025926 Unclassified 1404
188 Ga0207706_10001443 3300025933 Bacteria 23790
189 Ga0207706_10122921 3300025933 Unclassified 2283
190 Ga0207706_10635658 3300025933 Unclassified 915
191 Ga0207709_10045105 3300025935 Bacteria 2668
192 Ga0207670_10618224 3300025936 Unclassified 891
193 Ga0207669_10086951 3300025937 Unclassified 2023
194 Ga0207665_10025419 3300025939 Bacteria 3907
195 Ga0207665_10067714 3300025939 Unclassified 2432
196 Ga0207665_10583779 3300025939 Bacteria 871
197 Ga0207691_10000324 3300025940 Bacteria 47531
198 Ga0207691_10039205 3300025940 Unclassified 4382
199 Ga0207711_10032223 3300025941 Bacteria 4431
200 Ga0207711_10408974 3300025941 Bacteria 1261
201 Ga0207689_10006123 3300025942 Bacteria 10642
202 Ga0207689_11063364 3300025942 Unclassified 682
203 Ga0207661_10009574 3300025944 Bacteria 6955
204 Ga0207661_10337059 3300025944 Unclassified 1358
205 Ga0207679_10006506 3300025945 Bacteria 7386
206 Ga0207667_10197909 3300025949 Bacteria 2061
207 Ga0207667_10232036 3300025949 Bacteria 1889
208 Ga0207651_10581233 3300025960 Unclassified 977
209 Ga0207712_10006915 3300025961 Bacteria 7158
210 Ga0207712_10043321 3300025961 Bacteria 3104
211 Ga0207677_10042168 3300026023 Unclassified 3024
212 Ga0207703_10152255 3300026035 Bacteria 2018
213 Ga0207639_10708465 3300026041 Bacteria 934
214 Ga0207678_10201215 3300026067 Bacteria 1703
215 Ga0207708_10006449 3300026075 Bacteria 8695
216 Ga0207641_10405118 3300026088 Unclassified 1310
217 Ga0207675_100001488 3300026118 Bacteria 23495
218 Ga0207675_101482519 3300026118 Unclassified 699
219 Ga0207683_10001531 3300026121 Bacteria 20821
220 Ga0207698_10100323 3300026142 Unclassified 2397
221 Ga0209588_1011897 3300027671 Bacteria 2635
222 Ga0207428_10020151 3300027907 Bacteria 5672
223 Ga0268266_10465881 3300028379 Bacteria 1203
224 Ga0268265_10079518 3300028380 Bacteria 2582
225 Ga0268265_10257469 3300028380 Bacteria 1549
226 Ga0268265_10288500 3300028380 Unclassified 1472
227 Ga0268265_10689948 3300028380 Unclassified 985
228 Ga0268264_10034498 3300028381 Bacteria 4162
229 Ga0268264_10829293 3300028381 Unclassified 925
230 Ga0265340_10041173 3300031247 Bacteria 2273
231 Ga0265342_10234325 3300031712 Bacteria 985
232 Ga0373941_0047939 3300035115 Bacteria 1347
233 Ga0373956_0036721 3300035119 Unclassified 2163
234 Ga0373960_0232577 3300035121 Unclassified 663
235 Ga0373955_0040489 3300035172 Unclassified 2492
236 Ga0373961_0135055 3300035241 Unclassified 829
237 Ga0373935_0134033 3300035692 Bacteria 1667
238 Ga0373927_0059609 3300035695 Unclassified 2469
239 Ga0373937_0433093 3300036401 Unclassified 1248
240 Ga0373937_1031109 3300036401 Viruses 771
241 Ga0395905_0962167 3300037471 Bacteria 757
242 Ga0439443_016790 3300042003 Bacteria 1121
243 Ga0439446_0005518 3300042156 Bacteria 3256
244 Ga0439434_0344790 3300042435 Unclassified 519
245 Ga0451577_0013807 3300042876 Bacteria 7545
246 Ga0451577_0993970 3300042876 Bacteria 753
247 Ga0453683_0010558 3300044673 Bacteria 6118
248 Ga0453683_0245595 3300044673 Bacteria 1140
249 Ga0453684_0038814 3300044712 Bacteria 6499
250 Ga0453684_0549526 3300044712 Bacteria 1272
251 Ga0451576_0277460 3300045051 Unclassified 1752
252 Ga0495651_0037054 3300046462 Bacteria 3797
253 Ga0495639_0087027 3300046475 Unclassified 1462
254 Ga0495630_1112373 3300046517 Unclassified 599
255 Ga0495588_0017397 3300046674 Bacteria 3491
256 Ga0495604_0067814 3300047317 Bacteria 2710
257 Ga0496102_0090652 3300048905 Bacteria 2829
258 Ga0496104_0002278 3300048907 Bacteria 16546
259 Ga0496106_0659363 3300048909 Unclassified 836
260 Ga0496108_0006287 3300048911 Bacteria 9627
261 Ga0496109_0003696 3300048912 Bacteria 12780
262 Ga0496110_0001705 3300048913 Bacteria 16165
263 Ga0496111_0002116 3300048914 Bacteria 11862
264 Ga0496112_0000239 3300048915 Bacteria 35278
265 Ga0501041_0611363 3300049577 Unclassified 696
266 Ga0501048_0925171 3300049582 Bacteria 627
267 Ga0501071_0872281 3300049587 Unclassified 694
268 Ga0501076_0199384 3300049592 Bacteria 1634
269 Ga0501079_0763924 3300049741 Unclassified 761
270 Ga0501081_0344882 3300049743 Bacteria 1097
271 Ga0501081_0537328 3300049743 Unclassified 873
272 nmdc:mga05p37_12888_c1 3300050507 Bacteria 9997
273 nmdc:mga05p37_160705_c1 3300050507 Bacteria 2744
274 nmdc:mga05p37_208143_c1 3300050507 Unclassified 2365
275 nmdc:mga05p37_34026_c1 3300050507 Bacteria 6242
276 nmdc:mga05p37_460250_c1 3300050507 Bacteria 1470
277 nmdc:mga05p37_579425_c1 3300050507 Unclassified 1271
278 nmdc:mga05p37_8845_c1 3300050507 Bacteria 11897
279 nmdc:mga09592_60252_c1 3300050508 Unclassified 3209
280 nmdc:mga09592_82245_c1 3300050508 Bacteria 2744
281 nmdc:mga09592_94423_c1 3300050508 Bacteria 2558
282 nmdc:mga06r32_148480_c1 3300050510 Unclassified 2322
283 nmdc:mga06r32_21526_c1 3300050510 Bacteria 5952
284 nmdc:mga06r32_342858_c1 3300050510 Bacteria 1479
285 nmdc:mga06r32_369680_c1 3300050510 Bacteria 1417
286 nmdc:mga06r32_57708_c1 3300050510 Bacteria 3729
287 nmdc:mga08y16_124356_c1 3300050511 Bacteria 2683
288 nmdc:mga08y16_3752_c1 3300050511 Bacteria 15815
289 nmdc:mga0n895_1279_c1 3300050512 Bacteria 18591
290 nmdc:mga0n895_2532_c1 3300050512 Bacteria 14309
291 nmdc:mga0n895_25466_c1 3300050512 Bacteria 5590
292 nmdc:mga0n895_26710_c1 3300050512 Bacteria 5473
293 nmdc:mga0n895_44906_c2 3300050512 Unclassified 821
294 nmdc:mga0n895_65280_c1 3300050512 Bacteria 3602
295 nmdc:mga0rr50_1016020_c1 3300050513 Unclassified 706
296 nmdc:mga0rr50_1118560_c1 3300050513 Unclassified 670
297 nmdc:mga0rr50_212757_c1 3300050513 Bacteria 1593
298 nmdc:mga0rr50_23272_c1 3300050513 Bacteria 4268
299 nmdc:mga08x19_115750_c1 3300050514 Bacteria 1792
300 nmdc:mga08x19_124429_c1 3300050514 Unclassified 1731
301 nmdc:mga08x19_19116_c1 3300050514 Bacteria 4202
302 nmdc:mga08x19_478196_c1 3300050514 Bacteria 878
303 nmdc:mga08x19_7191_c1 3300050514 Bacteria 6613
304 nmdc:mga08x19_72619_c1 3300050514 Bacteria 2245
305 nmdc:mga0a205_118167_c1 3300050515 Unclassified 2550
306 nmdc:mga0a205_13366_c1 3300050515 Bacteria 7641
307 nmdc:mga0a205_176528_c1 3300050515 Bacteria 1406
308 nmdc:mga0a205_37063_c1 3300050515 Bacteria 4688
309 nmdc:mga0a205_445475_c1 3300050515 Unclassified 1155
310 nmdc:mga0a205_5860_c1 3300050515 Bacteria 11066
311 nmdc:mga0a205_639239_c1 3300050515 Bacteria 916
312 nmdc:mga0a205_70948_c1 3300050515 Bacteria 3364
313 Ga0495612_0112662 3300053078 Unclassified 1166
314 Ga0501082_0783646 3300060353 Unclassified 834
315 Ga0070704_100432062
316 Ga0065715_10166157
317 Ga0065707_10084279
318 Ga0070676_10946257
319 Ga0070683_100002358
320 Ga0070690_100548094
321 Ga0070670_100070631
322 Ga0070670_100307934
323 Ga0070670_100393758
324 Ga0068869_100151747
325 Ga0070660_100144000
326 Ga0070689_100104059
327 Ga0070689_101514151
328 Ga0070661_100002797
329 Ga0070661_100030885
330 Ga0070692_10015757
331 Ga0070669_100001505
332 Ga0070669_100120685
333 Ga0070669_100423886
334 Ga0070675_100068108
335 Ga0070675_100115290
336 Ga0070675_100553395
337 Ga0070671_100095496
338 Ga0070674_100800055
339 Ga0070673_100030015
340 Ga0070673_100075760
341 Ga0070688_100825413
342 Ga0070659_100108303
343 Ga0070667_100094005
344 Ga0070667_101174325
345 Ga0070709_10001847
346 Ga0070713_100393444
347 Ga0070701_10014741
348 Ga0070701_10037933
349 Ga0070711_100000048
350 Ga0070711_100225724
351 Ga0070705_100309077
352 Ga0070705_101092685
353 Ga0070700_100203822
354 Ga0070700_100213220
355 Ga0070694_100114959
356 Ga0070708_100056670
357 Ga0070708_100086833
358 Ga0070663_100086653
359 Ga0070662_100001205
360 Ga0070662_100005222
361 Ga0070662_100092901
362 Ga0070662_100296507
363 Ga0070681_10135588
364 Ga0070681_10168426
365 Ga0070706_100444978
366 Ga0070706_100458235
367 Ga0070707_100012289
368 Ga0070707_100345111
369 Ga0070698_100058051
370 Ga0070698_100213152
371 Ga0070698_100431650
372 Ga0070699_100011623
373 Ga0070699_100185183
374 Ga0070699_100186671
375 Ga0070699_100241401
376 Ga0070699_100299876
377 Ga0070699_100551369
378 Ga0070684_100001415
379 Ga0070684_100350572
380 Ga0070697_100012642
381 Ga0070697_100140402
382 Ga0070697_100510410
383 Ga0068853_100170358
384 Ga0070672_100033739
385 Ga0070672_100675120
386 Ga0070686_100950072
387 Ga0070695_100009335
388 Ga0070695_100017247
389 Ga0070696_100009360
390 Ga0070704_100000222
391 Ga0070704_100011366
392 Ga0068855_100027598
393 Ga0070664_100008591
394 Ga0070664_100490630
395 Ga0068857_100287964
396 Ga0068859_100016149
397 Ga0068864_100324900
398 Ga0068864_100495888
399 Ga0068861_100035442
400 Ga0068863_100009342
401 Ga0068858_100039930
402 Ga0068860_100075212
403 Ga0068860_100767461
404 Ga0068862_100016532
405 Ga0068862_100047370
406 Ga0068862_100119300
407 Ga0068862_100253205
408 Ga0068862_100570638
409 Ga0070716_100065658
410 Ga0070716_100211407
411 Ga0070712_101192472
412 Ga0075428_100000058
413 Ga0075428_100010885
414 Ga0075428_100062937
415 Ga0075428_100728961
416 Ga0075428_101173084
417 Ga0075431_100005593
418 Ga0075431_100053614
419 Ga0075431_100060534
420 Ga0075431_100447724
421 Ga0075433_10029361
422 Ga0075433_10214367
423 Ga0075433_10231482
424 Ga0075433_10241987
425 Ga0075433_10558209
426 Ga0075433_10673452
427 Ga0075434_100013317
428 Ga0075434_100044464
429 Ga0075434_100094338
430 Ga0075434_100195113
431 Ga0075434_100689726
432 Ga0075434_100691435
433 Ga0075429_100000045
434 Ga0075429_100080073
435 Ga0075429_100103208
436 Ga0068865_100319769
437 Ga0075436_100004228
438 Ga0075436_100012028
439 Ga0075436_100030525
440 Ga0075436_100086632
441 Ga0075436_100132245
442 Ga0097620_100016149
443 Ga0075435_100063415
444 Ga0075435_100095103
445 Ga0075435_100227413
446 Ga0075435_100898986
447 Ga0099794_10013127
448 Ga0099794_10105963
449 Ga0111539_10000691
450 Ga0111539_10081621
451 Ga0111539_10647416
452 Ga0111539_11193795
453 Ga0105245_10702040
454 Ga0105247_10301792
455 Ga0114129_10003915
456 Ga0114129_10020053
457 Ga0114129_10030971
458 Ga0114129_10052599
459 Ga0114129_10060708
460 Ga0114129_10127433
461 Ga0114129_10227218
462 Ga0114129_10410824
463 Ga0114129_11222936
464 Ga0105248_10039152
465 Ga0105249_10016155
466 Ga0105249_10026967
467 Ga0105249_10798698
468 Ga0105249_10799737
469 Ga0157374_10675884
470 Ga0163162_11017156
471 Ga0163162_12200957
472 Ga0157372_10317331
473 Ga0157375_10215924
474 Ga0163163_10179415
475 Ga0163163_10285231
476 Ga0157380_10056019
477 Ga0157377_10142958
478 Ga0157377_10461857
479 Ga0157379_10080998
480 Ga0207697_10261908
481 Ga0207653_10014388
482 Ga0207710_10161312
483 Ga0207699_10001042
484 Ga0207645_10106000
485 Ga0207643_10318504
486 Ga0207684_10478761
487 Ga0207684_10778686
488 Ga0207707_10247316
489 Ga0207663_10000146
490 Ga0207663_10422920
491 Ga0207649_10039929
492 Ga0207649_10529633
493 Ga0207646_10021234
494 Ga0207681_10010294
495 Ga0207681_10686582
496 Ga0207650_10054941
497 Ga0207650_10284599
498 Ga0207650_10510196
499 Ga0207650_10742017
500 Ga0207659_10104954
501 Ga0207659_10262997
502 Ga0207706_10001443
503 Ga0207706_10122921
504 Ga0207706_10635658
505 Ga0207709_10045105
506 Ga0207670_10618224
507 Ga0207669_10086951
508 Ga0207665_10025419
509 Ga0207665_10067714
510 Ga0207665_10583779
511 Ga0207691_10000324
512 Ga0207691_10039205
513 Ga0207711_10032223
514 Ga0207711_10408974
515 Ga0207689_10006123
516 Ga0207689_11063364
517 Ga0207661_10009574
518 Ga0207661_10337059
519 Ga0207679_10006506
520 Ga0207667_10197909
521 Ga0207667_10232036
522 Ga0207651_10581233
523 Ga0207712_10006915
524 Ga0207712_10043321
525 Ga0207677_10042168
526 Ga0207703_10152255
527 Ga0207639_10708465
528 Ga0207678_10201215
529 Ga0207708_10006449
530 Ga0207641_10405118
531 Ga0207675_100001488
532 Ga0207675_101482519
533 Ga0207683_10001531
534 Ga0207698_10100323
535 Ga0209588_1011897
536 Ga0207428_10020151
537 Ga0268266_10465881
538 Ga0268265_10079518
539 Ga0268265_10257469
540 Ga0268265_10288500
541 Ga0268265_10689948
542 Ga0268264_10034498
543 Ga0268264_10829293
544 Ga0265340_10041173
545 Ga0265342_10234325
546 Ga0373941_0047939
547 Ga0373956_0036721
548 Ga0373960_0232577
549 Ga0373955_0040489
550 Ga0373961_0135055
551 Ga0373935_0134033
552 Ga0373927_0059609
553 Ga0373937_0433093
554 Ga0373937_1031109
555 Ga0395905_0962167
556 Ga0439443_016790
557 Ga0439446_0005518
558 Ga0439434_0344790
559 Ga0451577_0013807
560 Ga0451577_0993970
561 Ga0453683_0010558
562 Ga0453683_0245595
563 Ga0453684_0038814
564 Ga0453684_0549526
565 Ga0451576_0277460
566 Ga0495651_0037054
567 Ga0495639_0087027
568 Ga0495630_1112373
569 Ga0495588_0017397
570 Ga0495604_0067814
571 Ga0496102_0090652
572 Ga0496104_0002278
573 Ga0496106_0659363
574 Ga0496108_0006287
575 Ga0496109_0003696
576 Ga0496110_0001705
577 Ga0496111_0002116
578 Ga0496112_0000239
579 Ga0501041_0611363
580 Ga0501048_0925171
581 Ga0501071_0872281
582 Ga0501076_0199384
583 Ga0501079_0763924
584 Ga0501081_0344882
585 Ga0501081_0537328
586 nmdc:mga05p37_12888_c1
587 nmdc:mga05p37_160705_c1
588 nmdc:mga05p37_208143_c1
589 nmdc:mga05p37_34026_c1
590 nmdc:mga05p37_460250_c1
591 nmdc:mga05p37_579425_c1
592 nmdc:mga05p37_8845_c1
593 nmdc:mga09592_60252_c1
594 nmdc:mga09592_82245_c1
595 nmdc:mga09592_94423_c1
596 nmdc:mga06r32_148480_c1
597 nmdc:mga06r32_21526_c1
598 nmdc:mga06r32_342858_c1
599 nmdc:mga06r32_369680_c1
600 nmdc:mga06r32_57708_c1
601 nmdc:mga08y16_124356_c1
602 nmdc:mga08y16_3752_c1
603 nmdc:mga0n895_1279_c1
604 nmdc:mga0n895_2532_c1
605 nmdc:mga0n895_25466_c1
606 nmdc:mga0n895_26710_c1
607 nmdc:mga0n895_44906_c2
608 nmdc:mga0n895_65280_c1
609 nmdc:mga0rr50_1016020_c1
610 nmdc:mga0rr50_1118560_c1
611 nmdc:mga0rr50_212757_c1
612 nmdc:mga0rr50_23272_c1
613 nmdc:mga08x19_115750_c1
614 nmdc:mga08x19_124429_c1
615 nmdc:mga08x19_19116_c1
616 nmdc:mga08x19_478196_c1
617 nmdc:mga08x19_7191_c1
618 nmdc:mga08x19_72619_c1
619 nmdc:mga0a205_118167_c1
620 nmdc:mga0a205_13366_c1
621 nmdc:mga0a205_176528_c1
622 nmdc:mga0a205_37063_c1
623 nmdc:mga0a205_445475_c1
624 nmdc:mga0a205_5860_c1
625 nmdc:mga0a205_639239_c1
626 nmdc:mga0a205_70948_c1
627 Ga0495612_0112662
628 Ga0501082_0783646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5673 98 182
5mg3-assembly1.cif.gz_D em fitted model of bacterial holo-translocon 0.5433 91 186
8q1b-assembly1.cif.gz_c iii2-iv1 respiratory supercomplex from s. pombe 0.4029 99 184
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.3999 98 184
6qc4-assembly1.cif.gz_AK ovine respiratory supercomplex i+iii2 open class 3 0.3968 94 180
ID Description Score Start End Superfamily
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5988 106 178 1.10.1760.20
5kc4E00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5673 98 182 1.10.1760.20
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5387 11 186 1.20.120.550
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.526 105 176 1.10.10.1740
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4985 106 178 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A849MDE0-F1-model_v4 DUF1761 domain-containing protein 0.9893 1 186 GO:0016020
AF-A0A3M1ADN1-F1-model_v4 DUF1761 domain-containing protein 0.9883 1 186 GO:0016020
AF-A0A7V9TFT3-F1-model_v4 DUF1761 domain-containing protein 0.9881 1 185 GO:0016020
AF-A0A2G2L714-F1-model_v4 DUF1761 domain-containing protein 0.9871 2 184 GO:0016020
AF-A0A7Y4RLB5-F1-model_v4 DUF1761 domain-containing protein 0.9841 1 185 GO:0016020

Map