F402543

General Info

Members Datasets Scaffolds Average Seq Length
314 184 628 279

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100569689|Ga0070661_1005696891
Length 289
Sequence VNWLLQVVDPANLGGFFRQVQADMHLPAFWLAVGKIIWINVLLSGDNALVIAMACRGLHGRHRLWGMIIGAGIAVVLLITFTGVVATLMSLPYLKLIGGIALIVIAAKLLVPDDESDEIAAGTTLWHAIRIVVIADIIMSLDNVIAVAAAANGEVVLLTLGLAISIPMIIAGAALIMLVLDRFPVLVWLGAILLGWIAGDVMETDPVVQPVLHRILDGTIALHIDAQSAIFGISPQLALEGELDEYIASVLGALVVLIAGSIWRRRRTRQLQDIALSDQGEAIQSIERP

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
178 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
179 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
183 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
184 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0.64
Rhizoplane 5.73
Rhizosphere 78.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100569689 3300005344 Bacteria 913
2 Ga0070683_100008950 3300005329 Bacteria 8532
3 Ga0070683_100320504 3300005329 Bacteria 1475
4 Ga0070680_100062297 3300005336 Bacteria 3054
5 Ga0070680_100111494 3300005336 Bacteria 2277
6 Ga0070691_10132325 3300005341 Bacteria 1265
7 Ga0070709_10004181 3300005434 Bacteria 7779
8 Ga0070709_10008791 3300005434 Bacteria 5557
9 Ga0070709_10067571 3300005434 Bacteria 2296
10 Ga0070709_10141105 3300005434 Bacteria 1656
11 Ga0070709_10295603 3300005434 Bacteria 1181
12 Ga0070714_100002494 3300005435 Bacteria 13584
13 Ga0070714_100003754 3300005435 Bacteria 11391
14 Ga0070714_100016267 3300005435 Bacteria 6000
15 Ga0070714_100060238 3300005435 Bacteria 3257
16 Ga0070714_100231368 3300005435 Bacteria 1703
17 Ga0070714_100251974 3300005435 Bacteria 1633
18 Ga0070713_100001137 3300005436 Bacteria 17038
19 Ga0070713_100014513 3300005436 Bacteria 5855
20 Ga0070713_100026225 3300005436 Bacteria 4572
21 Ga0070713_100063357 3300005436 Bacteria 3099
22 Ga0070713_100164400 3300005436 Bacteria 1983
23 Ga0070713_100354000 3300005436 Bacteria 1363
24 Ga0070713_100481793 3300005436 Bacteria 1169
25 Ga0070710_10000228 3300005437 Bacteria 26215
26 Ga0070710_10000996 3300005437 Bacteria 13478
27 Ga0070710_10049132 3300005437 Bacteria 2359
28 Ga0070711_100000787 3300005439 Bacteria 16583
29 Ga0070711_100014742 3300005439 Bacteria 4933
30 Ga0070711_100015860 3300005439 Bacteria 4772
31 Ga0070711_100069518 3300005439 Bacteria 2477
32 Ga0070711_100201887 3300005439 Bacteria 1535
33 Ga0070711_100283397 3300005439 Bacteria 1312
34 Ga0070663_100220541 3300005455 Bacteria 1489
35 Ga0070681_10053258 3300005458 Bacteria 4032
36 Ga0070681_10073793 3300005458 Bacteria 3374
37 Ga0070681_10127156 3300005458 Bacteria 2481
38 Ga0070706_100569630 3300005467 Bacteria 1053
39 Ga0070698_100003224 3300005471 Bacteria 17973
40 Ga0070679_100095807 3300005530 Bacteria 2955
41 Ga0070679_100131714 3300005530 Bacteria 2481
42 Ga0070684_100002603 3300005535 Bacteria 13319
43 Ga0070684_100393476 3300005535 Bacteria 1277
44 Ga0070684_100414532 3300005535 Bacteria 1243
45 Ga0070697_100535435 3300005536 Bacteria 1026
46 Ga0068853_100223469 3300005539 Bacteria 1721
47 Ga0068853_100242057 3300005539 Bacteria 1654
48 Ga0070693_100127395 3300005547 Bacteria 1587
49 Ga0070665_100709373 3300005548 Bacteria 1019
50 Ga0068855_100126574 3300005563 Bacteria 2921
51 Ga0068855_100147603 3300005563 Bacteria 2676
52 Ga0068856_100000205 3300005614 Bacteria 63226
53 Ga0068856_100327695 3300005614 Bacteria 1549
54 Ga0068856_100335530 3300005614 Bacteria 1530
55 Ga0068856_100662284 3300005614 Bacteria 1064
56 Ga0068852_100368293 3300005616 Bacteria 1407
57 Ga0068858_100137359 3300005842 Bacteria 2294
58 Ga0070717_10002705 3300006028 Bacteria 12496
59 Ga0070717_10002748 3300006028 Bacteria 12435
60 Ga0070717_10004596 3300006028 Bacteria 9995
61 Ga0070717_10113382 3300006028 Bacteria 2315
62 Ga0070715_10001629 3300006163 Bacteria 6637
63 Ga0070716_100000546 3300006173 Bacteria 15786
64 Ga0070716_100364070 3300006173 Bacteria 1028
65 Ga0070712_100019943 3300006175 Bacteria 4383
66 Ga0070712_100040750 3300006175 Bacteria 3185
67 Ga0070712_100044340 3300006175 Bacteria 3066
68 Ga0070712_100176049 3300006175 Bacteria 1664
69 Ga0075434_100042109 3300006871 Bacteria 4527
70 Ga0075435_100073732 3300007076 Bacteria 2791
71 Ga0099794_10122876 3300007265 Bacteria 1307
72 Ga0105240_10007997 3300009093 Bacteria 15232
73 Ga0105248_10306169 3300009177 Bacteria 1789
74 Ga0105237_10127306 3300009545 Bacteria 2541
75 Ga0105238_10006848 3300009551 Bacteria 11380
76 Ga0105238_10032858 3300009551 Bacteria 5282
77 Ga0105238_10094921 3300009551 Bacteria 2970
78 Ga0105239_10034837 3300010375 Bacteria 5529
79 Ga0105239_10134019 3300010375 Bacteria 2757
80 Ga0157370_10212657 3300013104 Bacteria 1792
81 Ga0157370_10547522 3300013104 Bacteria 1061
82 Ga0157369_10005656 3300013105 Bacteria 14523
83 Ga0157369_10088690 3300013105 Bacteria 3302
84 Ga0157369_10690716 3300013105 Bacteria 1051
85 Ga0157374_10453489 3300013296 Bacteria 1284
86 Ga0163162_10143930 3300013306 Bacteria 2498
87 Ga0163162_10189113 3300013306 Bacteria 2186
88 Ga0157372_10199071 3300013307 Bacteria 2320
89 Ga0157375_10145751 3300013308 Bacteria 2499
90 Ga0157379_10090583 3300014968 Bacteria 2744
91 Ga0213872_10069333 3300021361 Bacteria 1590
92 Ga0213872_10093859 3300021361 Bacteria 1341
93 Ga0213874_10010344 3300021377 Bacteria 2334
94 Ga0213876_10002845 3300021384 Bacteria 10068
95 Ga0213876_10110212 3300021384 Bacteria 1461
96 Ga0209148_1011771 3300025254 Bacteria 1617
97 Ga0209233_1001992 3300025261 Bacteria 7729
98 Ga0209455_1002455 3300025272 Bacteria 7161
99 Ga0209455_1029492 3300025272 Bacteria 946
100 Ga0207692_10000661 3300025898 Bacteria 12146
101 Ga0207692_10000921 3300025898 Bacteria 10633
102 Ga0207692_10018672 3300025898 Bacteria 3117
103 Ga0207692_10071346 3300025898 Bacteria 1831
104 Ga0207647_10098991 3300025904 Bacteria 1732
105 Ga0207685_10012839 3300025905 Bacteria 2571
106 Ga0207699_10001643 3300025906 Bacteria 10600
107 Ga0207699_10005165 3300025906 Bacteria 6249
108 Ga0207699_10162998 3300025906 Bacteria 1486
109 Ga0207684_10289272 3300025910 Bacteria 1413
110 Ga0207684_10465245 3300025910 Bacteria 1085
111 Ga0207654_10154036 3300025911 Bacteria 1478
112 Ga0207707_10002657 3300025912 Bacteria 15988
113 Ga0207707_10013230 3300025912 Bacteria 7190
114 Ga0207695_10168238 3300025913 Bacteria 2119
115 Ga0207695_10436828 3300025913 Bacteria 1193
116 Ga0207671_10073198 3300025914 Bacteria 2559
117 Ga0207693_10000095 3300025915 Bacteria 78764
118 Ga0207693_10020106 3300025915 Bacteria 5310
119 Ga0207693_10039678 3300025915 Bacteria 3707
120 Ga0207693_10181203 3300025915 Bacteria 1658
121 Ga0207663_10000383 3300025916 Bacteria 19331
122 Ga0207663_10038199 3300025916 Bacteria 2900
123 Ga0207663_10104229 3300025916 Bacteria 1912
124 Ga0207663_10143046 3300025916 Bacteria 1668
125 Ga0207663_10164944 3300025916 Bacteria 1568
126 Ga0207660_10086991 3300025917 Bacteria 2308
127 Ga0207652_10015479 3300025921 Bacteria 6201
128 Ga0207652_10157913 3300025921 Bacteria 2032
129 Ga0207652_10327432 3300025921 Bacteria 1383
130 Ga0207652_10338601 3300025921 Bacteria 1358
131 Ga0207652_10368990 3300025921 Bacteria 1296
132 Ga0207700_10011399 3300025928 Bacteria 5665
133 Ga0207700_10012136 3300025928 Bacteria 5540
134 Ga0207700_10023129 3300025928 Bacteria 4279
135 Ga0207700_10030020 3300025928 Bacteria 3844
136 Ga0207664_10002949 3300025929 Bacteria 11306
137 Ga0207664_10016759 3300025929 Bacteria 5353
138 Ga0207664_10287224 3300025929 Bacteria 1445
139 Ga0207664_10471519 3300025929 Bacteria 1122
140 Ga0207665_10000133 3300025939 Bacteria 49199
141 Ga0207665_10025188 3300025939 Bacteria 3925
142 Ga0207665_10040792 3300025939 Bacteria 3098
143 Ga0207661_10007727 3300025944 Bacteria 7654
144 Ga0207661_10034217 3300025944 Bacteria 3949
145 Ga0207667_10189558 3300025949 Bacteria 2110
146 Ga0207640_10013192 3300025981 Bacteria 4730
147 Ga0207640_10082110 3300025981 Bacteria 2206
148 Ga0207640_10099556 3300025981 Bacteria 2035
149 Ga0207639_10054268 3300026041 Bacteria 3062
150 Ga0207639_10127487 3300026041 Bacteria 2101
151 Ga0207678_10077965 3300026067 Bacteria 2838
152 Ga0207702_10000048 3300026078 Bacteria 143125
153 Ga0207702_10236970 3300026078 Bacteria 1708
154 Ga0207702_10327445 3300026078 Bacteria 1460
155 Ga0207676_10220448 3300026095 Bacteria 1689
156 Ga0207698_10379931 3300026142 Bacteria 1343
157 Ga0268264_10263071 3300028381 Bacteria 1608
158 Ga0265337_1004705 3300028556 Bacteria 5609
159 Ga0265326_10001832 3300028558 Bacteria 7298
160 Ga0265319_1035450 3300028563 Bacteria 1711
161 Ga0265323_10000734 3300028653 Bacteria 17734
162 Ga0265336_10000750 3300028666 Bacteria 17239
163 Ga0265338_10000086 3300028800 Bacteria 175026
164 Ga0265324_10002221 3300029957 Bacteria 10139
165 Ga0265330_10014967 3300031235 Bacteria 3591
166 Ga0265340_10002701 3300031247 Bacteria 10090
167 Ga0265339_10028077 3300031249 Bacteria 3203
168 Ga0307508_10000009 3300031616 Bacteria 256966
169 Ga0307508_10215772 3300031616 Bacteria 1519
170 Ga0265314_10016468 3300031711 Bacteria 5837
171 Ga0265314_10022351 3300031711 Bacteria 4845
172 Ga0265342_10016878 3300031712 Bacteria 4759
173 Ga0265342_10024095 3300031712 Bacteria 3845
174 Ga0373934_0002401 3300035086 Bacteria 6895
175 Ga0373923_0042013 3300035111 Bacteria 1887
176 Ga0373936_0138182 3300035113 Bacteria 1051
177 Ga0373953_0002233 3300035117 Bacteria 5816
178 Ga0373954_0002819 3300035118 Bacteria 7314
179 Ga0373957_0001709 3300035120 Bacteria 6026
180 Ga0373957_0151303 3300035120 Bacteria 953
181 Ga0373955_0013414 3300035172 Bacteria 3963
182 Ga0373955_0047482 3300035172 Bacteria 2325
183 Ga0373924_0021606 3300035410 Bacteria 2510
184 Ga0373935_0165210 3300035692 Bacteria 1511
185 Ga0373927_0081940 3300035695 Bacteria 2091
186 Ga0373933_0000041 3300035724 Bacteria 79805
187 Ga0373937_0055386 3300036401 Bacteria 3640
188 Ga0373937_0298227 3300036401 Bacteria 1523
189 Ga0373937_0389172 3300036401 Bacteria 1322
190 Ga0373925_0016531 3300037068 Bacteria 5346
191 Ga0373925_0061061 3300037068 Bacteria 2831
192 Ga0373925_0130502 3300037068 Bacteria 1959
193 Ga0373925_0234311 3300037068 Bacteria 1469
194 Ga0395900_0047169 3300037418 Bacteria 4436
195 Ga0395900_0401682 3300037418 Bacteria 1334
196 Ga0395898_0009783 3300037466 Bacteria 10048
197 Ga0395898_0017768 3300037466 Bacteria 7257
198 Ga0395898_0032169 3300037466 Bacteria 5235
199 Ga0395898_0351825 3300037466 Bacteria 1405
200 Ga0436364_1040025 3300037853 Bacteria 2380
201 Ga0436364_1040176 3300037853 Bacteria 1303
202 Ga0395901_0299421 3300038443 Bacteria 1668
203 Ga0436365_0199977 3300039437 Bacteria 18549
204 Ga0436365_0650425 3300039437 Bacteria 1193
205 Ga0436365_1129676 3300039437 Bacteria 1027
206 Ga0436365_1585193 3300039437 Bacteria 2064
207 Ga0436360_0958527 3300039438 Bacteria 1739
208 Ga0436361_0220719 3300039447 Bacteria 1795
209 Ga0436361_0261697 3300039447 Bacteria 3401
210 Ga0436363_0146321 3300039450 Bacteria 9529
211 Ga0436362_0762573 3300039453 Bacteria 4514
212 Ga0466969_0093441 3300044656 Bacteria 1423
213 Ga0466966_0017285 3300044684 Bacteria 4766
214 Ga0466963_0023957 3300044694 Bacteria 3882
215 Ga0466971_0167241 3300044719 Bacteria 1031
216 Ga0466959_0173131 3300045049 Bacteria 1513
217 Ga0466958_0129360 3300045836 Bacteria 1585
218 Ga0466967_0082959 3300045976 Bacteria 2898
219 Ga0466967_0150753 3300045976 Bacteria 2173
220 Ga0466967_0200295 3300045976 Bacteria 1891
221 Ga0495592_0032931 3300046454 Bacteria 3909
222 Ga0495629_0063011 3300046459 Bacteria 2589
223 Ga0495651_0011785 3300046462 Bacteria 6719
224 Ga0495651_0021867 3300046462 Bacteria 4973
225 Ga0495653_0029756 3300046463 Bacteria 4355
226 Ga0495664_0133919 3300046477 Bacteria 1501
227 Ga0495664_0211818 3300046477 Bacteria 1173
228 Ga0495608_0014000 3300046511 Bacteria 5564
229 Ga0495628_0013537 3300046516 Bacteria 6862
230 Ga0495652_0007701 3300046529 Bacteria 9920
231 Ga0495640_0007813 3300046533 Bacteria 8413
232 Ga0495586_0034396 3300046535 Bacteria 2722
233 Ga0495645_0028929 3300046543 Bacteria 4027
234 Ga0495645_0306018 3300046543 Bacteria 1036
235 Ga0495667_0002968 3300046559 Bacteria 11373
236 Ga0495634_0011888 3300046642 Bacteria 6324
237 Ga0495657_0043584 3300046675 Bacteria 3058
238 Ga0495599_0019995 3300046678 Bacteria 4170
239 Ga0495623_0005503 3300046679 Bacteria 8270
240 Ga0495613_0111585 3300046689 Bacteria 1970
241 Ga0495600_0006996 3300046809 Bacteria 6886
242 Ga0495604_0055549 3300047317 Bacteria 3051
243 Ga0495674_0046334 3300047319 Bacteria 3859
244 Ga0495680_0022648 3300047322 Bacteria 5233
245 Ga0495680_0312036 3300047322 Bacteria 1102
246 Ga0495675_0009130 3300047444 Bacteria 6163
247 Ga0495684_0005322 3300047471 Bacteria 10023
248 Ga0495593_0011676 3300047673 Bacteria 5040
249 Ga0495602_0038004 3300048088 Bacteria 4457
250 Ga0495602_0098263 3300048088 Bacteria 2410
251 Ga0495602_0160595 3300048088 Bacteria 1755
252 Ga0496100_0432305 3300048903 Bacteria 1007
253 Ga0496101_0049905 3300048904 Bacteria 3011
254 Ga0496102_0088372 3300048905 Bacteria 2865
255 Ga0496104_0483065 3300048907 Bacteria 1150
256 Ga0496106_0000423 3300048909 Bacteria 30107
257 Ga0496107_0000569 3300048910 Bacteria 20544
258 Ga0496108_0002359 3300048911 Bacteria 15126
259 Ga0496108_0178308 3300048911 Bacteria 1840
260 Ga0496109_0000393 3300048912 Bacteria 39750
261 Ga0496109_0257615 3300048912 Bacteria 1643
262 Ga0496110_0014041 3300048913 Bacteria 6638
263 Ga0496112_0016370 3300048915 Bacteria 6945
264 Ga0496112_0145998 3300048915 Bacteria 2334
265 Ga0496113_0413584 3300048916 Bacteria 1083
266 Ga0496114_0130790 3300048917 Bacteria 2167
267 Ga0496115_0064683 3300048918 Bacteria 2953
268 Ga0496115_0124209 3300048918 Bacteria 2125
269 Ga0496115_0173826 3300048918 Bacteria 1781
270 Ga0496121_0001946 3300048924 Bacteria 32906
271 Ga0496121_0026210 3300048924 Bacteria 5502
272 Ga0496121_0043248 3300048924 Bacteria 3904
273 Ga0496121_0047887 3300048924 Bacteria 3642
274 Ga0496124_0022346 3300048927 Bacteria 5799
275 Ga0496125_0078178 3300048928 Bacteria 2545
276 Ga0496126_0014646 3300048929 Bacteria 7916
277 Ga0496126_0017274 3300048929 Bacteria 7189
278 Ga0496126_0050054 3300048929 Bacteria 3810
279 Ga0496126_0074979 3300048929 Bacteria 3003
280 Ga0496126_0112012 3300048929 Bacteria 2376
281 Ga0496126_0156792 3300048929 Bacteria 1948
282 Ga0496126_0157395 3300048929 Bacteria 1944
283 Ga0496126_0167192 3300048929 Bacteria 1876
284 Ga0501046_0029444 3300049580 Bacteria 4463
285 Ga0501047_0009136 3300049581 Bacteria 9360
286 Ga0501047_0425981 3300049581 Bacteria 1158
287 Ga0501070_0044720 3300049586 Bacteria 3683
288 Ga0501073_0062141 3300049589 Bacteria 2605
289 Ga0501074_0049907 3300049590 Bacteria 3021
290 Ga0501080_0105881 3300049742 Bacteria 2607
291 Ga0501044_0100591 3300049823 Bacteria 2909
292 nmdc:mga0n895_4616_c1 3300050512 Bacteria 11356
293 nmdc:mga08x19_141960_c1 3300050514 Bacteria 1622
294 Ga0495601_0393728 3300053077 Bacteria 898
295 Ga0495612_0011064 3300053078 Bacteria 3642
296 Ga0500635_0099559 3300053080 Bacteria 1067
297 Ga0495619_0158498 3300053085 Bacteria 1562
298 Ga0500647_0013555 3300053091 Bacteria 3688
299 Ga0500566_0000026 3300053094 Bacteria 77138
300 Ga0500640_000375 3300053095 Bacteria 10534
301 Ga0500572_000596 3300053111 Bacteria 12198
302 Ga0500572_003516 3300053111 Bacteria 3571
303 Ga0500614_000455 3300053123 Bacteria 10609
304 Ga0500559_0000081 3300053136 Bacteria 75262
305 Ga0500559_0003568 3300053136 Bacteria 7609
306 Ga0500603_000327 3300053150 Bacteria 12434
307 Ga0500630_000530 3300053159 Bacteria 17155
308 Ga0500639_000673 3300053163 Bacteria 17246
309 Ga0500636_0299353 3300053177 Bacteria 793
310 Ga0500637_0012297 3300053178 Bacteria 4457
311 Ga0500596_000502 3300053735 Bacteria 7363
312 Ga0500596_000530 3300053735 Bacteria 7209
313 2509150964 2508501128 Bacteria 8613869
314 2513894030 2513237141 Bacteria 8496279
315 Ga0070661_100569689
316 Ga0070683_100008950
317 Ga0070683_100320504
318 Ga0070680_100062297
319 Ga0070680_100111494
320 Ga0070691_10132325
321 Ga0070709_10004181
322 Ga0070709_10008791
323 Ga0070709_10067571
324 Ga0070709_10141105
325 Ga0070709_10295603
326 Ga0070714_100002494
327 Ga0070714_100003754
328 Ga0070714_100016267
329 Ga0070714_100060238
330 Ga0070714_100231368
331 Ga0070714_100251974
332 Ga0070713_100001137
333 Ga0070713_100014513
334 Ga0070713_100026225
335 Ga0070713_100063357
336 Ga0070713_100164400
337 Ga0070713_100354000
338 Ga0070713_100481793
339 Ga0070710_10000228
340 Ga0070710_10000996
341 Ga0070710_10049132
342 Ga0070711_100000787
343 Ga0070711_100014742
344 Ga0070711_100015860
345 Ga0070711_100069518
346 Ga0070711_100201887
347 Ga0070711_100283397
348 Ga0070663_100220541
349 Ga0070681_10053258
350 Ga0070681_10073793
351 Ga0070681_10127156
352 Ga0070706_100569630
353 Ga0070698_100003224
354 Ga0070679_100095807
355 Ga0070679_100131714
356 Ga0070684_100002603
357 Ga0070684_100393476
358 Ga0070684_100414532
359 Ga0070697_100535435
360 Ga0068853_100223469
361 Ga0068853_100242057
362 Ga0070693_100127395
363 Ga0070665_100709373
364 Ga0068855_100126574
365 Ga0068855_100147603
366 Ga0068856_100000205
367 Ga0068856_100327695
368 Ga0068856_100335530
369 Ga0068856_100662284
370 Ga0068852_100368293
371 Ga0068858_100137359
372 Ga0070717_10002705
373 Ga0070717_10002748
374 Ga0070717_10004596
375 Ga0070717_10113382
376 Ga0070715_10001629
377 Ga0070716_100000546
378 Ga0070716_100364070
379 Ga0070712_100019943
380 Ga0070712_100040750
381 Ga0070712_100044340
382 Ga0070712_100176049
383 Ga0075434_100042109
384 Ga0075435_100073732
385 Ga0099794_10122876
386 Ga0105240_10007997
387 Ga0105248_10306169
388 Ga0105237_10127306
389 Ga0105238_10006848
390 Ga0105238_10032858
391 Ga0105238_10094921
392 Ga0105239_10034837
393 Ga0105239_10134019
394 Ga0157370_10212657
395 Ga0157370_10547522
396 Ga0157369_10005656
397 Ga0157369_10088690
398 Ga0157369_10690716
399 Ga0157374_10453489
400 Ga0163162_10143930
401 Ga0163162_10189113
402 Ga0157372_10199071
403 Ga0157375_10145751
404 Ga0157379_10090583
405 Ga0213872_10069333
406 Ga0213872_10093859
407 Ga0213874_10010344
408 Ga0213876_10002845
409 Ga0213876_10110212
410 Ga0209148_1011771
411 Ga0209233_1001992
412 Ga0209455_1002455
413 Ga0209455_1029492
414 Ga0207692_10000661
415 Ga0207692_10000921
416 Ga0207692_10018672
417 Ga0207692_10071346
418 Ga0207647_10098991
419 Ga0207685_10012839
420 Ga0207699_10001643
421 Ga0207699_10005165
422 Ga0207699_10162998
423 Ga0207684_10289272
424 Ga0207684_10465245
425 Ga0207654_10154036
426 Ga0207707_10002657
427 Ga0207707_10013230
428 Ga0207695_10168238
429 Ga0207695_10436828
430 Ga0207671_10073198
431 Ga0207693_10000095
432 Ga0207693_10020106
433 Ga0207693_10039678
434 Ga0207693_10181203
435 Ga0207663_10000383
436 Ga0207663_10038199
437 Ga0207663_10104229
438 Ga0207663_10143046
439 Ga0207663_10164944
440 Ga0207660_10086991
441 Ga0207652_10015479
442 Ga0207652_10157913
443 Ga0207652_10327432
444 Ga0207652_10338601
445 Ga0207652_10368990
446 Ga0207700_10011399
447 Ga0207700_10012136
448 Ga0207700_10023129
449 Ga0207700_10030020
450 Ga0207664_10002949
451 Ga0207664_10016759
452 Ga0207664_10287224
453 Ga0207664_10471519
454 Ga0207665_10000133
455 Ga0207665_10025188
456 Ga0207665_10040792
457 Ga0207661_10007727
458 Ga0207661_10034217
459 Ga0207667_10189558
460 Ga0207640_10013192
461 Ga0207640_10082110
462 Ga0207640_10099556
463 Ga0207639_10054268
464 Ga0207639_10127487
465 Ga0207678_10077965
466 Ga0207702_10000048
467 Ga0207702_10236970
468 Ga0207702_10327445
469 Ga0207676_10220448
470 Ga0207698_10379931
471 Ga0268264_10263071
472 Ga0265337_1004705
473 Ga0265326_10001832
474 Ga0265319_1035450
475 Ga0265323_10000734
476 Ga0265336_10000750
477 Ga0265338_10000086
478 Ga0265324_10002221
479 Ga0265330_10014967
480 Ga0265340_10002701
481 Ga0265339_10028077
482 Ga0307508_10000009
483 Ga0307508_10215772
484 Ga0265314_10016468
485 Ga0265314_10022351
486 Ga0265342_10016878
487 Ga0265342_10024095
488 Ga0373934_0002401
489 Ga0373923_0042013
490 Ga0373936_0138182
491 Ga0373953_0002233
492 Ga0373954_0002819
493 Ga0373957_0001709
494 Ga0373957_0151303
495 Ga0373955_0013414
496 Ga0373955_0047482
497 Ga0373924_0021606
498 Ga0373935_0165210
499 Ga0373927_0081940
500 Ga0373933_0000041
501 Ga0373937_0055386
502 Ga0373937_0298227
503 Ga0373937_0389172
504 Ga0373925_0016531
505 Ga0373925_0061061
506 Ga0373925_0130502
507 Ga0373925_0234311
508 Ga0395900_0047169
509 Ga0395900_0401682
510 Ga0395898_0009783
511 Ga0395898_0017768
512 Ga0395898_0032169
513 Ga0395898_0351825
514 Ga0436364_1040025
515 Ga0436364_1040176
516 Ga0395901_0299421
517 Ga0436365_0199977
518 Ga0436365_0650425
519 Ga0436365_1129676
520 Ga0436365_1585193
521 Ga0436360_0958527
522 Ga0436361_0220719
523 Ga0436361_0261697
524 Ga0436363_0146321
525 Ga0436362_0762573
526 Ga0466969_0093441
527 Ga0466966_0017285
528 Ga0466963_0023957
529 Ga0466971_0167241
530 Ga0466959_0173131
531 Ga0466958_0129360
532 Ga0466967_0082959
533 Ga0466967_0150753
534 Ga0466967_0200295
535 Ga0495592_0032931
536 Ga0495629_0063011
537 Ga0495651_0011785
538 Ga0495651_0021867
539 Ga0495653_0029756
540 Ga0495664_0133919
541 Ga0495664_0211818
542 Ga0495608_0014000
543 Ga0495628_0013537
544 Ga0495652_0007701
545 Ga0495640_0007813
546 Ga0495586_0034396
547 Ga0495645_0028929
548 Ga0495645_0306018
549 Ga0495667_0002968
550 Ga0495634_0011888
551 Ga0495657_0043584
552 Ga0495599_0019995
553 Ga0495623_0005503
554 Ga0495613_0111585
555 Ga0495600_0006996
556 Ga0495604_0055549
557 Ga0495674_0046334
558 Ga0495680_0022648
559 Ga0495680_0312036
560 Ga0495675_0009130
561 Ga0495684_0005322
562 Ga0495593_0011676
563 Ga0495602_0038004
564 Ga0495602_0098263
565 Ga0495602_0160595
566 Ga0496100_0432305
567 Ga0496101_0049905
568 Ga0496102_0088372
569 Ga0496104_0483065
570 Ga0496106_0000423
571 Ga0496107_0000569
572 Ga0496108_0002359
573 Ga0496108_0178308
574 Ga0496109_0000393
575 Ga0496109_0257615
576 Ga0496110_0014041
577 Ga0496112_0016370
578 Ga0496112_0145998
579 Ga0496113_0413584
580 Ga0496114_0130790
581 Ga0496115_0064683
582 Ga0496115_0124209
583 Ga0496115_0173826
584 Ga0496121_0001946
585 Ga0496121_0026210
586 Ga0496121_0043248
587 Ga0496121_0047887
588 Ga0496124_0022346
589 Ga0496125_0078178
590 Ga0496126_0014646
591 Ga0496126_0017274
592 Ga0496126_0050054
593 Ga0496126_0074979
594 Ga0496126_0112012
595 Ga0496126_0156792
596 Ga0496126_0157395
597 Ga0496126_0167192
598 Ga0501046_0029444
599 Ga0501047_0009136
600 Ga0501047_0425981
601 Ga0501070_0044720
602 Ga0501073_0062141
603 Ga0501074_0049907
604 Ga0501080_0105881
605 Ga0501044_0100591
606 nmdc:mga0n895_4616_c1
607 nmdc:mga08x19_141960_c1
608 Ga0495601_0393728
609 Ga0495612_0011064
610 Ga0500635_0099559
611 Ga0495619_0158498
612 Ga0500647_0013555
613 Ga0500566_0000026
614 Ga0500640_000375
615 Ga0500572_000596
616 Ga0500572_003516
617 Ga0500614_000455
618 Ga0500559_0000081
619 Ga0500559_0003568
620 Ga0500603_000327
621 Ga0500630_000530
622 Ga0500639_000673
623 Ga0500636_0299353
624 Ga0500637_0012297
625 Ga0500596_000502
626 Ga0500596_000530
627 2509150964
628 2513894030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

34

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m2l-assembly1.cif.gz_A crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 0.4468 23 202
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.4048 23 205
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.4019 35 260
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3979 19 270
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.3836 36 263
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.811 36 202 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.774 36 202 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7209 36 202 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6441 36 202 1.20.1250.20
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6013 188 262 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1H4RSM6-F1-model_v4 Integral membrane protein, YjbE family 0.9292 32 267 GO:0016020
AF-A0A2N4YRJ7-F1-model_v4 TerC family protein 0.914 21 213 GO:0016020
AF-F5L5E6-F1-model_v4 Integral membrane protein, YjbE family (TerC family protein) 0.9132 30 268 GO:0016020
AF-A0A1Z8NMG8-F1-model_v4 Tellurium resistance protein TerC 0.9126 26 266 GO:0016020
AF-A0A015L0V5-F1-model_v4 deleted 0.9052 30 206

Map