F402556
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 213 | 309 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100256628|Ga0070714_1002566282 |
| Length | 309 |
| Sequence | MLPQRTFLLLIRQRPSVTLARWQCAGRGRAPVPVRETGLVRELLIIGMGPGHPDQVTVQAVRALNRADVFFVFDKGDAKSGLNAARDEILRRHVTRPGYRVVDIPEPPRDRSSSLTADRYQGAVGDWHAARAELIAAAIGAELGADGVGAFLVWGDPSVYDSMLRIAERVRALGTVEFTVTVIPGVTSVQALAAAHRIPLNRVGEPIHITPARRLAELAEPGLPDGLDSAVVMLDRGFTAAGFGEPGLTVYWGAYLSTDDEALISGPLPEVAARISATRDELRARHGWIMDTYLVRRERAQPEAGAAGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 2 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 3 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 4 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 5 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 143 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 144 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 145 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 153 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 167 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 196 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 199 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 200 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 210 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 211 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.09 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.46 |
| Nodule | 0 |
| Rhizoplane | 6.37 |
| Rhizosphere | 82.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013119 | 3300001979 | Bacteria | 3104 |
| 2 | Ga0070658_10179446 | 3300005327 | Bacteria | 1781 |
| 3 | Ga0070683_100363423 | 3300005329 | Bacteria | 1378 |
| 4 | Ga0068869_100028470 | 3300005334 | Bacteria | 3905 |
| 5 | Ga0068869_100226653 | 3300005334 | Bacteria | 1483 |
| 6 | Ga0070682_100112983 | 3300005337 | Bacteria | 1813 |
| 7 | Ga0068868_100244503 | 3300005338 | Bacteria | 1508 |
| 8 | Ga0070660_100260603 | 3300005339 | Bacteria | 1416 |
| 9 | Ga0070689_100603771 | 3300005340 | Bacteria | 951 |
| 10 | Ga0070687_100131902 | 3300005343 | Bacteria | 1443 |
| 11 | Ga0070661_100156741 | 3300005344 | Bacteria | 1723 |
| 12 | Ga0070661_100166891 | 3300005344 | Bacteria | 1670 |
| 13 | Ga0070661_100397740 | 3300005344 | Bacteria | 1089 |
| 14 | Ga0070692_10002199 | 3300005345 | Bacteria | 7468 |
| 15 | Ga0070692_10066129 | 3300005345 | Bacteria | 1915 |
| 16 | Ga0070668_100029698 | 3300005347 | Bacteria | 4153 |
| 17 | Ga0070668_100049650 | 3300005347 | Bacteria | 3228 |
| 18 | Ga0070669_100094477 | 3300005353 | Bacteria | 2247 |
| 19 | Ga0070671_100221536 | 3300005355 | Bacteria | 1605 |
| 20 | Ga0070688_100129861 | 3300005365 | Bacteria | 1698 |
| 21 | Ga0070659_100553967 | 3300005366 | Bacteria | 984 |
| 22 | Ga0070667_100061933 | 3300005367 | Bacteria | 3169 |
| 23 | Ga0070714_100086764 | 3300005435 | Bacteria | 2735 |
| 24 | Ga0070714_100256628 | 3300005435 | Bacteria | 1618 |
| 25 | Ga0070710_10000374 | 3300005437 | Bacteria | 20970 |
| 26 | Ga0070711_100002257 | 3300005439 | Bacteria | 10939 |
| 27 | Ga0070700_100026429 | 3300005441 | Bacteria | 3428 |
| 28 | Ga0070700_100068783 | 3300005441 | Bacteria | 2253 |
| 29 | Ga0070694_100046037 | 3300005444 | Bacteria | 2926 |
| 30 | Ga0070663_100043087 | 3300005455 | Bacteria | 3174 |
| 31 | Ga0070663_100075573 | 3300005455 | Bacteria | 2462 |
| 32 | Ga0070663_100271816 | 3300005455 | Bacteria | 1348 |
| 33 | Ga0070678_100066570 | 3300005456 | Bacteria | 2678 |
| 34 | Ga0070678_100156366 | 3300005456 | Bacteria | 1842 |
| 35 | Ga0070678_100234837 | 3300005456 | Bacteria | 1530 |
| 36 | Ga0070662_100006779 | 3300005457 | Bacteria | 7406 |
| 37 | Ga0070662_100047674 | 3300005457 | Bacteria | 3083 |
| 38 | Ga0070685_10033280 | 3300005466 | Bacteria | 2894 |
| 39 | Ga0070685_10114369 | 3300005466 | Bacteria | 1667 |
| 40 | Ga0070706_100082042 | 3300005467 | Bacteria | 2987 |
| 41 | Ga0070698_100024611 | 3300005471 | Bacteria | 6281 |
| 42 | Ga0070684_100389934 | 3300005535 | Bacteria | 1283 |
| 43 | Ga0068853_100210862 | 3300005539 | Bacteria | 1770 |
| 44 | Ga0068853_100286859 | 3300005539 | Bacteria | 1519 |
| 45 | Ga0070672_100121257 | 3300005543 | Bacteria | 2140 |
| 46 | Ga0070672_100492102 | 3300005543 | Bacteria | 1060 |
| 47 | Ga0070695_100186177 | 3300005545 | Bacteria | 1474 |
| 48 | Ga0070693_100040538 | 3300005547 | Bacteria | 2615 |
| 49 | Ga0070665_100330544 | 3300005548 | Bacteria | 1529 |
| 50 | Ga0068855_100014883 | 3300005563 | Bacteria | 9370 |
| 51 | Ga0068855_100359576 | 3300005563 | Bacteria | 1602 |
| 52 | Ga0070664_100219852 | 3300005564 | Bacteria | 1699 |
| 53 | Ga0068857_100073968 | 3300005577 | Bacteria | 3037 |
| 54 | Ga0068857_100198493 | 3300005577 | Bacteria | 1828 |
| 55 | Ga0068857_100225685 | 3300005577 | Bacteria | 1712 |
| 56 | Ga0068854_100122618 | 3300005578 | Bacteria | 1975 |
| 57 | Ga0068854_100606582 | 3300005578 | Bacteria | 935 |
| 58 | Ga0068854_100650509 | 3300005578 | Bacteria | 905 |
| 59 | Ga0068856_100000576 | 3300005614 | Bacteria | 40077 |
| 60 | Ga0068856_100003884 | 3300005614 | Bacteria | 14994 |
| 61 | Ga0068856_100036948 | 3300005614 | Bacteria | 4790 |
| 62 | Ga0068856_100052504 | 3300005614 | Bacteria | 4020 |
| 63 | Ga0068856_100896979 | 3300005614 | Bacteria | 905 |
| 64 | Ga0068856_100896980 | 3300005614 | Bacteria | 905 |
| 65 | Ga0070702_100018825 | 3300005615 | Bacteria | 3589 |
| 66 | Ga0070702_100027148 | 3300005615 | Bacteria | 3086 |
| 67 | Ga0068852_100103229 | 3300005616 | Bacteria | 2578 |
| 68 | Ga0068852_100152025 | 3300005616 | Bacteria | 2153 |
| 69 | Ga0068859_100013803 | 3300005617 | Bacteria | 8099 |
| 70 | Ga0068859_100050607 | 3300005617 | Bacteria | 4173 |
| 71 | Ga0068864_100040851 | 3300005618 | Bacteria | 3966 |
| 72 | Ga0068864_100303051 | 3300005618 | Bacteria | 1496 |
| 73 | Ga0068864_100445707 | 3300005618 | Bacteria | 1237 |
| 74 | Ga0068866_10226188 | 3300005718 | Bacteria | 1132 |
| 75 | Ga0068861_100008519 | 3300005719 | Bacteria | 7060 |
| 76 | Ga0068851_10006726 | 3300005834 | Bacteria | 5259 |
| 77 | Ga0068851_10132989 | 3300005834 | Bacteria | 1347 |
| 78 | Ga0068858_100108903 | 3300005842 | Bacteria | 2586 |
| 79 | Ga0068858_100312125 | 3300005842 | Bacteria | 1502 |
| 80 | Ga0068860_100656962 | 3300005843 | Bacteria | 1056 |
| 81 | Ga0068862_100019466 | 3300005844 | Bacteria | 5665 |
| 82 | Ga0081455_10020348 | 3300005937 | Bacteria | 6252 |
| 83 | Ga0081455_10161911 | 3300005937 | Bacteria | 1714 |
| 84 | Ga0070717_10185328 | 3300006028 | Bacteria | 1816 |
| 85 | Ga0075364_10173947 | 3300006051 | Bacteria | 1456 |
| 86 | Ga0075432_10092587 | 3300006058 | Bacteria | 1108 |
| 87 | Ga0070715_10068857 | 3300006163 | Bacteria | 1575 |
| 88 | Ga0070716_100158041 | 3300006173 | Bacteria | 1466 |
| 89 | Ga0070712_100096931 | 3300006175 | Bacteria | 2172 |
| 90 | Ga0075367_10206548 | 3300006178 | Bacteria | 1228 |
| 91 | Ga0097621_100120655 | 3300006237 | Bacteria | 2223 |
| 92 | Ga0075370_10082162 | 3300006353 | Bacteria | 1852 |
| 93 | Ga0075428_100000695 | 3300006844 | Bacteria | 34737 |
| 94 | Ga0075430_100013026 | 3300006846 | Bacteria | 7088 |
| 95 | Ga0075431_100037027 | 3300006847 | Bacteria | 5026 |
| 96 | Ga0075433_10001761 | 3300006852 | Bacteria | 16189 |
| 97 | Ga0075434_100082294 | 3300006871 | Bacteria | 3216 |
| 98 | Ga0068865_100449994 | 3300006881 | Bacteria | 1064 |
| 99 | Ga0097620_100013803 | 3300006931 | Bacteria | 8099 |
| 100 | Ga0097620_100050611 | 3300006931 | Bacteria | 4173 |
| 101 | Ga0105240_10080893 | 3300009093 | Bacteria | 3994 |
| 102 | Ga0111539_10145462 | 3300009094 | Bacteria | 2775 |
| 103 | Ga0111539_10203634 | 3300009094 | Bacteria | 2307 |
| 104 | Ga0105245_10044472 | 3300009098 | Bacteria | 3964 |
| 105 | Ga0105247_10219580 | 3300009101 | Bacteria | 1286 |
| 106 | Ga0114129_10000314 | 3300009147 | Bacteria | 56573 |
| 107 | Ga0105243_10110698 | 3300009148 | Bacteria | 2297 |
| 108 | Ga0105243_10374260 | 3300009148 | Bacteria | 1315 |
| 109 | Ga0105241_10020799 | 3300009174 | Bacteria | 4850 |
| 110 | Ga0105237_10137945 | 3300009545 | Bacteria | 2433 |
| 111 | Ga0105237_10350897 | 3300009545 | Bacteria | 1480 |
| 112 | Ga0105237_10372535 | 3300009545 | Bacteria | 1433 |
| 113 | Ga0105238_10648190 | 3300009551 | Bacteria | 1066 |
| 114 | Ga0105238_10788591 | 3300009551 | Bacteria | 965 |
| 115 | Ga0105249_10159086 | 3300009553 | Bacteria | 2181 |
| 116 | Ga0105239_10032264 | 3300010375 | Bacteria | 5756 |
| 117 | Ga0105239_10058469 | 3300010375 | Bacteria | 4231 |
| 118 | Ga0105239_10127596 | 3300010375 | Bacteria | 2828 |
| 119 | Ga0105239_10255228 | 3300010375 | Bacteria | 1970 |
| 120 | Ga0105239_10572927 | 3300010375 | Bacteria | 1287 |
| 121 | Ga0157371_10106712 | 3300013102 | Bacteria | 1987 |
| 122 | Ga0157378_10023624 | 3300013297 | Bacteria | 5407 |
| 123 | Ga0163162_10024882 | 3300013306 | Bacteria | 5913 |
| 124 | Ga0163162_10040616 | 3300013306 | Bacteria | 4652 |
| 125 | Ga0157372_10055226 | 3300013307 | Bacteria | 4435 |
| 126 | Ga0157372_10152724 | 3300013307 | Bacteria | 2666 |
| 127 | Ga0157372_10340211 | 3300013307 | Bacteria | 1748 |
| 128 | Ga0157375_10191850 | 3300013308 | Bacteria | 2198 |
| 129 | Ga0157375_10407698 | 3300013308 | Bacteria | 1526 |
| 130 | Ga0163163_10136180 | 3300014325 | Bacteria | 2497 |
| 131 | Ga0163163_10586975 | 3300014325 | Bacteria | 1177 |
| 132 | Ga0163163_11099892 | 3300014325 | Bacteria | 858 |
| 133 | Ga0157380_10121286 | 3300014326 | Bacteria | 2215 |
| 134 | Ga0157380_10274946 | 3300014326 | Bacteria | 1538 |
| 135 | Ga0157377_10071554 | 3300014745 | Bacteria | 2006 |
| 136 | Ga0157377_10071654 | 3300014745 | Bacteria | 2005 |
| 137 | Ga0157379_10060449 | 3300014968 | Bacteria | 3387 |
| 138 | Ga0157379_10355376 | 3300014968 | Bacteria | 1342 |
| 139 | Ga0157376_10103690 | 3300014969 | Bacteria | 2491 |
| 140 | Ga0157376_10409542 | 3300014969 | Bacteria | 1313 |
| 141 | Ga0163161_10021204 | 3300017792 | Bacteria | 4567 |
| 142 | Ga0213875_10003425 | 3300021388 | Bacteria | 9033 |
| 143 | Ga0207692_10000156 | 3300025898 | Bacteria | 21661 |
| 144 | Ga0207710_10163739 | 3300025900 | Bacteria | 1085 |
| 145 | Ga0207688_10009753 | 3300025901 | Bacteria | 5226 |
| 146 | Ga0207688_10024416 | 3300025901 | Bacteria | 3315 |
| 147 | Ga0207680_10546069 | 3300025903 | Bacteria | 827 |
| 148 | Ga0207647_10019594 | 3300025904 | Bacteria | 4548 |
| 149 | Ga0207647_10091935 | 3300025904 | Bacteria | 1809 |
| 150 | Ga0207645_10008913 | 3300025907 | Bacteria | 6968 |
| 151 | Ga0207643_10052331 | 3300025908 | Bacteria | 2319 |
| 152 | Ga0207684_10069147 | 3300025910 | Bacteria | 3001 |
| 153 | Ga0207707_10070663 | 3300025912 | Bacteria | 3042 |
| 154 | Ga0207695_10185991 | 3300025913 | Bacteria | 1996 |
| 155 | Ga0207671_10034420 | 3300025914 | Bacteria | 3763 |
| 156 | Ga0207693_10000246 | 3300025915 | Bacteria | 50005 |
| 157 | Ga0207663_10305419 | 3300025916 | Bacteria | 1190 |
| 158 | Ga0207662_10029350 | 3300025918 | Bacteria | 3186 |
| 159 | Ga0207657_10034252 | 3300025919 | Bacteria | 4569 |
| 160 | Ga0207652_10178088 | 3300025921 | Bacteria | 1910 |
| 161 | Ga0207681_10108537 | 3300025923 | Bacteria | 2015 |
| 162 | Ga0207650_10530054 | 3300025925 | Bacteria | 986 |
| 163 | Ga0207659_10293284 | 3300025926 | Bacteria | 1333 |
| 164 | Ga0207664_10125387 | 3300025929 | Bacteria | 2155 |
| 165 | Ga0207664_10383725 | 3300025929 | Bacteria | 1248 |
| 166 | Ga0207706_10020323 | 3300025933 | Bacteria | 5968 |
| 167 | Ga0207706_10027906 | 3300025933 | Bacteria | 5046 |
| 168 | Ga0207709_10008189 | 3300025935 | Bacteria | 5789 |
| 169 | Ga0207709_10046675 | 3300025935 | Bacteria | 2630 |
| 170 | Ga0207704_10097674 | 3300025938 | Bacteria | 1949 |
| 171 | Ga0207704_10202534 | 3300025938 | Bacteria | 1454 |
| 172 | Ga0207665_10008487 | 3300025939 | Bacteria | 6764 |
| 173 | Ga0207711_10534678 | 3300025941 | Bacteria | 1093 |
| 174 | Ga0207689_10019691 | 3300025942 | Bacteria | 5687 |
| 175 | Ga0207661_10543022 | 3300025944 | Bacteria | 1064 |
| 176 | Ga0207679_10236434 | 3300025945 | Bacteria | 1545 |
| 177 | Ga0207667_10083640 | 3300025949 | Bacteria | 3304 |
| 178 | Ga0207667_10210207 | 3300025949 | Bacteria | 1994 |
| 179 | Ga0207667_10302594 | 3300025949 | Bacteria | 1634 |
| 180 | Ga0207651_10033646 | 3300025960 | Bacteria | 3309 |
| 181 | Ga0207651_10193568 | 3300025960 | Bacteria | 1624 |
| 182 | Ga0207712_10095828 | 3300025961 | Bacteria | 2195 |
| 183 | Ga0207712_10108560 | 3300025961 | Bacteria | 2077 |
| 184 | Ga0207668_10069425 | 3300025972 | Bacteria | 2509 |
| 185 | Ga0207668_10122358 | 3300025972 | Bacteria | 1972 |
| 186 | Ga0207640_10080523 | 3300025981 | Bacteria | 2223 |
| 187 | Ga0207640_10166077 | 3300025981 | Bacteria | 1639 |
| 188 | Ga0207640_10403686 | 3300025981 | Bacteria | 1114 |
| 189 | Ga0207658_10406223 | 3300025986 | Bacteria | 1198 |
| 190 | Ga0207677_10250919 | 3300026023 | Bacteria | 1437 |
| 191 | Ga0207703_10082278 | 3300026035 | Bacteria | 2686 |
| 192 | Ga0207639_10131918 | 3300026041 | Bacteria | 2069 |
| 193 | Ga0207639_10143471 | 3300026041 | Bacteria | 1992 |
| 194 | Ga0207678_10004183 | 3300026067 | Bacteria | 12949 |
| 195 | Ga0207678_10016043 | 3300026067 | Bacteria | 6579 |
| 196 | Ga0207708_10015883 | 3300026075 | Bacteria | 5653 |
| 197 | Ga0207702_10000524 | 3300026078 | Bacteria | 43042 |
| 198 | Ga0207702_10045313 | 3300026078 | Bacteria | 3700 |
| 199 | Ga0207702_10065102 | 3300026078 | Bacteria | 3121 |
| 200 | Ga0207702_10402177 | 3300026078 | Bacteria | 1321 |
| 201 | Ga0207702_10692164 | 3300026078 | Bacteria | 1004 |
| 202 | Ga0207674_10136658 | 3300026116 | Bacteria | 2413 |
| 203 | Ga0207674_10237560 | 3300026116 | Bacteria | 1769 |
| 204 | Ga0207674_10336734 | 3300026116 | Bacteria | 1459 |
| 205 | Ga0207675_100007041 | 3300026118 | Bacteria | 10624 |
| 206 | Ga0207675_100081107 | 3300026118 | Bacteria | 3041 |
| 207 | Ga0207683_10004064 | 3300026121 | Bacteria | 12645 |
| 208 | Ga0207683_10299342 | 3300026121 | Bacteria | 1472 |
| 209 | Ga0207698_10083633 | 3300026142 | Bacteria | 2584 |
| 210 | Ga0209813_10123933 | 3300027866 | Bacteria | 902 |
| 211 | Ga0207428_10078646 | 3300027907 | Bacteria | 2580 |
| 212 | Ga0207428_10236520 | 3300027907 | Bacteria | 1366 |
| 213 | Ga0268266_10205550 | 3300028379 | Bacteria | 1804 |
| 214 | Ga0316177_1093360 | 3300030731 | Bacteria | 4504 |
| 215 | Ga0316176_1162042 | 3300030732 | Bacteria | 2062 |
| 216 | Ga0314311_1172719 | 3300030733 | Bacteria | 5668 |
| 217 | Ga0316180_1029728 | 3300030736 | Bacteria | 3001 |
| 218 | Ga0265340_10000557 | 3300031247 | Bacteria | 20706 |
| 219 | Ga0265327_10000637 | 3300031251 | Bacteria | 57211 |
| 220 | Ga0307513_10001922 | 3300031456 | Bacteria | 29483 |
| 221 | Ga0307513_10185082 | 3300031456 | Bacteria | 1941 |
| 222 | Ga0307509_10237096 | 3300031507 | Bacteria | 1621 |
| 223 | Ga0307409_100709604 | 3300031995 | Bacteria | 1006 |
| 224 | Ga0307415_100154540 | 3300032126 | Bacteria | 1770 |
| 225 | Ga0373938_0011976 | 3300034957 | Bacteria | 1621 |
| 226 | Ga0373928_0019090 | 3300035084 | Bacteria | 1427 |
| 227 | Ga0373940_0014177 | 3300035088 | Bacteria | 1941 |
| 228 | Ga0373939_0013578 | 3300035114 | Bacteria | 2099 |
| 229 | Ga0373943_0270966 | 3300035170 | Bacteria | 958 |
| 230 | Ga0373942_0003232 | 3300035207 | Bacteria | 3849 |
| 231 | Ga0373931_0065853 | 3300035691 | Bacteria | 1964 |
| 232 | Ga0372808_019952 | 3300036459 | Bacteria | 963 |
| 233 | Ga0373925_0000013 | 3300037068 | Bacteria | 188673 |
| 234 | Ga0373925_0308816 | 3300037068 | Bacteria | 1278 |
| 235 | Ga0395898_0066836 | 3300037466 | Bacteria | 3482 |
| 236 | Ga0436364_0662240 | 3300037853 | Bacteria | 1065 |
| 237 | Ga0436364_0692680 | 3300037853 | Bacteria | 44978 |
| 238 | Ga0436365_0187415 | 3300039437 | Bacteria | 2709 |
| 239 | Ga0451789_0667087 | 3300041443 | Bacteria | 1855 |
| 240 | Ga0451807_1362352 | 3300041486 | Bacteria | 1168 |
| 241 | Ga0451843_0465946 | 3300041509 | Bacteria | 887 |
| 242 | Ga0466972_0009400 | 3300044658 | Bacteria | 4911 |
| 243 | Ga0466972_0059766 | 3300044658 | Bacteria | 1829 |
| 244 | Ga0466972_0143089 | 3300044658 | Bacteria | 1125 |
| 245 | Ga0466965_0003080 | 3300044683 | Bacteria | 7264 |
| 246 | Ga0466965_0004046 | 3300044683 | Bacteria | 6504 |
| 247 | Ga0466965_0007334 | 3300044683 | Bacteria | 5057 |
| 248 | Ga0466966_0090470 | 3300044684 | Bacteria | 1900 |
| 249 | Ga0466966_0245669 | 3300044684 | Bacteria | 1078 |
| 250 | Ga0466961_0030576 | 3300044693 | Bacteria | 3461 |
| 251 | Ga0466963_0280470 | 3300044694 | Bacteria | 1171 |
| 252 | Ga0466970_0128011 | 3300044765 | Bacteria | 1393 |
| 253 | Ga0466960_0005193 | 3300044901 | Bacteria | 5146 |
| 254 | Ga0466960_0036331 | 3300044901 | Bacteria | 2307 |
| 255 | Ga0466959_0006283 | 3300045049 | Bacteria | 8210 |
| 256 | Ga0466959_0098012 | 3300045049 | Bacteria | 2100 |
| 257 | Ga0495638_0085758 | 3300046460 | Bacteria | 1904 |
| 258 | Ga0495585_0032169 | 3300046492 | Bacteria | 2973 |
| 259 | Ga0495624_0037279 | 3300046690 | Bacteria | 3130 |
| 260 | Ga0495604_0251474 | 3300047317 | Bacteria | 1205 |
| 261 | Ga0496101_0261682 | 3300048904 | Bacteria | 1349 |
| 262 | Ga0496102_0000327 | 3300048905 | Bacteria | 59228 |
| 263 | Ga0496102_0015990 | 3300048905 | Bacteria | 6550 |
| 264 | Ga0496103_0000267 | 3300048906 | Bacteria | 49943 |
| 265 | Ga0496104_0320999 | 3300048907 | Bacteria | 1461 |
| 266 | Ga0496107_0308765 | 3300048910 | Bacteria | 1177 |
| 267 | Ga0496108_0083136 | 3300048911 | Bacteria | 2715 |
| 268 | Ga0496108_0247897 | 3300048911 | Bacteria | 1549 |
| 269 | Ga0496108_0373356 | 3300048911 | Bacteria | 1245 |
| 270 | Ga0496109_0097830 | 3300048912 | Bacteria | 2720 |
| 271 | Ga0496109_0443421 | 3300048912 | Bacteria | 1226 |
| 272 | Ga0496109_0534043 | 3300048912 | Bacteria | 1107 |
| 273 | Ga0496110_0214474 | 3300048913 | Bacteria | 1750 |
| 274 | Ga0496111_0055911 | 3300048914 | Bacteria | 2854 |
| 275 | Ga0496111_0471609 | 3300048914 | Bacteria | 925 |
| 276 | Ga0496112_0604516 | 3300048915 | Bacteria | 1028 |
| 277 | Ga0496114_0046112 | 3300048917 | Bacteria | 3621 |
| 278 | Ga0496115_0379821 | 3300048918 | Bacteria | 1149 |
| 279 | Ga0496117_0018420 | 3300048920 | Bacteria | 5783 |
| 280 | Ga0496118_0025858 | 3300048921 | Bacteria | 5020 |
| 281 | Ga0496119_0007875 | 3300048922 | Bacteria | 9486 |
| 282 | Ga0496119_0044731 | 3300048922 | Bacteria | 2784 |
| 283 | Ga0496121_0033007 | 3300048924 | Bacteria | 4694 |
| 284 | Ga0496122_0003001 | 3300048925 | Bacteria | 22951 |
| 285 | nmdc:mga0yw44_90455_c1 | 3300050492 | Bacteria | 1933 |
| 286 | nmdc:mga0k408_31308_c1 | 3300050493 | Bacteria | 3037 |
| 287 | nmdc:mga06z11_165250_c1 | 3300050494 | Bacteria | 1267 |
| 288 | nmdc:mga04h51_145346_c1 | 3300050495 | Bacteria | 902 |
| 289 | nmdc:mga05p37_142305_c1 | 3300050507 | Bacteria | 2938 |
| 290 | nmdc:mga05p37_172085_c1 | 3300050507 | Bacteria | 2393 |
| 291 | nmdc:mga09592_204473_c1 | 3300050508 | Bacteria | 1710 |
| 292 | nmdc:mga09592_2488_c1 | 3300050508 | Bacteria | 14893 |
| 293 | nmdc:mga09592_64728_c1 | 3300050508 | Bacteria | 3096 |
| 294 | nmdc:mga0qj67_46217_c1 | 3300050509 | Bacteria | 3437 |
| 295 | nmdc:mga06r32_17692_c1 | 3300050510 | Bacteria | 6511 |
| 296 | nmdc:mga06r32_341211_c1 | 3300050510 | Bacteria | 1483 |
| 297 | nmdc:mga08y16_163370_c1 | 3300050511 | Bacteria | 2313 |
| 298 | nmdc:mga08y16_214063_c1 | 3300050511 | Bacteria | 1995 |
| 299 | nmdc:mga08y16_53727_c1 | 3300050511 | Bacteria | 4211 |
| 300 | nmdc:mga0n895_286656_c1 | 3300050512 | Bacteria | 1670 |
| 301 | nmdc:mga0rr50_101889_c1 | 3300050513 | Bacteria | 2258 |
| 302 | nmdc:mga08x19_129819_c1 | 3300050514 | Bacteria | 1694 |
| 303 | nmdc:mga0a205_56310_c1 | 3300050515 | Bacteria | 3796 |
| 304 | Ga0500583_0039305 | 3300053092 | Bacteria | 2136 |
| 305 | Ga0500556_0000017 | 3300053104 | Bacteria | 192495 |
| 306 | Ga0500588_0008820 | 3300053146 | Bacteria | 2374 |
| 307 | Ga0500616_0004119 | 3300053153 | Bacteria | 10536 |
| 308 | Ga0500616_0004328 | 3300053153 | Bacteria | 10171 |
| 309 | Ga0500645_016520 | 3300053730 | Bacteria | 2324 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_100271816 | Ga0070663_1002718162 | 235 |
| 2 | 3300005466 | Ga0070685_10114369 | Ga0070685_101143692 | 235 |
| 3 | 3300005614 | Ga0068856_100896979 | Ga0068856_1008969791 | 235 |
| 4 | 3300005614 | Ga0068856_100896980 | Ga0068856_1008969801 | 235 |
| 5 | 3300013308 | Ga0157375_10407698 | Ga0157375_104076982 | 235 |
| 6 | 3300014745 | Ga0157377_10071654 | Ga0157377_100716542 | 235 |
| 7 | 3300014968 | Ga0157379_10355376 | Ga0157379_103553762 | 235 |
| 8 | 3300025903 | Ga0207680_10546069 | Ga0207680_105460691 | 235 |
| 9 | 3300025921 | Ga0207652_10178088 | Ga0207652_101780882 | 235 |
| 10 | 3300025960 | Ga0207651_10033646 | Ga0207651_100336462 | 235 |
| 11 | 3300048912 | Ga0496109_0443421 | Ga0496109_0443421_205_927 | 235 |
| 12 | 3300048911 | Ga0496108_0247897 | Ga0496108_0247897_303_1028 | 236 |
| 13 | 3300005345 | Ga0070692_10066129 | Ga0070692_100661292 | 239 |
| 14 | 3300005578 | Ga0068854_100122618 | Ga0068854_1001226182 | 239 |
| 15 | 3300005843 | Ga0068860_100656962 | Ga0068860_1006569622 | 239 |
| 16 | 3300006881 | Ga0068865_100449994 | Ga0068865_1004499942 | 239 |
| 17 | 3300009148 | Ga0105243_10374260 | Ga0105243_103742602 | 239 |
| 18 | 3300014325 | Ga0163163_10586975 | Ga0163163_105869751 | 239 |
| 19 | 3300025935 | Ga0207709_10046675 | Ga0207709_100466752 | 239 |
| 20 | 3300025938 | Ga0207704_10097674 | Ga0207704_100976742 | 239 |
| 21 | 3300048911 | Ga0496108_0373356 | Ga0496108_0373356_378_1112 | 239 |
| 22 | 3300005338 | Ga0068868_100244503 | Ga0068868_1002445032 | 240 |
| 23 | 3300005344 | Ga0070661_100166891 | Ga0070661_1001668912 | 240 |
| 24 | 3300005618 | Ga0068864_100303051 | Ga0068864_1003030512 | 240 |
| 25 | 3300009551 | Ga0105238_10788591 | Ga0105238_107885911 | 240 |
| 26 | 3300013307 | Ga0157372_10340211 | Ga0157372_103402112 | 240 |
| 27 | 3300025925 | Ga0207650_10530054 | Ga0207650_105300542 | 240 |
| 28 | 3300025944 | Ga0207661_10543022 | Ga0207661_105430222 | 240 |
| 29 | 3300025961 | Ga0207712_10108560 | Ga0207712_101085602 | 240 |
| 30 | 3300026023 | Ga0207677_10250919 | Ga0207677_102509192 | 240 |
| 31 | 3300026116 | Ga0207674_10336734 | Ga0207674_103367342 | 240 |
| 32 | 3300026121 | Ga0207683_10299342 | Ga0207683_102993422 | 240 |
| 33 | 3300010375 | Ga0105239_10572927 | Ga0105239_105729271 | 241 |
| 34 | 3300009551 | Ga0105238_10648190 | Ga0105238_106481901 | 242 |
| 35 | 3300048920 | Ga0496117_0018420 | Ga0496117_0018420_452_1195 | 242 |
| 36 | iso_pu_bacteria | 2856741275 | 2856745173 | 242 |
| 37 | iso_pu_bacteria | 2891395885 | 2891398448 | 242 |
| 38 | iso_pu_bacteria | 2891562705 | 2891568891 | 242 |
| 39 | 3300005456 | Ga0070678_100156366 | Ga0070678_1001563662 | 243 |
| 40 | 3300006028 | Ga0070717_10185328 | Ga0070717_101853282 | 243 |
| 41 | 3300039437 | Ga0436365_0187415 | Ga0436365_0187415_1815_2564 | 243 |
| 42 | 3300005327 | Ga0070658_10179446 | Ga0070658_101794462 | 244 |
| 43 | 3300005329 | Ga0070683_100363423 | Ga0070683_1003634232 | 244 |
| 44 | 3300005334 | Ga0068869_100226653 | Ga0068869_1002266531 | 244 |
| 45 | 3300005337 | Ga0070682_100112983 | Ga0070682_1001129832 | 244 |
| 46 | 3300005340 | Ga0070689_100603771 | Ga0070689_1006037712 | 244 |
| 47 | 3300005343 | Ga0070687_100131902 | Ga0070687_1001319022 | 244 |
| 48 | 3300005344 | Ga0070661_100397740 | Ga0070661_1003977402 | 244 |
| 49 | 3300005347 | Ga0070668_100029698 | Ga0070668_1000296982 | 244 |
| 50 | 3300005365 | Ga0070688_100129861 | Ga0070688_1001298612 | 244 |
| 51 | 3300005366 | Ga0070659_100553967 | Ga0070659_1005539671 | 244 |
| 52 | 3300005441 | Ga0070700_100026429 | Ga0070700_1000264292 | 244 |
| 53 | 3300005455 | Ga0070663_100043087 | Ga0070663_1000430872 | 244 |
| 54 | 3300005456 | Ga0070678_100234837 | Ga0070678_1002348372 | 244 |
| 55 | 3300005457 | Ga0070662_100047674 | Ga0070662_1000476742 | 244 |
| 56 | 3300005466 | Ga0070685_10033280 | Ga0070685_100332803 | 244 |
| 57 | 3300005535 | Ga0070684_100389934 | Ga0070684_1003899342 | 244 |
| 58 | 3300005543 | Ga0070672_100121257 | Ga0070672_1001212572 | 244 |
| 59 | 3300005564 | Ga0070664_100219852 | Ga0070664_1002198522 | 244 |
| 60 | 3300005577 | Ga0068857_100198493 | Ga0068857_1001984932 | 244 |
| 61 | 3300005615 | Ga0070702_100027148 | Ga0070702_1000271482 | 244 |
| 62 | 3300005616 | Ga0068852_100152025 | Ga0068852_1001520252 | 244 |
| 63 | 3300005617 | Ga0068859_100050607 | Ga0068859_1000506073 | 244 |
| 64 | 3300005618 | Ga0068864_100445707 | Ga0068864_1004457072 | 244 |
| 65 | 3300005718 | Ga0068866_10226188 | Ga0068866_102261882 | 244 |
| 66 | 3300005834 | Ga0068851_10006726 | Ga0068851_100067265 | 244 |
| 67 | 3300005842 | Ga0068858_100108903 | Ga0068858_1001089032 | 244 |
| 68 | 3300005844 | Ga0068862_100019466 | Ga0068862_1000194664 | 244 |
| 69 | 3300006931 | Ga0097620_100050611 | Ga0097620_1000506113 | 244 |
| 70 | 3300009101 | Ga0105247_10219580 | Ga0105247_102195802 | 244 |
| 71 | 3300009545 | Ga0105237_10372535 | Ga0105237_103725352 | 244 |
| 72 | 3300010375 | Ga0105239_10032264 | Ga0105239_100322644 | 244 |
| 73 | 3300013306 | Ga0163162_10040616 | Ga0163162_100406163 | 244 |
| 74 | 3300014326 | Ga0157380_10274946 | Ga0157380_102749462 | 244 |
| 75 | 3300014745 | Ga0157377_10071554 | Ga0157377_100715542 | 244 |
| 76 | 3300014969 | Ga0157376_10409542 | Ga0157376_104095422 | 244 |
| 77 | 3300025901 | Ga0207688_10009753 | Ga0207688_100097532 | 244 |
| 78 | 3300025907 | Ga0207645_10008913 | Ga0207645_100089133 | 244 |
| 79 | 3300025918 | Ga0207662_10029350 | Ga0207662_100293502 | 244 |
| 80 | 3300025933 | Ga0207706_10020323 | Ga0207706_100203232 | 244 |
| 81 | 3300025945 | Ga0207679_10236434 | Ga0207679_102364342 | 244 |
| 82 | 3300025949 | Ga0207667_10210207 | Ga0207667_102102072 | 244 |
| 83 | 3300025972 | Ga0207668_10122358 | Ga0207668_101223582 | 244 |
| 84 | 3300025981 | Ga0207640_10080523 | Ga0207640_100805232 | 244 |
| 85 | 3300026041 | Ga0207639_10131918 | Ga0207639_101319182 | 244 |
| 86 | 3300026067 | Ga0207678_10016043 | Ga0207678_100160432 | 244 |
| 87 | 3300026075 | Ga0207708_10015883 | Ga0207708_100158834 | 244 |
| 88 | 3300026118 | Ga0207675_100081107 | Ga0207675_1000811073 | 244 |
| 89 | 3300031251 | Ga0265327_10000637 | Ga0265327_1000063743 | 244 |
| 90 | 3300048912 | Ga0496109_0097830 | Ga0496109_0097830_1767_2537 | 244 |
| 91 | 3300048913 | Ga0496110_0214474 | Ga0496110_0214474_66_836 | 244 |
| 92 | 3300005437 | Ga0070710_10000374 | Ga0070710_1000037417 | 246 |
| 93 | 3300025898 | Ga0207692_10000156 | Ga0207692_100001565 | 246 |
| 94 | 3300030731 | Ga0316177_1093360 | Ga0316177_10933602 | 246 |
| 95 | 3300030732 | Ga0316176_1162042 | Ga0316176_11620422 | 246 |
| 96 | 3300030733 | Ga0314311_1172719 | Ga0314311_11727195 | 246 |
| 97 | 3300030736 | Ga0316180_1029728 | Ga0316180_10297283 | 246 |
| 98 | 3300044658 | Ga0466972_0009400 | Ga0466972_0009400_3708_4451 | 246 |
| 99 | 3300044683 | Ga0466965_0003080 | Ga0466965_0003080_1675_2418 | 246 |
| 100 | 3300044683 | Ga0466965_0004046 | Ga0466965_0004046_3137_3886 | 246 |
| 101 | 3300044683 | Ga0466965_0007334 | Ga0466965_0007334_3397_4140 | 246 |
| 102 | 3300044901 | Ga0466960_0005193 | Ga0466960_0005193_315_1058 | 246 |
| 103 | 3300044684 | Ga0466966_0090470 | Ga0466966_0090470_417_1178 | 247 |
| 104 | 3300044765 | Ga0466970_0128011 | Ga0466970_0128011_557_1318 | 247 |
| 105 | 3300053092 | Ga0500583_0039305 | Ga0500583_0039305_671_1414 | 247 |
| 106 | 3300053146 | Ga0500588_0008820 | Ga0500588_0008820_567_1310 | 247 |
| 107 | iso_pu_bacteria | 3002998708 | 3003006571 | 247 |
| 108 | 3300005614 | Ga0068856_100000576 | Ga0068856_1000005761 | 248 |
| 109 | 3300005614 | Ga0068856_100052504 | Ga0068856_1000525041 | 248 |
| 110 | 3300005617 | Ga0068859_100013803 | Ga0068859_1000138037 | 248 |
| 111 | 3300006931 | Ga0097620_100013803 | Ga0097620_1000138037 | 248 |
| 112 | 3300009545 | Ga0105237_10137945 | Ga0105237_101379453 | 248 |
| 113 | 3300025914 | Ga0207671_10034420 | Ga0207671_100344203 | 248 |
| 114 | 3300026078 | Ga0207702_10000524 | Ga0207702_100005244 | 248 |
| 115 | 3300026078 | Ga0207702_10065102 | Ga0207702_100651022 | 248 |
| 116 | 3300031507 | Ga0307509_10237096 | Ga0307509_102370962 | 248 |
| 117 | 3300044658 | Ga0466972_0059766 | Ga0466972_0059766_526_1287 | 248 |
| 118 | 3300044901 | Ga0466960_0036331 | Ga0466960_0036331_670_1431 | 248 |
| 119 | 3300045049 | Ga0466959_0098012 | Ga0466959_0098012_1163_1924 | 248 |
| 120 | 3300048905 | Ga0496102_0000327 | Ga0496102_0000327_15493_16254 | 248 |
| 121 | 3300048906 | Ga0496103_0000267 | Ga0496103_0000267_14911_15672 | 248 |
| 122 | 3300048910 | Ga0496107_0308765 | Ga0496107_0308765_185_946 | 248 |
| 123 | 3300048921 | Ga0496118_0025858 | Ga0496118_0025858_2328_3089 | 248 |
| 124 | 3300048922 | Ga0496119_0044731 | Ga0496119_0044731_1940_2701 | 248 |
| 125 | 3300005616 | Ga0068852_100103229 | Ga0068852_1001032293 | 249 |
| 126 | 3300026142 | Ga0207698_10083633 | Ga0207698_100836333 | 249 |
| 127 | 3300032126 | Ga0307415_100154540 | Ga0307415_1001545402 | 249 |
| 128 | 3300044694 | Ga0466963_0280470 | Ga0466963_0280470_138_911 | 249 |
| 129 | 3300045049 | Ga0466959_0006283 | Ga0466959_0006283_1673_2446 | 249 |
| 130 | 3300050492 | nmdc:mga0yw44_90455_c1 | nmdc:mga0yw44_90455_c1_699_1460 | 249 |
| 131 | iso_pu_bacteria | 2891326441 | 2891330760 | 249 |
| 132 | 3300005467 | Ga0070706_100082042 | Ga0070706_1000820422 | 250 |
| 133 | 3300025910 | Ga0207684_10069147 | Ga0207684_100691472 | 250 |
| 134 | 3300031456 | Ga0307513_10185082 | Ga0307513_101850821 | 250 |
| 135 | 3300031995 | Ga0307409_100709604 | Ga0307409_1007096042 | 250 |
| 136 | 3300036459 | Ga0372808_019952 | Ga0372808_019952_11_784 | 250 |
| 137 | 3300041486 | Ga0451807_1362352 | Ga0451807_1362352_379_1137 | 250 |
| 138 | 3300053153 | Ga0500616_0004119 | Ga0500616_0004119_2183_2968 | 250 |
| 139 | 3300005539 | Ga0068853_100286859 | Ga0068853_1002868592 | 251 |
| 140 | 3300005937 | Ga0081455_10020348 | Ga0081455_100203485 | 251 |
| 141 | 3300006051 | Ga0075364_10173947 | Ga0075364_101739472 | 251 |
| 142 | 3300006178 | Ga0075367_10206548 | Ga0075367_102065481 | 251 |
| 143 | 3300006353 | Ga0075370_10082162 | Ga0075370_100821622 | 251 |
| 144 | 3300006844 | Ga0075428_100000695 | Ga0075428_10000069523 | 251 |
| 145 | 3300006846 | Ga0075430_100013026 | Ga0075430_1000130261 | 251 |
| 146 | 3300006847 | Ga0075431_100037027 | Ga0075431_1000370275 | 251 |
| 147 | 3300009094 | Ga0111539_10145462 | Ga0111539_101454624 | 251 |
| 148 | 3300009147 | Ga0114129_10000314 | Ga0114129_1000031452 | 251 |
| 149 | 3300025912 | Ga0207707_10070663 | Ga0207707_100706632 | 251 |
| 150 | 3300025986 | Ga0207658_10406223 | Ga0207658_104062231 | 251 |
| 151 | 3300026116 | Ga0207674_10237560 | Ga0207674_102375601 | 251 |
| 152 | 3300027866 | Ga0209813_10123933 | Ga0209813_101239331 | 251 |
| 153 | 3300027907 | Ga0207428_10236520 | Ga0207428_102365202 | 251 |
| 154 | 3300050493 | nmdc:mga0k408_31308_c1 | nmdc:mga0k408_31308_c1_1165_1926 | 251 |
| 155 | 3300050494 | nmdc:mga06z11_165250_c1 | nmdc:mga06z11_165250_c1_469_1230 | 251 |
| 156 | 3300050495 | nmdc:mga04h51_145346_c1 | nmdc:mga04h51_145346_c1_85_846 | 251 |
| 157 | 3300050507 | nmdc:mga05p37_142305_c1 | nmdc:mga05p37_142305_c1_1082_1843 | 251 |
| 158 | 3300050507 | nmdc:mga05p37_172085_c1 | nmdc:mga05p37_172085_c1_1110_1880 | 251 |
| 159 | 3300050508 | nmdc:mga09592_204473_c1 | nmdc:mga09592_204473_c1_415_1176 | 251 |
| 160 | 3300050508 | nmdc:mga09592_2488_c1 | nmdc:mga09592_2488_c1_2952_3713 | 251 |
| 161 | 3300050508 | nmdc:mga09592_64728_c1 | nmdc:mga09592_64728_c1_684_1445 | 251 |
| 162 | 3300050509 | nmdc:mga0qj67_46217_c1 | nmdc:mga0qj67_46217_c1_69_830 | 251 |
| 163 | 3300050510 | nmdc:mga06r32_17692_c1 | nmdc:mga06r32_17692_c1_1939_2700 | 251 |
| 164 | 3300050510 | nmdc:mga06r32_341211_c1 | nmdc:mga06r32_341211_c1_243_1004 | 251 |
| 165 | 3300050511 | nmdc:mga08y16_163370_c1 | nmdc:mga08y16_163370_c1_435_1205 | 251 |
| 166 | 3300050511 | nmdc:mga08y16_53727_c1 | nmdc:mga08y16_53727_c1_724_1485 | 251 |
| 167 | 3300001979 | JGI24740J21852_10013119 | JGI24740J21852_100131192 | 252 |
| 168 | 3300005334 | Ga0068869_100028470 | Ga0068869_1000284703 | 252 |
| 169 | 3300005339 | Ga0070660_100260603 | Ga0070660_1002606032 | 252 |
| 170 | 3300005344 | Ga0070661_100156741 | Ga0070661_1001567412 | 252 |
| 171 | 3300005345 | Ga0070692_10002199 | Ga0070692_100021996 | 252 |
| 172 | 3300005347 | Ga0070668_100049650 | Ga0070668_1000496503 | 252 |
| 173 | 3300005353 | Ga0070669_100094477 | Ga0070669_1000944773 | 252 |
| 174 | 3300005355 | Ga0070671_100221536 | Ga0070671_1002215361 | 252 |
| 175 | 3300005367 | Ga0070667_100061933 | Ga0070667_1000619333 | 252 |
| 176 | 3300005435 | Ga0070714_100086764 | Ga0070714_1000867643 | 252 |
| 177 | 3300005435 | Ga0070714_100256628 | Ga0070714_1002566282 | 252 |
| 178 | 3300005439 | Ga0070711_100002257 | Ga0070711_1000022573 | 252 |
| 179 | 3300005441 | Ga0070700_100068783 | Ga0070700_1000687832 | 252 |
| 180 | 3300005444 | Ga0070694_100046037 | Ga0070694_1000460373 | 252 |
| 181 | 3300005455 | Ga0070663_100075573 | Ga0070663_1000755733 | 252 |
| 182 | 3300005456 | Ga0070678_100066570 | Ga0070678_1000665703 | 252 |
| 183 | 3300005457 | Ga0070662_100006779 | Ga0070662_1000067796 | 252 |
| 184 | 3300005471 | Ga0070698_100024611 | Ga0070698_1000246112 | 252 |
| 185 | 3300005539 | Ga0068853_100210862 | Ga0068853_1002108622 | 252 |
| 186 | 3300005543 | Ga0070672_100492102 | Ga0070672_1004921021 | 252 |
| 187 | 3300005545 | Ga0070695_100186177 | Ga0070695_1001861772 | 252 |
| 188 | 3300005547 | Ga0070693_100040538 | Ga0070693_1000405383 | 252 |
| 189 | 3300005548 | Ga0070665_100330544 | Ga0070665_1003305442 | 252 |
| 190 | 3300005563 | Ga0068855_100014883 | Ga0068855_1000148837 | 252 |
| 191 | 3300005563 | Ga0068855_100359576 | Ga0068855_1003595761 | 252 |
| 192 | 3300005577 | Ga0068857_100073968 | Ga0068857_1000739682 | 252 |
| 193 | 3300005577 | Ga0068857_100225685 | Ga0068857_1002256852 | 252 |
| 194 | 3300005578 | Ga0068854_100606582 | Ga0068854_1006065821 | 252 |
| 195 | 3300005578 | Ga0068854_100650509 | Ga0068854_1006505091 | 252 |
| 196 | 3300005614 | Ga0068856_100003884 | Ga0068856_10000388415 | 252 |
| 197 | 3300005614 | Ga0068856_100036948 | Ga0068856_1000369484 | 252 |
| 198 | 3300005615 | Ga0070702_100018825 | Ga0070702_1000188253 | 252 |
| 199 | 3300005618 | Ga0068864_100040851 | Ga0068864_1000408513 | 252 |
| 200 | 3300005719 | Ga0068861_100008519 | Ga0068861_1000085195 | 252 |
| 201 | 3300005834 | Ga0068851_10132989 | Ga0068851_101329892 | 252 |
| 202 | 3300005842 | Ga0068858_100312125 | Ga0068858_1003121252 | 252 |
| 203 | 3300005937 | Ga0081455_10161911 | Ga0081455_101619111 | 252 |
| 204 | 3300006058 | Ga0075432_10092587 | Ga0075432_100925872 | 252 |
| 205 | 3300006163 | Ga0070715_10068857 | Ga0070715_100688572 | 252 |
| 206 | 3300006173 | Ga0070716_100158041 | Ga0070716_1001580412 | 252 |
| 207 | 3300006175 | Ga0070712_100096931 | Ga0070712_1000969312 | 252 |
| 208 | 3300006237 | Ga0097621_100120655 | Ga0097621_1001206553 | 252 |
| 209 | 3300006852 | Ga0075433_10001761 | Ga0075433_100017614 | 252 |
| 210 | 3300006871 | Ga0075434_100082294 | Ga0075434_1000822942 | 252 |
| 211 | 3300009093 | Ga0105240_10080893 | Ga0105240_100808934 | 252 |
| 212 | 3300009094 | Ga0111539_10203634 | Ga0111539_102036342 | 252 |
| 213 | 3300009098 | Ga0105245_10044472 | Ga0105245_100444723 | 252 |
| 214 | 3300009148 | Ga0105243_10110698 | Ga0105243_101106982 | 252 |
| 215 | 3300009174 | Ga0105241_10020799 | Ga0105241_100207993 | 252 |
| 216 | 3300009545 | Ga0105237_10350897 | Ga0105237_103508972 | 252 |
| 217 | 3300009553 | Ga0105249_10159086 | Ga0105249_101590862 | 252 |
| 218 | 3300010375 | Ga0105239_10058469 | Ga0105239_100584693 | 252 |
| 219 | 3300010375 | Ga0105239_10127596 | Ga0105239_101275963 | 252 |
| 220 | 3300010375 | Ga0105239_10255228 | Ga0105239_102552284 | 252 |
| 221 | 3300013102 | Ga0157371_10106712 | Ga0157371_101067122 | 252 |
| 222 | 3300013297 | Ga0157378_10023624 | Ga0157378_100236244 | 252 |
| 223 | 3300013306 | Ga0163162_10024882 | Ga0163162_100248823 | 252 |
| 224 | 3300013307 | Ga0157372_10055226 | Ga0157372_100552265 | 252 |
| 225 | 3300013307 | Ga0157372_10152724 | Ga0157372_101527243 | 252 |
| 226 | 3300013308 | Ga0157375_10191850 | Ga0157375_101918503 | 252 |
| 227 | 3300014325 | Ga0163163_10136180 | Ga0163163_101361802 | 252 |
| 228 | 3300014325 | Ga0163163_11099892 | Ga0163163_110998921 | 252 |
| 229 | 3300014326 | Ga0157380_10121286 | Ga0157380_101212863 | 252 |
| 230 | 3300014968 | Ga0157379_10060449 | Ga0157379_100604493 | 252 |
| 231 | 3300014969 | Ga0157376_10103690 | Ga0157376_101036901 | 252 |
| 232 | 3300017792 | Ga0163161_10021204 | Ga0163161_100212043 | 252 |
| 233 | 3300021388 | Ga0213875_10003425 | Ga0213875_100034258 | 252 |
| 234 | 3300025900 | Ga0207710_10163739 | Ga0207710_101637392 | 252 |
| 235 | 3300025901 | Ga0207688_10024416 | Ga0207688_100244163 | 252 |
| 236 | 3300025904 | Ga0207647_10019594 | Ga0207647_100195942 | 252 |
| 237 | 3300025904 | Ga0207647_10091935 | Ga0207647_100919353 | 252 |
| 238 | 3300025908 | Ga0207643_10052331 | Ga0207643_100523313 | 252 |
| 239 | 3300025913 | Ga0207695_10185991 | Ga0207695_101859912 | 252 |
| 240 | 3300025915 | Ga0207693_10000246 | Ga0207693_100002461 | 252 |
| 241 | 3300025916 | Ga0207663_10305419 | Ga0207663_103054192 | 252 |
| 242 | 3300025919 | Ga0207657_10034252 | Ga0207657_100342523 | 252 |
| 243 | 3300025923 | Ga0207681_10108537 | Ga0207681_101085372 | 252 |
| 244 | 3300025926 | Ga0207659_10293284 | Ga0207659_102932842 | 252 |
| 245 | 3300025929 | Ga0207664_10125387 | Ga0207664_101253872 | 252 |
| 246 | 3300025929 | Ga0207664_10383725 | Ga0207664_103837251 | 252 |
| 247 | 3300025933 | Ga0207706_10027906 | Ga0207706_100279064 | 252 |
| 248 | 3300025935 | Ga0207709_10008189 | Ga0207709_100081892 | 252 |
| 249 | 3300025938 | Ga0207704_10202534 | Ga0207704_102025342 | 252 |
| 250 | 3300025939 | Ga0207665_10008487 | Ga0207665_100084876 | 252 |
| 251 | 3300025941 | Ga0207711_10534678 | Ga0207711_105346782 | 252 |
| 252 | 3300025942 | Ga0207689_10019691 | Ga0207689_100196913 | 252 |
| 253 | 3300025949 | Ga0207667_10083640 | Ga0207667_100836402 | 252 |
| 254 | 3300025949 | Ga0207667_10302594 | Ga0207667_103025942 | 252 |
| 255 | 3300025960 | Ga0207651_10193568 | Ga0207651_101935682 | 252 |
| 256 | 3300025961 | Ga0207712_10095828 | Ga0207712_100958283 | 252 |
| 257 | 3300025972 | Ga0207668_10069425 | Ga0207668_100694252 | 252 |
| 258 | 3300025981 | Ga0207640_10166077 | Ga0207640_101660772 | 252 |
| 259 | 3300025981 | Ga0207640_10403686 | Ga0207640_104036862 | 252 |
| 260 | 3300026035 | Ga0207703_10082278 | Ga0207703_100822782 | 252 |
| 261 | 3300026041 | Ga0207639_10143471 | Ga0207639_101434712 | 252 |
| 262 | 3300026067 | Ga0207678_10004183 | Ga0207678_100041836 | 252 |
| 263 | 3300026078 | Ga0207702_10045313 | Ga0207702_100453133 | 252 |
| 264 | 3300026078 | Ga0207702_10402177 | Ga0207702_104021772 | 252 |
| 265 | 3300026078 | Ga0207702_10692164 | Ga0207702_106921641 | 252 |
| 266 | 3300026116 | Ga0207674_10136658 | Ga0207674_101366584 | 252 |
| 267 | 3300026118 | Ga0207675_100007041 | Ga0207675_1000070415 | 252 |
| 268 | 3300026121 | Ga0207683_10004064 | Ga0207683_100040645 | 252 |
| 269 | 3300027907 | Ga0207428_10078646 | Ga0207428_100786463 | 252 |
| 270 | 3300028379 | Ga0268266_10205550 | Ga0268266_102055503 | 252 |
| 271 | 3300031247 | Ga0265340_10000557 | Ga0265340_100005573 | 252 |
| 272 | 3300031456 | Ga0307513_10001922 | Ga0307513_1000192215 | 252 |
| 273 | 3300034957 | Ga0373938_0011976 | Ga0373938_0011976_738_1529 | 252 |
| 274 | 3300035084 | Ga0373928_0019090 | Ga0373928_0019090_177_968 | 252 |
| 275 | 3300035088 | Ga0373940_0014177 | Ga0373940_0014177_262_1053 | 252 |
| 276 | 3300035114 | Ga0373939_0013578 | Ga0373939_0013578_541_1332 | 252 |
| 277 | 3300035170 | Ga0373943_0270966 | Ga0373943_0270966_22_819 | 252 |
| 278 | 3300035207 | Ga0373942_0003232 | Ga0373942_0003232_1413_2204 | 252 |
| 279 | 3300035691 | Ga0373931_0065853 | Ga0373931_0065853_644_1435 | 252 |
| 280 | 3300037068 | Ga0373925_0000013 | Ga0373925_0000013_154412_155209 | 252 |
| 281 | 3300037068 | Ga0373925_0308816 | Ga0373925_0308816_170_967 | 252 |
| 282 | 3300037466 | Ga0395898_0066836 | Ga0395898_0066836_2398_3222 | 252 |
| 283 | 3300037853 | Ga0436364_0662240 | Ga0436364_0662240_182_976 | 252 |
| 284 | 3300037853 | Ga0436364_0692680 | Ga0436364_0692680_5751_6533 | 252 |
| 285 | 3300041443 | Ga0451789_0667087 | Ga0451789_0667087_421_1224 | 252 |
| 286 | 3300041509 | Ga0451843_0465946 | Ga0451843_0465946_68_877 | 252 |
| 287 | 3300044658 | Ga0466972_0143089 | Ga0466972_0143089_263_1042 | 252 |
| 288 | 3300044684 | Ga0466966_0245669 | Ga0466966_0245669_19_903 | 252 |
| 289 | 3300044693 | Ga0466961_0030576 | Ga0466961_0030576_1102_1890 | 252 |
| 290 | 3300046460 | Ga0495638_0085758 | Ga0495638_0085758_904_1713 | 252 |
| 291 | 3300046492 | Ga0495585_0032169 | Ga0495585_0032169_1632_2396 | 252 |
| 292 | 3300046690 | Ga0495624_0037279 | Ga0495624_0037279_695_1486 | 252 |
| 293 | 3300047317 | Ga0495604_0251474 | Ga0495604_0251474_171_932 | 252 |
| 294 | 3300048904 | Ga0496101_0261682 | Ga0496101_0261682_428_1219 | 252 |
| 295 | 3300048905 | Ga0496102_0015990 | Ga0496102_0015990_3739_4530 | 252 |
| 296 | 3300048907 | Ga0496104_0320999 | Ga0496104_0320999_17_808 | 252 |
| 297 | 3300048911 | Ga0496108_0083136 | Ga0496108_0083136_206_997 | 252 |
| 298 | 3300048912 | Ga0496109_0534043 | Ga0496109_0534043_80_838 | 252 |
| 299 | 3300048914 | Ga0496111_0055911 | Ga0496111_0055911_290_1081 | 252 |
| 300 | 3300048914 | Ga0496111_0471609 | Ga0496111_0471609_18_785 | 252 |
| 301 | 3300048915 | Ga0496112_0604516 | Ga0496112_0604516_36_827 | 252 |
| 302 | 3300048917 | Ga0496114_0046112 | Ga0496114_0046112_273_1064 | 252 |
| 303 | 3300048918 | Ga0496115_0379821 | Ga0496115_0379821_332_1123 | 252 |
| 304 | 3300048922 | Ga0496119_0007875 | Ga0496119_0007875_5549_6313 | 252 |
| 305 | 3300048924 | Ga0496121_0033007 | Ga0496121_0033007_695_1486 | 252 |
| 306 | 3300048925 | Ga0496122_0003001 | Ga0496122_0003001_3637_4401 | 252 |
| 307 | 3300050511 | nmdc:mga08y16_214063_c1 | nmdc:mga08y16_214063_c1_595_1386 | 252 |
| 308 | 3300050512 | nmdc:mga0n895_286656_c1 | nmdc:mga0n895_286656_c1_821_1612 | 252 |
| 309 | 3300050513 | nmdc:mga0rr50_101889_c1 | nmdc:mga0rr50_101889_c1_692_1483 | 252 |
| 310 | 3300050514 | nmdc:mga08x19_129819_c1 | nmdc:mga08x19_129819_c1_398_1189 | 252 |
| 311 | 3300050515 | nmdc:mga0a205_56310_c1 | nmdc:mga0a205_56310_c1_2041_2832 | 252 |
| 312 | 3300053104 | Ga0500556_0000017 | Ga0500556_0000017_102570_103334 | 252 |
| 313 | 3300053153 | Ga0500616_0004328 | Ga0500616_0004328_2400_3209 | 252 |
| 314 | 3300053730 | Ga0500645_016520 | Ga0500645_016520_1230_1994 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nd1-assembly1.cif.gz_B | crystal structure of precorrin-6a synthase from rhodobacter capsulatus | 0.9151 | 1 | 252 |
| 3nd1-assembly1.cif.gz_A | crystal structure of precorrin-6a synthase from rhodobacter capsulatus | 0.9142 | 1 | 252 |
| 2npn-assembly1.cif.gz_A | crystal structure of putative cobalamin synthesis related protein (cobf) from corynebacterium diphtheriae | 0.9123 | 1 | 250 |
| 3nd1-assembly1.cif.gz_B | crystal structure of precorrin-6a synthase from rhodobacter capsulatus | 0.9082 | 1 | 252 |
| 3nd1-assembly1.cif.gz_A | crystal structure of precorrin-6a synthase from rhodobacter capsulatus | 0.9071 | 1 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nd1B02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9672 | 144 | 252 | 3.30.950.10 |
| 3nd1B02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9502 | 144 | 252 | 3.30.950.10 |
| 2npnA02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9147 | 144 | 250 | 3.30.950.10 |
| 2npnA02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.8901 | 144 | 250 | 3.30.950.10 |
| 3nd1A01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.8537 | 1 | 143 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J7H877-F1-model_v4 | Unannotated protein | 0.9924 | 165 | 251 |
GO:0008168
|
| AF-A0A6B3C8V2-F1-model_v4 | Precorrin-6A synthase (Deacetylating) (EC 2.1.1.152) | 0.9877 | 138 | 251 |
GO:0009236
GO:0032259 GO:0043819 |
| AF-A0A529Y3U9-F1-model_v4 | Precorrin-6A synthase (Deacetylating) | 0.9751 | 198 | 252 |
GO:0008168
|
| AF-A0A640SBS1-F1-model_v4 | Immunity protein 35 domain-containing protein | 0.9745 | 182 | 252 |
GO:0008168
|
| AF-A0A2M9PEW2-F1-model_v4 | Precorrin-6A synthase (Deacetylating) | 0.9716 | 150 | 251 |
GO:0008168
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar