F402556

General Info

Members Datasets Scaffolds Average Seq Length
314 213 309 257

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100256628|Ga0070714_1002566282
Length 309
Sequence MLPQRTFLLLIRQRPSVTLARWQCAGRGRAPVPVRETGLVRELLIIGMGPGHPDQVTVQAVRALNRADVFFVFDKGDAKSGLNAARDEILRRHVTRPGYRVVDIPEPPRDRSSSLTADRYQGAVGDWHAARAELIAAAIGAELGADGVGAFLVWGDPSVYDSMLRIAERVRALGTVEFTVTVIPGVTSVQALAAAHRIPLNRVGEPIHITPARRLAELAEPGLPDGLDSAVVMLDRGFTAAGFGEPGLTVYWGAYLSTDDEALISGPLPEVAARISATRDELRARHGWIMDTYLVRRERAQPEAGAAGE

Samples

Sample ID Description Type Environment
1 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
2 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
3 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
4 2891562705 Microbispora tritici MT50 Isolate Unclassified
5 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
144 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
145 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0.32
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 6.37
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013119 3300001979 Bacteria 3104
2 Ga0070658_10179446 3300005327 Bacteria 1781
3 Ga0070683_100363423 3300005329 Bacteria 1378
4 Ga0068869_100028470 3300005334 Bacteria 3905
5 Ga0068869_100226653 3300005334 Bacteria 1483
6 Ga0070682_100112983 3300005337 Bacteria 1813
7 Ga0068868_100244503 3300005338 Bacteria 1508
8 Ga0070660_100260603 3300005339 Bacteria 1416
9 Ga0070689_100603771 3300005340 Bacteria 951
10 Ga0070687_100131902 3300005343 Bacteria 1443
11 Ga0070661_100156741 3300005344 Bacteria 1723
12 Ga0070661_100166891 3300005344 Bacteria 1670
13 Ga0070661_100397740 3300005344 Bacteria 1089
14 Ga0070692_10002199 3300005345 Bacteria 7468
15 Ga0070692_10066129 3300005345 Bacteria 1915
16 Ga0070668_100029698 3300005347 Bacteria 4153
17 Ga0070668_100049650 3300005347 Bacteria 3228
18 Ga0070669_100094477 3300005353 Bacteria 2247
19 Ga0070671_100221536 3300005355 Bacteria 1605
20 Ga0070688_100129861 3300005365 Bacteria 1698
21 Ga0070659_100553967 3300005366 Bacteria 984
22 Ga0070667_100061933 3300005367 Bacteria 3169
23 Ga0070714_100086764 3300005435 Bacteria 2735
24 Ga0070714_100256628 3300005435 Bacteria 1618
25 Ga0070710_10000374 3300005437 Bacteria 20970
26 Ga0070711_100002257 3300005439 Bacteria 10939
27 Ga0070700_100026429 3300005441 Bacteria 3428
28 Ga0070700_100068783 3300005441 Bacteria 2253
29 Ga0070694_100046037 3300005444 Bacteria 2926
30 Ga0070663_100043087 3300005455 Bacteria 3174
31 Ga0070663_100075573 3300005455 Bacteria 2462
32 Ga0070663_100271816 3300005455 Bacteria 1348
33 Ga0070678_100066570 3300005456 Bacteria 2678
34 Ga0070678_100156366 3300005456 Bacteria 1842
35 Ga0070678_100234837 3300005456 Bacteria 1530
36 Ga0070662_100006779 3300005457 Bacteria 7406
37 Ga0070662_100047674 3300005457 Bacteria 3083
38 Ga0070685_10033280 3300005466 Bacteria 2894
39 Ga0070685_10114369 3300005466 Bacteria 1667
40 Ga0070706_100082042 3300005467 Bacteria 2987
41 Ga0070698_100024611 3300005471 Bacteria 6281
42 Ga0070684_100389934 3300005535 Bacteria 1283
43 Ga0068853_100210862 3300005539 Bacteria 1770
44 Ga0068853_100286859 3300005539 Bacteria 1519
45 Ga0070672_100121257 3300005543 Bacteria 2140
46 Ga0070672_100492102 3300005543 Bacteria 1060
47 Ga0070695_100186177 3300005545 Bacteria 1474
48 Ga0070693_100040538 3300005547 Bacteria 2615
49 Ga0070665_100330544 3300005548 Bacteria 1529
50 Ga0068855_100014883 3300005563 Bacteria 9370
51 Ga0068855_100359576 3300005563 Bacteria 1602
52 Ga0070664_100219852 3300005564 Bacteria 1699
53 Ga0068857_100073968 3300005577 Bacteria 3037
54 Ga0068857_100198493 3300005577 Bacteria 1828
55 Ga0068857_100225685 3300005577 Bacteria 1712
56 Ga0068854_100122618 3300005578 Bacteria 1975
57 Ga0068854_100606582 3300005578 Bacteria 935
58 Ga0068854_100650509 3300005578 Bacteria 905
59 Ga0068856_100000576 3300005614 Bacteria 40077
60 Ga0068856_100003884 3300005614 Bacteria 14994
61 Ga0068856_100036948 3300005614 Bacteria 4790
62 Ga0068856_100052504 3300005614 Bacteria 4020
63 Ga0068856_100896979 3300005614 Bacteria 905
64 Ga0068856_100896980 3300005614 Bacteria 905
65 Ga0070702_100018825 3300005615 Bacteria 3589
66 Ga0070702_100027148 3300005615 Bacteria 3086
67 Ga0068852_100103229 3300005616 Bacteria 2578
68 Ga0068852_100152025 3300005616 Bacteria 2153
69 Ga0068859_100013803 3300005617 Bacteria 8099
70 Ga0068859_100050607 3300005617 Bacteria 4173
71 Ga0068864_100040851 3300005618 Bacteria 3966
72 Ga0068864_100303051 3300005618 Bacteria 1496
73 Ga0068864_100445707 3300005618 Bacteria 1237
74 Ga0068866_10226188 3300005718 Bacteria 1132
75 Ga0068861_100008519 3300005719 Bacteria 7060
76 Ga0068851_10006726 3300005834 Bacteria 5259
77 Ga0068851_10132989 3300005834 Bacteria 1347
78 Ga0068858_100108903 3300005842 Bacteria 2586
79 Ga0068858_100312125 3300005842 Bacteria 1502
80 Ga0068860_100656962 3300005843 Bacteria 1056
81 Ga0068862_100019466 3300005844 Bacteria 5665
82 Ga0081455_10020348 3300005937 Bacteria 6252
83 Ga0081455_10161911 3300005937 Bacteria 1714
84 Ga0070717_10185328 3300006028 Bacteria 1816
85 Ga0075364_10173947 3300006051 Bacteria 1456
86 Ga0075432_10092587 3300006058 Bacteria 1108
87 Ga0070715_10068857 3300006163 Bacteria 1575
88 Ga0070716_100158041 3300006173 Bacteria 1466
89 Ga0070712_100096931 3300006175 Bacteria 2172
90 Ga0075367_10206548 3300006178 Bacteria 1228
91 Ga0097621_100120655 3300006237 Bacteria 2223
92 Ga0075370_10082162 3300006353 Bacteria 1852
93 Ga0075428_100000695 3300006844 Bacteria 34737
94 Ga0075430_100013026 3300006846 Bacteria 7088
95 Ga0075431_100037027 3300006847 Bacteria 5026
96 Ga0075433_10001761 3300006852 Bacteria 16189
97 Ga0075434_100082294 3300006871 Bacteria 3216
98 Ga0068865_100449994 3300006881 Bacteria 1064
99 Ga0097620_100013803 3300006931 Bacteria 8099
100 Ga0097620_100050611 3300006931 Bacteria 4173
101 Ga0105240_10080893 3300009093 Bacteria 3994
102 Ga0111539_10145462 3300009094 Bacteria 2775
103 Ga0111539_10203634 3300009094 Bacteria 2307
104 Ga0105245_10044472 3300009098 Bacteria 3964
105 Ga0105247_10219580 3300009101 Bacteria 1286
106 Ga0114129_10000314 3300009147 Bacteria 56573
107 Ga0105243_10110698 3300009148 Bacteria 2297
108 Ga0105243_10374260 3300009148 Bacteria 1315
109 Ga0105241_10020799 3300009174 Bacteria 4850
110 Ga0105237_10137945 3300009545 Bacteria 2433
111 Ga0105237_10350897 3300009545 Bacteria 1480
112 Ga0105237_10372535 3300009545 Bacteria 1433
113 Ga0105238_10648190 3300009551 Bacteria 1066
114 Ga0105238_10788591 3300009551 Bacteria 965
115 Ga0105249_10159086 3300009553 Bacteria 2181
116 Ga0105239_10032264 3300010375 Bacteria 5756
117 Ga0105239_10058469 3300010375 Bacteria 4231
118 Ga0105239_10127596 3300010375 Bacteria 2828
119 Ga0105239_10255228 3300010375 Bacteria 1970
120 Ga0105239_10572927 3300010375 Bacteria 1287
121 Ga0157371_10106712 3300013102 Bacteria 1987
122 Ga0157378_10023624 3300013297 Bacteria 5407
123 Ga0163162_10024882 3300013306 Bacteria 5913
124 Ga0163162_10040616 3300013306 Bacteria 4652
125 Ga0157372_10055226 3300013307 Bacteria 4435
126 Ga0157372_10152724 3300013307 Bacteria 2666
127 Ga0157372_10340211 3300013307 Bacteria 1748
128 Ga0157375_10191850 3300013308 Bacteria 2198
129 Ga0157375_10407698 3300013308 Bacteria 1526
130 Ga0163163_10136180 3300014325 Bacteria 2497
131 Ga0163163_10586975 3300014325 Bacteria 1177
132 Ga0163163_11099892 3300014325 Bacteria 858
133 Ga0157380_10121286 3300014326 Bacteria 2215
134 Ga0157380_10274946 3300014326 Bacteria 1538
135 Ga0157377_10071554 3300014745 Bacteria 2006
136 Ga0157377_10071654 3300014745 Bacteria 2005
137 Ga0157379_10060449 3300014968 Bacteria 3387
138 Ga0157379_10355376 3300014968 Bacteria 1342
139 Ga0157376_10103690 3300014969 Bacteria 2491
140 Ga0157376_10409542 3300014969 Bacteria 1313
141 Ga0163161_10021204 3300017792 Bacteria 4567
142 Ga0213875_10003425 3300021388 Bacteria 9033
143 Ga0207692_10000156 3300025898 Bacteria 21661
144 Ga0207710_10163739 3300025900 Bacteria 1085
145 Ga0207688_10009753 3300025901 Bacteria 5226
146 Ga0207688_10024416 3300025901 Bacteria 3315
147 Ga0207680_10546069 3300025903 Bacteria 827
148 Ga0207647_10019594 3300025904 Bacteria 4548
149 Ga0207647_10091935 3300025904 Bacteria 1809
150 Ga0207645_10008913 3300025907 Bacteria 6968
151 Ga0207643_10052331 3300025908 Bacteria 2319
152 Ga0207684_10069147 3300025910 Bacteria 3001
153 Ga0207707_10070663 3300025912 Bacteria 3042
154 Ga0207695_10185991 3300025913 Bacteria 1996
155 Ga0207671_10034420 3300025914 Bacteria 3763
156 Ga0207693_10000246 3300025915 Bacteria 50005
157 Ga0207663_10305419 3300025916 Bacteria 1190
158 Ga0207662_10029350 3300025918 Bacteria 3186
159 Ga0207657_10034252 3300025919 Bacteria 4569
160 Ga0207652_10178088 3300025921 Bacteria 1910
161 Ga0207681_10108537 3300025923 Bacteria 2015
162 Ga0207650_10530054 3300025925 Bacteria 986
163 Ga0207659_10293284 3300025926 Bacteria 1333
164 Ga0207664_10125387 3300025929 Bacteria 2155
165 Ga0207664_10383725 3300025929 Bacteria 1248
166 Ga0207706_10020323 3300025933 Bacteria 5968
167 Ga0207706_10027906 3300025933 Bacteria 5046
168 Ga0207709_10008189 3300025935 Bacteria 5789
169 Ga0207709_10046675 3300025935 Bacteria 2630
170 Ga0207704_10097674 3300025938 Bacteria 1949
171 Ga0207704_10202534 3300025938 Bacteria 1454
172 Ga0207665_10008487 3300025939 Bacteria 6764
173 Ga0207711_10534678 3300025941 Bacteria 1093
174 Ga0207689_10019691 3300025942 Bacteria 5687
175 Ga0207661_10543022 3300025944 Bacteria 1064
176 Ga0207679_10236434 3300025945 Bacteria 1545
177 Ga0207667_10083640 3300025949 Bacteria 3304
178 Ga0207667_10210207 3300025949 Bacteria 1994
179 Ga0207667_10302594 3300025949 Bacteria 1634
180 Ga0207651_10033646 3300025960 Bacteria 3309
181 Ga0207651_10193568 3300025960 Bacteria 1624
182 Ga0207712_10095828 3300025961 Bacteria 2195
183 Ga0207712_10108560 3300025961 Bacteria 2077
184 Ga0207668_10069425 3300025972 Bacteria 2509
185 Ga0207668_10122358 3300025972 Bacteria 1972
186 Ga0207640_10080523 3300025981 Bacteria 2223
187 Ga0207640_10166077 3300025981 Bacteria 1639
188 Ga0207640_10403686 3300025981 Bacteria 1114
189 Ga0207658_10406223 3300025986 Bacteria 1198
190 Ga0207677_10250919 3300026023 Bacteria 1437
191 Ga0207703_10082278 3300026035 Bacteria 2686
192 Ga0207639_10131918 3300026041 Bacteria 2069
193 Ga0207639_10143471 3300026041 Bacteria 1992
194 Ga0207678_10004183 3300026067 Bacteria 12949
195 Ga0207678_10016043 3300026067 Bacteria 6579
196 Ga0207708_10015883 3300026075 Bacteria 5653
197 Ga0207702_10000524 3300026078 Bacteria 43042
198 Ga0207702_10045313 3300026078 Bacteria 3700
199 Ga0207702_10065102 3300026078 Bacteria 3121
200 Ga0207702_10402177 3300026078 Bacteria 1321
201 Ga0207702_10692164 3300026078 Bacteria 1004
202 Ga0207674_10136658 3300026116 Bacteria 2413
203 Ga0207674_10237560 3300026116 Bacteria 1769
204 Ga0207674_10336734 3300026116 Bacteria 1459
205 Ga0207675_100007041 3300026118 Bacteria 10624
206 Ga0207675_100081107 3300026118 Bacteria 3041
207 Ga0207683_10004064 3300026121 Bacteria 12645
208 Ga0207683_10299342 3300026121 Bacteria 1472
209 Ga0207698_10083633 3300026142 Bacteria 2584
210 Ga0209813_10123933 3300027866 Bacteria 902
211 Ga0207428_10078646 3300027907 Bacteria 2580
212 Ga0207428_10236520 3300027907 Bacteria 1366
213 Ga0268266_10205550 3300028379 Bacteria 1804
214 Ga0316177_1093360 3300030731 Bacteria 4504
215 Ga0316176_1162042 3300030732 Bacteria 2062
216 Ga0314311_1172719 3300030733 Bacteria 5668
217 Ga0316180_1029728 3300030736 Bacteria 3001
218 Ga0265340_10000557 3300031247 Bacteria 20706
219 Ga0265327_10000637 3300031251 Bacteria 57211
220 Ga0307513_10001922 3300031456 Bacteria 29483
221 Ga0307513_10185082 3300031456 Bacteria 1941
222 Ga0307509_10237096 3300031507 Bacteria 1621
223 Ga0307409_100709604 3300031995 Bacteria 1006
224 Ga0307415_100154540 3300032126 Bacteria 1770
225 Ga0373938_0011976 3300034957 Bacteria 1621
226 Ga0373928_0019090 3300035084 Bacteria 1427
227 Ga0373940_0014177 3300035088 Bacteria 1941
228 Ga0373939_0013578 3300035114 Bacteria 2099
229 Ga0373943_0270966 3300035170 Bacteria 958
230 Ga0373942_0003232 3300035207 Bacteria 3849
231 Ga0373931_0065853 3300035691 Bacteria 1964
232 Ga0372808_019952 3300036459 Bacteria 963
233 Ga0373925_0000013 3300037068 Bacteria 188673
234 Ga0373925_0308816 3300037068 Bacteria 1278
235 Ga0395898_0066836 3300037466 Bacteria 3482
236 Ga0436364_0662240 3300037853 Bacteria 1065
237 Ga0436364_0692680 3300037853 Bacteria 44978
238 Ga0436365_0187415 3300039437 Bacteria 2709
239 Ga0451789_0667087 3300041443 Bacteria 1855
240 Ga0451807_1362352 3300041486 Bacteria 1168
241 Ga0451843_0465946 3300041509 Bacteria 887
242 Ga0466972_0009400 3300044658 Bacteria 4911
243 Ga0466972_0059766 3300044658 Bacteria 1829
244 Ga0466972_0143089 3300044658 Bacteria 1125
245 Ga0466965_0003080 3300044683 Bacteria 7264
246 Ga0466965_0004046 3300044683 Bacteria 6504
247 Ga0466965_0007334 3300044683 Bacteria 5057
248 Ga0466966_0090470 3300044684 Bacteria 1900
249 Ga0466966_0245669 3300044684 Bacteria 1078
250 Ga0466961_0030576 3300044693 Bacteria 3461
251 Ga0466963_0280470 3300044694 Bacteria 1171
252 Ga0466970_0128011 3300044765 Bacteria 1393
253 Ga0466960_0005193 3300044901 Bacteria 5146
254 Ga0466960_0036331 3300044901 Bacteria 2307
255 Ga0466959_0006283 3300045049 Bacteria 8210
256 Ga0466959_0098012 3300045049 Bacteria 2100
257 Ga0495638_0085758 3300046460 Bacteria 1904
258 Ga0495585_0032169 3300046492 Bacteria 2973
259 Ga0495624_0037279 3300046690 Bacteria 3130
260 Ga0495604_0251474 3300047317 Bacteria 1205
261 Ga0496101_0261682 3300048904 Bacteria 1349
262 Ga0496102_0000327 3300048905 Bacteria 59228
263 Ga0496102_0015990 3300048905 Bacteria 6550
264 Ga0496103_0000267 3300048906 Bacteria 49943
265 Ga0496104_0320999 3300048907 Bacteria 1461
266 Ga0496107_0308765 3300048910 Bacteria 1177
267 Ga0496108_0083136 3300048911 Bacteria 2715
268 Ga0496108_0247897 3300048911 Bacteria 1549
269 Ga0496108_0373356 3300048911 Bacteria 1245
270 Ga0496109_0097830 3300048912 Bacteria 2720
271 Ga0496109_0443421 3300048912 Bacteria 1226
272 Ga0496109_0534043 3300048912 Bacteria 1107
273 Ga0496110_0214474 3300048913 Bacteria 1750
274 Ga0496111_0055911 3300048914 Bacteria 2854
275 Ga0496111_0471609 3300048914 Bacteria 925
276 Ga0496112_0604516 3300048915 Bacteria 1028
277 Ga0496114_0046112 3300048917 Bacteria 3621
278 Ga0496115_0379821 3300048918 Bacteria 1149
279 Ga0496117_0018420 3300048920 Bacteria 5783
280 Ga0496118_0025858 3300048921 Bacteria 5020
281 Ga0496119_0007875 3300048922 Bacteria 9486
282 Ga0496119_0044731 3300048922 Bacteria 2784
283 Ga0496121_0033007 3300048924 Bacteria 4694
284 Ga0496122_0003001 3300048925 Bacteria 22951
285 nmdc:mga0yw44_90455_c1 3300050492 Bacteria 1933
286 nmdc:mga0k408_31308_c1 3300050493 Bacteria 3037
287 nmdc:mga06z11_165250_c1 3300050494 Bacteria 1267
288 nmdc:mga04h51_145346_c1 3300050495 Bacteria 902
289 nmdc:mga05p37_142305_c1 3300050507 Bacteria 2938
290 nmdc:mga05p37_172085_c1 3300050507 Bacteria 2393
291 nmdc:mga09592_204473_c1 3300050508 Bacteria 1710
292 nmdc:mga09592_2488_c1 3300050508 Bacteria 14893
293 nmdc:mga09592_64728_c1 3300050508 Bacteria 3096
294 nmdc:mga0qj67_46217_c1 3300050509 Bacteria 3437
295 nmdc:mga06r32_17692_c1 3300050510 Bacteria 6511
296 nmdc:mga06r32_341211_c1 3300050510 Bacteria 1483
297 nmdc:mga08y16_163370_c1 3300050511 Bacteria 2313
298 nmdc:mga08y16_214063_c1 3300050511 Bacteria 1995
299 nmdc:mga08y16_53727_c1 3300050511 Bacteria 4211
300 nmdc:mga0n895_286656_c1 3300050512 Bacteria 1670
301 nmdc:mga0rr50_101889_c1 3300050513 Bacteria 2258
302 nmdc:mga08x19_129819_c1 3300050514 Bacteria 1694
303 nmdc:mga0a205_56310_c1 3300050515 Bacteria 3796
304 Ga0500583_0039305 3300053092 Bacteria 2136
305 Ga0500556_0000017 3300053104 Bacteria 192495
306 Ga0500588_0008820 3300053146 Bacteria 2374
307 Ga0500616_0004119 3300053153 Bacteria 10536
308 Ga0500616_0004328 3300053153 Bacteria 10171
309 Ga0500645_016520 3300053730 Bacteria 2324

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100271816 Ga0070663_1002718162 235
2 3300005466 Ga0070685_10114369 Ga0070685_101143692 235
3 3300005614 Ga0068856_100896979 Ga0068856_1008969791 235
4 3300005614 Ga0068856_100896980 Ga0068856_1008969801 235
5 3300013308 Ga0157375_10407698 Ga0157375_104076982 235
6 3300014745 Ga0157377_10071654 Ga0157377_100716542 235
7 3300014968 Ga0157379_10355376 Ga0157379_103553762 235
8 3300025903 Ga0207680_10546069 Ga0207680_105460691 235
9 3300025921 Ga0207652_10178088 Ga0207652_101780882 235
10 3300025960 Ga0207651_10033646 Ga0207651_100336462 235
11 3300048912 Ga0496109_0443421 Ga0496109_0443421_205_927 235
12 3300048911 Ga0496108_0247897 Ga0496108_0247897_303_1028 236
13 3300005345 Ga0070692_10066129 Ga0070692_100661292 239
14 3300005578 Ga0068854_100122618 Ga0068854_1001226182 239
15 3300005843 Ga0068860_100656962 Ga0068860_1006569622 239
16 3300006881 Ga0068865_100449994 Ga0068865_1004499942 239
17 3300009148 Ga0105243_10374260 Ga0105243_103742602 239
18 3300014325 Ga0163163_10586975 Ga0163163_105869751 239
19 3300025935 Ga0207709_10046675 Ga0207709_100466752 239
20 3300025938 Ga0207704_10097674 Ga0207704_100976742 239
21 3300048911 Ga0496108_0373356 Ga0496108_0373356_378_1112 239
22 3300005338 Ga0068868_100244503 Ga0068868_1002445032 240
23 3300005344 Ga0070661_100166891 Ga0070661_1001668912 240
24 3300005618 Ga0068864_100303051 Ga0068864_1003030512 240
25 3300009551 Ga0105238_10788591 Ga0105238_107885911 240
26 3300013307 Ga0157372_10340211 Ga0157372_103402112 240
27 3300025925 Ga0207650_10530054 Ga0207650_105300542 240
28 3300025944 Ga0207661_10543022 Ga0207661_105430222 240
29 3300025961 Ga0207712_10108560 Ga0207712_101085602 240
30 3300026023 Ga0207677_10250919 Ga0207677_102509192 240
31 3300026116 Ga0207674_10336734 Ga0207674_103367342 240
32 3300026121 Ga0207683_10299342 Ga0207683_102993422 240
33 3300010375 Ga0105239_10572927 Ga0105239_105729271 241
34 3300009551 Ga0105238_10648190 Ga0105238_106481901 242
35 3300048920 Ga0496117_0018420 Ga0496117_0018420_452_1195 242
36 iso_pu_bacteria 2856741275 2856745173 242
37 iso_pu_bacteria 2891395885 2891398448 242
38 iso_pu_bacteria 2891562705 2891568891 242
39 3300005456 Ga0070678_100156366 Ga0070678_1001563662 243
40 3300006028 Ga0070717_10185328 Ga0070717_101853282 243
41 3300039437 Ga0436365_0187415 Ga0436365_0187415_1815_2564 243
42 3300005327 Ga0070658_10179446 Ga0070658_101794462 244
43 3300005329 Ga0070683_100363423 Ga0070683_1003634232 244
44 3300005334 Ga0068869_100226653 Ga0068869_1002266531 244
45 3300005337 Ga0070682_100112983 Ga0070682_1001129832 244
46 3300005340 Ga0070689_100603771 Ga0070689_1006037712 244
47 3300005343 Ga0070687_100131902 Ga0070687_1001319022 244
48 3300005344 Ga0070661_100397740 Ga0070661_1003977402 244
49 3300005347 Ga0070668_100029698 Ga0070668_1000296982 244
50 3300005365 Ga0070688_100129861 Ga0070688_1001298612 244
51 3300005366 Ga0070659_100553967 Ga0070659_1005539671 244
52 3300005441 Ga0070700_100026429 Ga0070700_1000264292 244
53 3300005455 Ga0070663_100043087 Ga0070663_1000430872 244
54 3300005456 Ga0070678_100234837 Ga0070678_1002348372 244
55 3300005457 Ga0070662_100047674 Ga0070662_1000476742 244
56 3300005466 Ga0070685_10033280 Ga0070685_100332803 244
57 3300005535 Ga0070684_100389934 Ga0070684_1003899342 244
58 3300005543 Ga0070672_100121257 Ga0070672_1001212572 244
59 3300005564 Ga0070664_100219852 Ga0070664_1002198522 244
60 3300005577 Ga0068857_100198493 Ga0068857_1001984932 244
61 3300005615 Ga0070702_100027148 Ga0070702_1000271482 244
62 3300005616 Ga0068852_100152025 Ga0068852_1001520252 244
63 3300005617 Ga0068859_100050607 Ga0068859_1000506073 244
64 3300005618 Ga0068864_100445707 Ga0068864_1004457072 244
65 3300005718 Ga0068866_10226188 Ga0068866_102261882 244
66 3300005834 Ga0068851_10006726 Ga0068851_100067265 244
67 3300005842 Ga0068858_100108903 Ga0068858_1001089032 244
68 3300005844 Ga0068862_100019466 Ga0068862_1000194664 244
69 3300006931 Ga0097620_100050611 Ga0097620_1000506113 244
70 3300009101 Ga0105247_10219580 Ga0105247_102195802 244
71 3300009545 Ga0105237_10372535 Ga0105237_103725352 244
72 3300010375 Ga0105239_10032264 Ga0105239_100322644 244
73 3300013306 Ga0163162_10040616 Ga0163162_100406163 244
74 3300014326 Ga0157380_10274946 Ga0157380_102749462 244
75 3300014745 Ga0157377_10071554 Ga0157377_100715542 244
76 3300014969 Ga0157376_10409542 Ga0157376_104095422 244
77 3300025901 Ga0207688_10009753 Ga0207688_100097532 244
78 3300025907 Ga0207645_10008913 Ga0207645_100089133 244
79 3300025918 Ga0207662_10029350 Ga0207662_100293502 244
80 3300025933 Ga0207706_10020323 Ga0207706_100203232 244
81 3300025945 Ga0207679_10236434 Ga0207679_102364342 244
82 3300025949 Ga0207667_10210207 Ga0207667_102102072 244
83 3300025972 Ga0207668_10122358 Ga0207668_101223582 244
84 3300025981 Ga0207640_10080523 Ga0207640_100805232 244
85 3300026041 Ga0207639_10131918 Ga0207639_101319182 244
86 3300026067 Ga0207678_10016043 Ga0207678_100160432 244
87 3300026075 Ga0207708_10015883 Ga0207708_100158834 244
88 3300026118 Ga0207675_100081107 Ga0207675_1000811073 244
89 3300031251 Ga0265327_10000637 Ga0265327_1000063743 244
90 3300048912 Ga0496109_0097830 Ga0496109_0097830_1767_2537 244
91 3300048913 Ga0496110_0214474 Ga0496110_0214474_66_836 244
92 3300005437 Ga0070710_10000374 Ga0070710_1000037417 246
93 3300025898 Ga0207692_10000156 Ga0207692_100001565 246
94 3300030731 Ga0316177_1093360 Ga0316177_10933602 246
95 3300030732 Ga0316176_1162042 Ga0316176_11620422 246
96 3300030733 Ga0314311_1172719 Ga0314311_11727195 246
97 3300030736 Ga0316180_1029728 Ga0316180_10297283 246
98 3300044658 Ga0466972_0009400 Ga0466972_0009400_3708_4451 246
99 3300044683 Ga0466965_0003080 Ga0466965_0003080_1675_2418 246
100 3300044683 Ga0466965_0004046 Ga0466965_0004046_3137_3886 246
101 3300044683 Ga0466965_0007334 Ga0466965_0007334_3397_4140 246
102 3300044901 Ga0466960_0005193 Ga0466960_0005193_315_1058 246
103 3300044684 Ga0466966_0090470 Ga0466966_0090470_417_1178 247
104 3300044765 Ga0466970_0128011 Ga0466970_0128011_557_1318 247
105 3300053092 Ga0500583_0039305 Ga0500583_0039305_671_1414 247
106 3300053146 Ga0500588_0008820 Ga0500588_0008820_567_1310 247
107 iso_pu_bacteria 3002998708 3003006571 247
108 3300005614 Ga0068856_100000576 Ga0068856_1000005761 248
109 3300005614 Ga0068856_100052504 Ga0068856_1000525041 248
110 3300005617 Ga0068859_100013803 Ga0068859_1000138037 248
111 3300006931 Ga0097620_100013803 Ga0097620_1000138037 248
112 3300009545 Ga0105237_10137945 Ga0105237_101379453 248
113 3300025914 Ga0207671_10034420 Ga0207671_100344203 248
114 3300026078 Ga0207702_10000524 Ga0207702_100005244 248
115 3300026078 Ga0207702_10065102 Ga0207702_100651022 248
116 3300031507 Ga0307509_10237096 Ga0307509_102370962 248
117 3300044658 Ga0466972_0059766 Ga0466972_0059766_526_1287 248
118 3300044901 Ga0466960_0036331 Ga0466960_0036331_670_1431 248
119 3300045049 Ga0466959_0098012 Ga0466959_0098012_1163_1924 248
120 3300048905 Ga0496102_0000327 Ga0496102_0000327_15493_16254 248
121 3300048906 Ga0496103_0000267 Ga0496103_0000267_14911_15672 248
122 3300048910 Ga0496107_0308765 Ga0496107_0308765_185_946 248
123 3300048921 Ga0496118_0025858 Ga0496118_0025858_2328_3089 248
124 3300048922 Ga0496119_0044731 Ga0496119_0044731_1940_2701 248
125 3300005616 Ga0068852_100103229 Ga0068852_1001032293 249
126 3300026142 Ga0207698_10083633 Ga0207698_100836333 249
127 3300032126 Ga0307415_100154540 Ga0307415_1001545402 249
128 3300044694 Ga0466963_0280470 Ga0466963_0280470_138_911 249
129 3300045049 Ga0466959_0006283 Ga0466959_0006283_1673_2446 249
130 3300050492 nmdc:mga0yw44_90455_c1 nmdc:mga0yw44_90455_c1_699_1460 249
131 iso_pu_bacteria 2891326441 2891330760 249
132 3300005467 Ga0070706_100082042 Ga0070706_1000820422 250
133 3300025910 Ga0207684_10069147 Ga0207684_100691472 250
134 3300031456 Ga0307513_10185082 Ga0307513_101850821 250
135 3300031995 Ga0307409_100709604 Ga0307409_1007096042 250
136 3300036459 Ga0372808_019952 Ga0372808_019952_11_784 250
137 3300041486 Ga0451807_1362352 Ga0451807_1362352_379_1137 250
138 3300053153 Ga0500616_0004119 Ga0500616_0004119_2183_2968 250
139 3300005539 Ga0068853_100286859 Ga0068853_1002868592 251
140 3300005937 Ga0081455_10020348 Ga0081455_100203485 251
141 3300006051 Ga0075364_10173947 Ga0075364_101739472 251
142 3300006178 Ga0075367_10206548 Ga0075367_102065481 251
143 3300006353 Ga0075370_10082162 Ga0075370_100821622 251
144 3300006844 Ga0075428_100000695 Ga0075428_10000069523 251
145 3300006846 Ga0075430_100013026 Ga0075430_1000130261 251
146 3300006847 Ga0075431_100037027 Ga0075431_1000370275 251
147 3300009094 Ga0111539_10145462 Ga0111539_101454624 251
148 3300009147 Ga0114129_10000314 Ga0114129_1000031452 251
149 3300025912 Ga0207707_10070663 Ga0207707_100706632 251
150 3300025986 Ga0207658_10406223 Ga0207658_104062231 251
151 3300026116 Ga0207674_10237560 Ga0207674_102375601 251
152 3300027866 Ga0209813_10123933 Ga0209813_101239331 251
153 3300027907 Ga0207428_10236520 Ga0207428_102365202 251
154 3300050493 nmdc:mga0k408_31308_c1 nmdc:mga0k408_31308_c1_1165_1926 251
155 3300050494 nmdc:mga06z11_165250_c1 nmdc:mga06z11_165250_c1_469_1230 251
156 3300050495 nmdc:mga04h51_145346_c1 nmdc:mga04h51_145346_c1_85_846 251
157 3300050507 nmdc:mga05p37_142305_c1 nmdc:mga05p37_142305_c1_1082_1843 251
158 3300050507 nmdc:mga05p37_172085_c1 nmdc:mga05p37_172085_c1_1110_1880 251
159 3300050508 nmdc:mga09592_204473_c1 nmdc:mga09592_204473_c1_415_1176 251
160 3300050508 nmdc:mga09592_2488_c1 nmdc:mga09592_2488_c1_2952_3713 251
161 3300050508 nmdc:mga09592_64728_c1 nmdc:mga09592_64728_c1_684_1445 251
162 3300050509 nmdc:mga0qj67_46217_c1 nmdc:mga0qj67_46217_c1_69_830 251
163 3300050510 nmdc:mga06r32_17692_c1 nmdc:mga06r32_17692_c1_1939_2700 251
164 3300050510 nmdc:mga06r32_341211_c1 nmdc:mga06r32_341211_c1_243_1004 251
165 3300050511 nmdc:mga08y16_163370_c1 nmdc:mga08y16_163370_c1_435_1205 251
166 3300050511 nmdc:mga08y16_53727_c1 nmdc:mga08y16_53727_c1_724_1485 251
167 3300001979 JGI24740J21852_10013119 JGI24740J21852_100131192 252
168 3300005334 Ga0068869_100028470 Ga0068869_1000284703 252
169 3300005339 Ga0070660_100260603 Ga0070660_1002606032 252
170 3300005344 Ga0070661_100156741 Ga0070661_1001567412 252
171 3300005345 Ga0070692_10002199 Ga0070692_100021996 252
172 3300005347 Ga0070668_100049650 Ga0070668_1000496503 252
173 3300005353 Ga0070669_100094477 Ga0070669_1000944773 252
174 3300005355 Ga0070671_100221536 Ga0070671_1002215361 252
175 3300005367 Ga0070667_100061933 Ga0070667_1000619333 252
176 3300005435 Ga0070714_100086764 Ga0070714_1000867643 252
177 3300005435 Ga0070714_100256628 Ga0070714_1002566282 252
178 3300005439 Ga0070711_100002257 Ga0070711_1000022573 252
179 3300005441 Ga0070700_100068783 Ga0070700_1000687832 252
180 3300005444 Ga0070694_100046037 Ga0070694_1000460373 252
181 3300005455 Ga0070663_100075573 Ga0070663_1000755733 252
182 3300005456 Ga0070678_100066570 Ga0070678_1000665703 252
183 3300005457 Ga0070662_100006779 Ga0070662_1000067796 252
184 3300005471 Ga0070698_100024611 Ga0070698_1000246112 252
185 3300005539 Ga0068853_100210862 Ga0068853_1002108622 252
186 3300005543 Ga0070672_100492102 Ga0070672_1004921021 252
187 3300005545 Ga0070695_100186177 Ga0070695_1001861772 252
188 3300005547 Ga0070693_100040538 Ga0070693_1000405383 252
189 3300005548 Ga0070665_100330544 Ga0070665_1003305442 252
190 3300005563 Ga0068855_100014883 Ga0068855_1000148837 252
191 3300005563 Ga0068855_100359576 Ga0068855_1003595761 252
192 3300005577 Ga0068857_100073968 Ga0068857_1000739682 252
193 3300005577 Ga0068857_100225685 Ga0068857_1002256852 252
194 3300005578 Ga0068854_100606582 Ga0068854_1006065821 252
195 3300005578 Ga0068854_100650509 Ga0068854_1006505091 252
196 3300005614 Ga0068856_100003884 Ga0068856_10000388415 252
197 3300005614 Ga0068856_100036948 Ga0068856_1000369484 252
198 3300005615 Ga0070702_100018825 Ga0070702_1000188253 252
199 3300005618 Ga0068864_100040851 Ga0068864_1000408513 252
200 3300005719 Ga0068861_100008519 Ga0068861_1000085195 252
201 3300005834 Ga0068851_10132989 Ga0068851_101329892 252
202 3300005842 Ga0068858_100312125 Ga0068858_1003121252 252
203 3300005937 Ga0081455_10161911 Ga0081455_101619111 252
204 3300006058 Ga0075432_10092587 Ga0075432_100925872 252
205 3300006163 Ga0070715_10068857 Ga0070715_100688572 252
206 3300006173 Ga0070716_100158041 Ga0070716_1001580412 252
207 3300006175 Ga0070712_100096931 Ga0070712_1000969312 252
208 3300006237 Ga0097621_100120655 Ga0097621_1001206553 252
209 3300006852 Ga0075433_10001761 Ga0075433_100017614 252
210 3300006871 Ga0075434_100082294 Ga0075434_1000822942 252
211 3300009093 Ga0105240_10080893 Ga0105240_100808934 252
212 3300009094 Ga0111539_10203634 Ga0111539_102036342 252
213 3300009098 Ga0105245_10044472 Ga0105245_100444723 252
214 3300009148 Ga0105243_10110698 Ga0105243_101106982 252
215 3300009174 Ga0105241_10020799 Ga0105241_100207993 252
216 3300009545 Ga0105237_10350897 Ga0105237_103508972 252
217 3300009553 Ga0105249_10159086 Ga0105249_101590862 252
218 3300010375 Ga0105239_10058469 Ga0105239_100584693 252
219 3300010375 Ga0105239_10127596 Ga0105239_101275963 252
220 3300010375 Ga0105239_10255228 Ga0105239_102552284 252
221 3300013102 Ga0157371_10106712 Ga0157371_101067122 252
222 3300013297 Ga0157378_10023624 Ga0157378_100236244 252
223 3300013306 Ga0163162_10024882 Ga0163162_100248823 252
224 3300013307 Ga0157372_10055226 Ga0157372_100552265 252
225 3300013307 Ga0157372_10152724 Ga0157372_101527243 252
226 3300013308 Ga0157375_10191850 Ga0157375_101918503 252
227 3300014325 Ga0163163_10136180 Ga0163163_101361802 252
228 3300014325 Ga0163163_11099892 Ga0163163_110998921 252
229 3300014326 Ga0157380_10121286 Ga0157380_101212863 252
230 3300014968 Ga0157379_10060449 Ga0157379_100604493 252
231 3300014969 Ga0157376_10103690 Ga0157376_101036901 252
232 3300017792 Ga0163161_10021204 Ga0163161_100212043 252
233 3300021388 Ga0213875_10003425 Ga0213875_100034258 252
234 3300025900 Ga0207710_10163739 Ga0207710_101637392 252
235 3300025901 Ga0207688_10024416 Ga0207688_100244163 252
236 3300025904 Ga0207647_10019594 Ga0207647_100195942 252
237 3300025904 Ga0207647_10091935 Ga0207647_100919353 252
238 3300025908 Ga0207643_10052331 Ga0207643_100523313 252
239 3300025913 Ga0207695_10185991 Ga0207695_101859912 252
240 3300025915 Ga0207693_10000246 Ga0207693_100002461 252
241 3300025916 Ga0207663_10305419 Ga0207663_103054192 252
242 3300025919 Ga0207657_10034252 Ga0207657_100342523 252
243 3300025923 Ga0207681_10108537 Ga0207681_101085372 252
244 3300025926 Ga0207659_10293284 Ga0207659_102932842 252
245 3300025929 Ga0207664_10125387 Ga0207664_101253872 252
246 3300025929 Ga0207664_10383725 Ga0207664_103837251 252
247 3300025933 Ga0207706_10027906 Ga0207706_100279064 252
248 3300025935 Ga0207709_10008189 Ga0207709_100081892 252
249 3300025938 Ga0207704_10202534 Ga0207704_102025342 252
250 3300025939 Ga0207665_10008487 Ga0207665_100084876 252
251 3300025941 Ga0207711_10534678 Ga0207711_105346782 252
252 3300025942 Ga0207689_10019691 Ga0207689_100196913 252
253 3300025949 Ga0207667_10083640 Ga0207667_100836402 252
254 3300025949 Ga0207667_10302594 Ga0207667_103025942 252
255 3300025960 Ga0207651_10193568 Ga0207651_101935682 252
256 3300025961 Ga0207712_10095828 Ga0207712_100958283 252
257 3300025972 Ga0207668_10069425 Ga0207668_100694252 252
258 3300025981 Ga0207640_10166077 Ga0207640_101660772 252
259 3300025981 Ga0207640_10403686 Ga0207640_104036862 252
260 3300026035 Ga0207703_10082278 Ga0207703_100822782 252
261 3300026041 Ga0207639_10143471 Ga0207639_101434712 252
262 3300026067 Ga0207678_10004183 Ga0207678_100041836 252
263 3300026078 Ga0207702_10045313 Ga0207702_100453133 252
264 3300026078 Ga0207702_10402177 Ga0207702_104021772 252
265 3300026078 Ga0207702_10692164 Ga0207702_106921641 252
266 3300026116 Ga0207674_10136658 Ga0207674_101366584 252
267 3300026118 Ga0207675_100007041 Ga0207675_1000070415 252
268 3300026121 Ga0207683_10004064 Ga0207683_100040645 252
269 3300027907 Ga0207428_10078646 Ga0207428_100786463 252
270 3300028379 Ga0268266_10205550 Ga0268266_102055503 252
271 3300031247 Ga0265340_10000557 Ga0265340_100005573 252
272 3300031456 Ga0307513_10001922 Ga0307513_1000192215 252
273 3300034957 Ga0373938_0011976 Ga0373938_0011976_738_1529 252
274 3300035084 Ga0373928_0019090 Ga0373928_0019090_177_968 252
275 3300035088 Ga0373940_0014177 Ga0373940_0014177_262_1053 252
276 3300035114 Ga0373939_0013578 Ga0373939_0013578_541_1332 252
277 3300035170 Ga0373943_0270966 Ga0373943_0270966_22_819 252
278 3300035207 Ga0373942_0003232 Ga0373942_0003232_1413_2204 252
279 3300035691 Ga0373931_0065853 Ga0373931_0065853_644_1435 252
280 3300037068 Ga0373925_0000013 Ga0373925_0000013_154412_155209 252
281 3300037068 Ga0373925_0308816 Ga0373925_0308816_170_967 252
282 3300037466 Ga0395898_0066836 Ga0395898_0066836_2398_3222 252
283 3300037853 Ga0436364_0662240 Ga0436364_0662240_182_976 252
284 3300037853 Ga0436364_0692680 Ga0436364_0692680_5751_6533 252
285 3300041443 Ga0451789_0667087 Ga0451789_0667087_421_1224 252
286 3300041509 Ga0451843_0465946 Ga0451843_0465946_68_877 252
287 3300044658 Ga0466972_0143089 Ga0466972_0143089_263_1042 252
288 3300044684 Ga0466966_0245669 Ga0466966_0245669_19_903 252
289 3300044693 Ga0466961_0030576 Ga0466961_0030576_1102_1890 252
290 3300046460 Ga0495638_0085758 Ga0495638_0085758_904_1713 252
291 3300046492 Ga0495585_0032169 Ga0495585_0032169_1632_2396 252
292 3300046690 Ga0495624_0037279 Ga0495624_0037279_695_1486 252
293 3300047317 Ga0495604_0251474 Ga0495604_0251474_171_932 252
294 3300048904 Ga0496101_0261682 Ga0496101_0261682_428_1219 252
295 3300048905 Ga0496102_0015990 Ga0496102_0015990_3739_4530 252
296 3300048907 Ga0496104_0320999 Ga0496104_0320999_17_808 252
297 3300048911 Ga0496108_0083136 Ga0496108_0083136_206_997 252
298 3300048912 Ga0496109_0534043 Ga0496109_0534043_80_838 252
299 3300048914 Ga0496111_0055911 Ga0496111_0055911_290_1081 252
300 3300048914 Ga0496111_0471609 Ga0496111_0471609_18_785 252
301 3300048915 Ga0496112_0604516 Ga0496112_0604516_36_827 252
302 3300048917 Ga0496114_0046112 Ga0496114_0046112_273_1064 252
303 3300048918 Ga0496115_0379821 Ga0496115_0379821_332_1123 252
304 3300048922 Ga0496119_0007875 Ga0496119_0007875_5549_6313 252
305 3300048924 Ga0496121_0033007 Ga0496121_0033007_695_1486 252
306 3300048925 Ga0496122_0003001 Ga0496122_0003001_3637_4401 252
307 3300050511 nmdc:mga08y16_214063_c1 nmdc:mga08y16_214063_c1_595_1386 252
308 3300050512 nmdc:mga0n895_286656_c1 nmdc:mga0n895_286656_c1_821_1612 252
309 3300050513 nmdc:mga0rr50_101889_c1 nmdc:mga0rr50_101889_c1_692_1483 252
310 3300050514 nmdc:mga08x19_129819_c1 nmdc:mga08x19_129819_c1_398_1189 252
311 3300050515 nmdc:mga0a205_56310_c1 nmdc:mga0a205_56310_c1_2041_2832 252
312 3300053104 Ga0500556_0000017 Ga0500556_0000017_102570_103334 252
313 3300053153 Ga0500616_0004328 Ga0500616_0004328_2400_3209 252
314 3300053730 Ga0500645_016520 Ga0500645_016520_1230_1994 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

42

272

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nd1-assembly1.cif.gz_B crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9151 1 252
3nd1-assembly1.cif.gz_A crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9142 1 252
2npn-assembly1.cif.gz_A crystal structure of putative cobalamin synthesis related protein (cobf) from corynebacterium diphtheriae 0.9123 1 250
3nd1-assembly1.cif.gz_B crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9082 1 252
3nd1-assembly1.cif.gz_A crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9071 1 252
ID Description Score Start End Superfamily
3nd1B02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9672 144 252 3.30.950.10
3nd1B02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9502 144 252 3.30.950.10
2npnA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9147 144 250 3.30.950.10
2npnA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8901 144 250 3.30.950.10
3nd1A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8537 1 143 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A6J7H877-F1-model_v4 Unannotated protein 0.9924 165 251 GO:0008168
AF-A0A6B3C8V2-F1-model_v4 Precorrin-6A synthase (Deacetylating) (EC 2.1.1.152) 0.9877 138 251 GO:0009236
GO:0032259
GO:0043819
AF-A0A529Y3U9-F1-model_v4 Precorrin-6A synthase (Deacetylating) 0.9751 198 252 GO:0008168
AF-A0A640SBS1-F1-model_v4 Immunity protein 35 domain-containing protein 0.9745 182 252 GO:0008168
AF-A0A2M9PEW2-F1-model_v4 Precorrin-6A synthase (Deacetylating) 0.9716 150 251 GO:0008168

Feature Viewer

pLDDT pTM Quality
90.66 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map