F402534

General Info

Members Datasets Scaffolds Average Seq Length
314 212 628 158

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002987|Ga0070680_1000029875
Length 194
Sequence VVVPECSVLIFTFNISFRKNCPGPKGPFSLAFVYDDATMRGDADIITALNDILTSELTAINQYFVHYKMLENWGYFRLAKKKREESIEEMKHADRLIARILYLDGVPNLQRLGPVKVGEDPLEMNKLDMELEQEAVVRLNKAIDLCGKKLDAGTRELLESVLVEEEDAIDWLDAQARIVNDIGRERYLSEQLRE

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
189 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
197 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
198 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 2831864461 Roseateles noduli HZ7 Isolate Nodule
212 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0.96
Rhizoplane 7.01
Rhizosphere 84.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100002987 3300005336 Bacteria 12560
2 rootH1_10134775 3300003323 Bacteria 3399
3 Ga0070676_10295816 3300005328 Bacteria 1096
4 Ga0070676_10610520 3300005328 Bacteria 788
5 Ga0070683_100142014 3300005329 Bacteria 2275
6 Ga0068869_100461723 3300005334 Bacteria 1054
7 Ga0070682_100301623 3300005337 Bacteria 1176
8 Ga0070682_100844652 3300005337 Bacteria 748
9 Ga0070682_101517086 3300005337 Bacteria 577
10 Ga0068868_100535714 3300005338 Bacteria 1030
11 Ga0068868_101461190 3300005338 Bacteria 639
12 Ga0070691_10773214 3300005341 Bacteria 582
13 Ga0070671_100736475 3300005355 Bacteria 856
14 Ga0070688_100032005 3300005365 Bacteria 3168
15 Ga0070703_10018193 3300005406 Bacteria 2029
16 Ga0070709_10429438 3300005434 Bacteria 992
17 Ga0070713_100766555 3300005436 Bacteria 924
18 Ga0070710_10209862 3300005437 Bacteria 1234
19 Ga0070710_10427039 3300005437 Bacteria 894
20 Ga0070701_10884103 3300005438 Bacteria 616
21 Ga0070711_100060096 3300005439 Bacteria 2641
22 Ga0070705_100007324 3300005440 Bacteria 5430
23 Ga0070705_100042795 3300005440 Bacteria 2591
24 Ga0070700_100000001 3300005441 Bacteria 346167
25 Ga0070694_100124455 3300005444 Bacteria 1854
26 Ga0070708_100260043 3300005445 Bacteria 1632
27 Ga0070708_100764424 3300005445 Bacteria 909
28 Ga0070708_100773494 3300005445 Bacteria 903
29 Ga0070708_101753261 3300005445 Bacteria 577
30 Ga0070678_100624652 3300005456 Bacteria 964
31 Ga0070681_10085922 3300005458 Bacteria 3099
32 Ga0070681_10387272 3300005458 Bacteria 1309
33 Ga0070706_100003492 3300005467 Bacteria 15447
34 Ga0070706_100018775 3300005467 Bacteria 6376
35 Ga0070706_100058595 3300005467 Bacteria 3554
36 Ga0070706_100069591 3300005467 Bacteria 3255
37 Ga0070707_100079460 3300005468 Bacteria 3166
38 Ga0070707_100214236 3300005468 Bacteria 1877
39 Ga0070698_100002361 3300005471 Bacteria 20833
40 Ga0070698_100055140 3300005471 Bacteria 4033
41 Ga0070699_100299761 3300005518 Bacteria 1442
42 Ga0070699_100562094 3300005518 Bacteria 1039
43 Ga0070679_100000583 3300005530 Bacteria 30891
44 Ga0070679_100634756 3300005530 Bacteria 1011
45 Ga0070684_100013189 3300005535 Bacteria 6654
46 Ga0070684_100106407 3300005535 Bacteria 2511
47 Ga0070684_100323933 3300005535 Bacteria 1416
48 Ga0070684_101525911 3300005535 Bacteria 630
49 Ga0070697_101006188 3300005536 Bacteria 741
50 Ga0068853_100002426 3300005539 Bacteria 13937
51 Ga0070695_100006489 3300005545 Bacteria 6915
52 Ga0070695_100050401 3300005545 Bacteria 2668
53 Ga0070696_100136079 3300005546 Bacteria 1791
54 Ga0070704_100030431 3300005549 Bacteria 3617
55 Ga0070704_100211602 3300005549 Bacteria 1571
56 Ga0068855_100102737 3300005563 Bacteria 3289
57 Ga0068855_100137961 3300005563 Bacteria 2782
58 Ga0070664_100678720 3300005564 Bacteria 959
59 Ga0068857_101173484 3300005577 Bacteria 743
60 Ga0068856_100160031 3300005614 Bacteria 2262
61 Ga0068859_100470900 3300005617 Bacteria 1352
62 Ga0068860_101113587 3300005843 Bacteria 809
63 Ga0068860_101481815 3300005843 Bacteria 700
64 Ga0081540_1010566 3300005983 Bacteria 6237
65 Ga0070717_10082078 3300006028 Bacteria 2708
66 Ga0075363_100191111 3300006048 Bacteria 1168
67 Ga0075364_10384139 3300006051 Bacteria 958
68 Ga0070712_100304342 3300006175 Bacteria 1291
69 Ga0070712_100518619 3300006175 Bacteria 1001
70 Ga0075366_10665725 3300006195 Bacteria 646
71 Ga0075366_10752408 3300006195 Bacteria 606
72 Ga0075366_10974097 3300006195 Bacteria 529
73 Ga0075370_10162672 3300006353 Bacteria 1310
74 Ga0068871_100143186 3300006358 Bacteria 2034
75 Ga0075428_100582885 3300006844 Bacteria 1195
76 Ga0075431_100454144 3300006847 Bacteria 1277
77 Ga0075433_10060685 3300006852 Bacteria 3312
78 Ga0075434_100442432 3300006871 Bacteria 1321
79 Ga0075434_101123357 3300006871 Bacteria 799
80 Ga0075429_100426813 3300006880 Bacteria 1161
81 Ga0075429_100554841 3300006880 Bacteria 1007
82 Ga0075429_101421486 3300006880 Bacteria 604
83 Ga0068865_100480934 3300006881 Bacteria 1032
84 Ga0097620_100470915 3300006931 Bacteria 1352
85 Ga0099826_10000007 3300006948 Bacteria 393518
86 Ga0105240_10021076 3300009093 Bacteria 8675
87 Ga0111539_10004541 3300009094 Bacteria 18154
88 Ga0111539_10462104 3300009094 Bacteria 1478
89 Ga0111539_11207382 3300009094 Bacteria 878
90 Ga0105247_10162940 3300009101 Bacteria 1478
91 Ga0114129_10198139 3300009147 Bacteria 2722
92 Ga0114129_10267745 3300009147 Bacteria 2287
93 Ga0114129_10453665 3300009147 Bacteria 1681
94 Ga0114129_11149465 3300009147 Bacteria 969
95 Ga0105241_10426363 3300009174 Bacteria 1168
96 Ga0105242_11473197 3300009176 Bacteria 710
97 Ga0105237_10007486 3300009545 Bacteria 11940
98 Ga0105237_10155273 3300009545 Bacteria 2285
99 Ga0105238_10025179 3300009551 Bacteria 6064
100 Ga0105249_10488251 3300009553 Bacteria 1275
101 Ga0105239_10067872 3300010375 Bacteria 3918
102 Ga0157370_10254213 3300013104 Bacteria 1625
103 Ga0157374_10084709 3300013296 Bacteria 3013
104 Ga0157374_10270991 3300013296 Bacteria 1674
105 Ga0157374_10297063 3300013296 Bacteria 1597
106 Ga0163162_10192184 3300013306 Bacteria 2169
107 Ga0163163_10898753 3300014325 Bacteria 949
108 Ga0163163_11418322 3300014325 Bacteria 756
109 Ga0157380_10883813 3300014326 Bacteria 918
110 Ga0157379_10079812 3300014968 Bacteria 2931
111 Ga0157376_10139792 3300014969 Bacteria 2171
112 Ga0157376_10379435 3300014969 Bacteria 1361
113 Ga0207653_10028102 3300025885 Bacteria 1808
114 Ga0207653_10107397 3300025885 Bacteria 993
115 Ga0207692_10267262 3300025898 Bacteria 1030
116 Ga0207692_10588142 3300025898 Bacteria 714
117 Ga0207710_10154577 3300025900 Bacteria 1114
118 Ga0207699_10072294 3300025906 Bacteria 2112
119 Ga0207684_10044114 3300025910 Bacteria 3781
120 Ga0207684_10054545 3300025910 Bacteria 3391
121 Ga0207684_10067734 3300025910 Bacteria 3034
122 Ga0207707_10176803 3300025912 Bacteria 1865
123 Ga0207707_10192726 3300025912 Bacteria 1778
124 Ga0207695_10004835 3300025913 Bacteria 18184
125 Ga0207671_10005305 3300025914 Bacteria 11944
126 Ga0207693_10335284 3300025915 Bacteria 1184
127 Ga0207663_10142583 3300025916 Bacteria 1671
128 Ga0207663_10378782 3300025916 Bacteria 1078
129 Ga0207660_10000920 3300025917 Bacteria 19420
130 Ga0207652_10000542 3300025921 Bacteria 38273
131 Ga0207652_10464878 3300025921 Bacteria 1140
132 Ga0207646_10105164 3300025922 Bacteria 2531
133 Ga0207694_10068886 3300025924 Bacteria 2764
134 Ga0207650_10943482 3300025925 Bacteria 733
135 Ga0207659_10450128 3300025926 Bacteria 1084
136 Ga0207644_10504066 3300025931 Bacteria 999
137 Ga0207686_10096196 3300025934 Bacteria 1967
138 Ga0207704_10508080 3300025938 Bacteria 972
139 Ga0207661_10001006 3300025944 Bacteria 18630
140 Ga0207661_10103981 3300025944 Bacteria 2391
141 Ga0207661_10189320 3300025944 Bacteria 1803
142 Ga0207661_10368744 3300025944 Bacteria 1298
143 Ga0207661_10779969 3300025944 Bacteria 880
144 Ga0207667_10009955 3300025949 Bacteria 11152
145 Ga0207667_10135232 3300025949 Bacteria 2539
146 Ga0207667_10464254 3300025949 Bacteria 1286
147 Ga0207712_10405886 3300025961 Bacteria 1146
148 Ga0207677_11307954 3300026023 Bacteria 666
149 Ga0207639_10003623 3300026041 Bacteria 10375
150 Ga0207639_10545139 3300026041 Bacteria 1064
151 Ga0207708_10000024 3300026075 Bacteria 172863
152 Ga0207702_10038632 3300026078 Bacteria 3997
153 Ga0207641_10520619 3300026088 Bacteria 1157
154 Ga0207676_10791251 3300026095 Bacteria 925
155 Ga0207675_100360745 3300026118 Bacteria 1426
156 Ga0207683_10311041 3300026121 Bacteria 1442
157 Ga0207698_10162243 3300026142 Bacteria 1956
158 Ga0268266_10746751 3300028379 Bacteria 944
159 Ga0268265_10538180 3300028380 Bacteria 1107
160 Ga0268264_10734595 3300028381 Bacteria 982
161 Ga0268264_10815681 3300028381 Bacteria 933
162 Ga0268264_11669103 3300028381 Bacteria 648
163 Ga0265319_1040022 3300028563 Bacteria 1586
164 Ga0265318_10057590 3300028577 Bacteria 1452
165 Ga0265318_10243518 3300028577 Bacteria 656
166 Ga0307515_10068185 3300028794 Bacteria 4892
167 Ga0265338_10008636 3300028800 Bacteria 12322
168 Ga0265338_10016775 3300028800 Bacteria 7935
169 Ga0265332_10092780 3300031238 Bacteria 1276
170 Ga0265332_10172834 3300031238 Bacteria 901
171 Ga0265328_10000663 3300031239 Bacteria 16009
172 Ga0265320_10001588 3300031240 Bacteria 16333
173 Ga0265320_10025142 3300031240 Bacteria 3136
174 Ga0265325_10305011 3300031241 Bacteria 710
175 Ga0265340_10003809 3300031247 Bacteria 8500
176 Ga0265339_10014852 3300031249 Bacteria 4683
177 Ga0265339_10032483 3300031249 Bacteria 2943
178 Ga0307513_10619201 3300031456 Bacteria 791
179 Ga0307408_100080816 3300031548 Bacteria 2429
180 Ga0307408_100411252 3300031548 Bacteria 1164
181 Ga0307408_100762588 3300031548 Bacteria 875
182 Ga0265313_10057996 3300031595 Bacteria 1826
183 Ga0265313_10187021 3300031595 Bacteria 868
184 Ga0307508_10011486 3300031616 Bacteria 8088
185 Ga0307514_10310848 3300031649 Bacteria 874
186 Ga0265314_10007680 3300031711 Bacteria 9324
187 Ga0265314_10091940 3300031711 Bacteria 1973
188 Ga0265342_10000923 3300031712 Bacteria 29178
189 Ga0265342_10017558 3300031712 Bacteria 4650
190 Ga0265342_10112053 3300031712 Bacteria 1543
191 Ga0307516_10002711 3300031730 Bacteria 23336
192 Ga0307410_11024568 3300031852 Bacteria 713
193 Ga0307412_10180094 3300031911 Bacteria 1589
194 Ga0307412_10670034 3300031911 Bacteria 887
195 Ga0307416_100048833 3300032002 Bacteria 3361
196 Ga0307411_10981329 3300032005 Bacteria 755
197 Ga0373939_0208407 3300035114 Bacteria 743
198 Ga0373953_0092267 3300035117 Bacteria 1268
199 Ga0373953_0124774 3300035117 Bacteria 1095
200 Ga0373954_0195291 3300035118 Bacteria 994
201 Ga0373956_0169211 3300035119 Bacteria 1031
202 Ga0373957_0062320 3300035120 Bacteria 1447
203 Ga0373943_0032452 3300035170 Bacteria 2483
204 Ga0373943_0140190 3300035170 Bacteria 1302
205 Ga0373946_0190018 3300035171 Bacteria 979
206 Ga0373955_0088208 3300035172 Bacteria 1764
207 Ga0373955_0116085 3300035172 Bacteria 1552
208 Ga0373924_0040355 3300035410 Bacteria 1910
209 Ga0373933_0002984 3300035724 Bacteria 9436
210 Ga0373937_0002274 3300036401 Bacteria 16038
211 Ga0373937_0162203 3300036401 Bacteria 2096
212 Ga0373937_0302576 3300036401 Bacteria 1512
213 Ga0373925_0022860 3300037068 Bacteria 4563
214 Ga0373925_0090572 3300037068 Bacteria 2338
215 Ga0436365_0414878 3300039437 Bacteria 10783
216 Ga0439438_136304 3300041405 Bacteria 588
217 Ga0439439_0089009 3300041406 Bacteria 841
218 Ga0439453_0104051 3300041408 Bacteria 636
219 Ga0451787_121887 3300041441 Bacteria 894
220 Ga0451789_0712500 3300041443 Bacteria 560
221 Ga0451791_1012978 3300041451 Bacteria 1082
222 Ga0451791_1156861 3300041451 Bacteria 626
223 Ga0451797_0610307 3300041453 Bacteria 1749
224 Ga0451804_0824254 3300041463 Bacteria 1212
225 Ga0451807_0472034 3300041486 Bacteria 12054
226 Ga0451807_0545152 3300041486 Bacteria 652
227 Ga0451807_2460438 3300041486 Bacteria 830
228 Ga0451835_1035813 3300041492 Bacteria 572
229 Ga0451845_0002838 3300041501 Bacteria 653
230 Ga0451843_1686106 3300041509 Bacteria 1611
231 Ga0451855_1152976 3300041511 Bacteria 548
232 Ga0451853_0392830 3300041512 Bacteria 698
233 Ga0451853_0914067 3300041512 Bacteria 980
234 Ga0439445_0026900 3300042004 Bacteria 1475
235 Ga0439445_0081621 3300042004 Bacteria 904
236 Ga0439452_005816 3300042010 Bacteria 3932
237 Ga0453684_0063588 3300044712 Bacteria 4719
238 Ga0466957_0846226 3300044842 Bacteria 652
239 Ga0466960_0229472 3300044901 Bacteria 1024
240 Ga0451576_1183715 3300045051 Bacteria 798
241 Ga0495617_094731 3300046452 Bacteria 973
242 Ga0495584_0093878 3300046491 Bacteria 1514
243 Ga0495584_0099054 3300046491 Bacteria 1473
244 Ga0495630_0538949 3300046517 Bacteria 895
245 Ga0495668_0585943 3300046616 Bacteria 616
246 Ga0495624_0387151 3300046690 Bacteria 840
247 Ga0495680_0466604 3300047322 Bacteria 862
248 Ga0496101_0931656 3300048904 Bacteria 684
249 Ga0496102_0501546 3300048905 Bacteria 1136
250 Ga0496104_0065697 3300048907 Bacteria 3443
251 Ga0496107_0472358 3300048910 Bacteria 931
252 Ga0496109_0391632 3300048912 Bacteria 1313
253 Ga0496111_0335663 3300048914 Bacteria 1119
254 Ga0496112_0073969 3300048915 Bacteria 3369
255 Ga0496112_0733787 3300048915 Bacteria 915
256 Ga0496114_0125056 3300048917 Bacteria 2216
257 Ga0496114_0221198 3300048917 Bacteria 1662
258 Ga0496114_0278400 3300048917 Bacteria 1475
259 Ga0496114_1094551 3300048917 Bacteria 682
260 Ga0496115_0090997 3300048918 Bacteria 2493
261 Ga0501292_088581 3300049515 Bacteria 598
262 Ga0501034_0163830 3300049571 Bacteria 2193
263 Ga0501034_0509742 3300049571 Bacteria 1116
264 Ga0501040_0252617 3300049576 Bacteria 1258
265 Ga0501067_0000041 3300049583 Bacteria 77291
266 Ga0501069_0076174 3300049585 Bacteria 1886
267 Ga0501069_0177978 3300049585 Bacteria 1229
268 Ga0501070_0000004 3300049586 Bacteria 254956
269 Ga0501070_0236089 3300049586 Bacteria 1497
270 Ga0501071_0298703 3300049587 Bacteria 1221
271 Ga0501072_0326157 3300049588 Bacteria 1220
272 Ga0501073_0000704 3300049589 Bacteria 23592
273 Ga0501073_0114192 3300049589 Bacteria 1872
274 Ga0501073_0827738 3300049589 Bacteria 638
275 Ga0501074_0161758 3300049590 Bacteria 1599
276 Ga0501074_0241231 3300049590 Bacteria 1285
277 Ga0501074_0245072 3300049590 Bacteria 1274
278 Ga0501074_0614850 3300049590 Bacteria 768
279 Ga0501077_0055952 3300049593 Bacteria 2504
280 Ga0501206_019283 3300049653 Bacteria 964
281 Ga0501228_022569 3300049666 Bacteria 722
282 Ga0501257_006312 3300049686 Bacteria 2628
283 Ga0501258_055428 3300049687 Bacteria 562
284 Ga0501079_0031377 3300049741 Bacteria 4084
285 Ga0501080_0007475 3300049742 Bacteria 9862
286 Ga0501080_0067274 3300049742 Bacteria 3332
287 Ga0501080_0126399 3300049742 Bacteria 2368
288 Ga0501081_0002907 3300049743 Bacteria 10869
289 Ga0501081_0023917 3300049743 Bacteria 4099
290 Ga0501083_0002517 3300049744 Bacteria 12579
291 Ga0501083_0028880 3300049744 Bacteria 3821
292 Ga0501262_001589 3300049759 Bacteria 2544
293 Ga0501276_022255 3300049773 Bacteria 615
294 Ga0501281_01862 3300049777 Bacteria 1588
295 Ga0501035_0298061 3300049822 Bacteria 1359
296 Ga0501045_0404315 3300049824 Bacteria 1016
297 nmdc:mga0k408_285874_c1 3300050493 Bacteria 984
298 nmdc:mga0k408_7795_c1 3300050493 Bacteria 5725
299 nmdc:mga04h51_335921_c1 3300050495 Bacteria 622
300 nmdc:mga05p37_420740_c1 3300050507 Bacteria 1555
301 nmdc:mga05p37_857753_c1 3300050507 Bacteria 985
302 nmdc:mga08y16_852_c1 3300050511 Bacteria 29252
303 nmdc:mga0n895_37557_c1 3300050512 Bacteria 4687
304 nmdc:mga0n895_706980_c1 3300050512 Bacteria 1003
305 nmdc:mga0a205_106373_c1 3300050515 Bacteria 2703
306 nmdc:mga0a205_114908_c1 3300050515 Bacteria 2590
307 Ga0500568_0328664 3300053139 Bacteria 554
308 Ga0500622_0002183 3300053156 Bacteria 14470
309 Ga0501084_0073211 3300054114 Bacteria 2869
310 Ga0501084_0230829 3300054114 Bacteria 1562
311 Ga0501082_0031121 3300060353 Bacteria 4599
312 Ga0501082_0085713 3300060353 Bacteria 2717
313 2831869241 2831864461 Bacteria 6502356
314 2921647523 2921643360 Bacteria 11448031
315 Ga0070680_100002987
316 rootH1_10134775
317 Ga0070676_10295816
318 Ga0070676_10610520
319 Ga0070683_100142014
320 Ga0068869_100461723
321 Ga0070682_100301623
322 Ga0070682_100844652
323 Ga0070682_101517086
324 Ga0068868_100535714
325 Ga0068868_101461190
326 Ga0070691_10773214
327 Ga0070671_100736475
328 Ga0070688_100032005
329 Ga0070703_10018193
330 Ga0070709_10429438
331 Ga0070713_100766555
332 Ga0070710_10209862
333 Ga0070710_10427039
334 Ga0070701_10884103
335 Ga0070711_100060096
336 Ga0070705_100007324
337 Ga0070705_100042795
338 Ga0070700_100000001
339 Ga0070694_100124455
340 Ga0070708_100260043
341 Ga0070708_100764424
342 Ga0070708_100773494
343 Ga0070708_101753261
344 Ga0070678_100624652
345 Ga0070681_10085922
346 Ga0070681_10387272
347 Ga0070706_100003492
348 Ga0070706_100018775
349 Ga0070706_100058595
350 Ga0070706_100069591
351 Ga0070707_100079460
352 Ga0070707_100214236
353 Ga0070698_100002361
354 Ga0070698_100055140
355 Ga0070699_100299761
356 Ga0070699_100562094
357 Ga0070679_100000583
358 Ga0070679_100634756
359 Ga0070684_100013189
360 Ga0070684_100106407
361 Ga0070684_100323933
362 Ga0070684_101525911
363 Ga0070697_101006188
364 Ga0068853_100002426
365 Ga0070695_100006489
366 Ga0070695_100050401
367 Ga0070696_100136079
368 Ga0070704_100030431
369 Ga0070704_100211602
370 Ga0068855_100102737
371 Ga0068855_100137961
372 Ga0070664_100678720
373 Ga0068857_101173484
374 Ga0068856_100160031
375 Ga0068859_100470900
376 Ga0068860_101113587
377 Ga0068860_101481815
378 Ga0081540_1010566
379 Ga0070717_10082078
380 Ga0075363_100191111
381 Ga0075364_10384139
382 Ga0070712_100304342
383 Ga0070712_100518619
384 Ga0075366_10665725
385 Ga0075366_10752408
386 Ga0075366_10974097
387 Ga0075370_10162672
388 Ga0068871_100143186
389 Ga0075428_100582885
390 Ga0075431_100454144
391 Ga0075433_10060685
392 Ga0075434_100442432
393 Ga0075434_101123357
394 Ga0075429_100426813
395 Ga0075429_100554841
396 Ga0075429_101421486
397 Ga0068865_100480934
398 Ga0097620_100470915
399 Ga0099826_10000007
400 Ga0105240_10021076
401 Ga0111539_10004541
402 Ga0111539_10462104
403 Ga0111539_11207382
404 Ga0105247_10162940
405 Ga0114129_10198139
406 Ga0114129_10267745
407 Ga0114129_10453665
408 Ga0114129_11149465
409 Ga0105241_10426363
410 Ga0105242_11473197
411 Ga0105237_10007486
412 Ga0105237_10155273
413 Ga0105238_10025179
414 Ga0105249_10488251
415 Ga0105239_10067872
416 Ga0157370_10254213
417 Ga0157374_10084709
418 Ga0157374_10270991
419 Ga0157374_10297063
420 Ga0163162_10192184
421 Ga0163163_10898753
422 Ga0163163_11418322
423 Ga0157380_10883813
424 Ga0157379_10079812
425 Ga0157376_10139792
426 Ga0157376_10379435
427 Ga0207653_10028102
428 Ga0207653_10107397
429 Ga0207692_10267262
430 Ga0207692_10588142
431 Ga0207710_10154577
432 Ga0207699_10072294
433 Ga0207684_10044114
434 Ga0207684_10054545
435 Ga0207684_10067734
436 Ga0207707_10176803
437 Ga0207707_10192726
438 Ga0207695_10004835
439 Ga0207671_10005305
440 Ga0207693_10335284
441 Ga0207663_10142583
442 Ga0207663_10378782
443 Ga0207660_10000920
444 Ga0207652_10000542
445 Ga0207652_10464878
446 Ga0207646_10105164
447 Ga0207694_10068886
448 Ga0207650_10943482
449 Ga0207659_10450128
450 Ga0207644_10504066
451 Ga0207686_10096196
452 Ga0207704_10508080
453 Ga0207661_10001006
454 Ga0207661_10103981
455 Ga0207661_10189320
456 Ga0207661_10368744
457 Ga0207661_10779969
458 Ga0207667_10009955
459 Ga0207667_10135232
460 Ga0207667_10464254
461 Ga0207712_10405886
462 Ga0207677_11307954
463 Ga0207639_10003623
464 Ga0207639_10545139
465 Ga0207708_10000024
466 Ga0207702_10038632
467 Ga0207641_10520619
468 Ga0207676_10791251
469 Ga0207675_100360745
470 Ga0207683_10311041
471 Ga0207698_10162243
472 Ga0268266_10746751
473 Ga0268265_10538180
474 Ga0268264_10734595
475 Ga0268264_10815681
476 Ga0268264_11669103
477 Ga0265319_1040022
478 Ga0265318_10057590
479 Ga0265318_10243518
480 Ga0307515_10068185
481 Ga0265338_10008636
482 Ga0265338_10016775
483 Ga0265332_10092780
484 Ga0265332_10172834
485 Ga0265328_10000663
486 Ga0265320_10001588
487 Ga0265320_10025142
488 Ga0265325_10305011
489 Ga0265340_10003809
490 Ga0265339_10014852
491 Ga0265339_10032483
492 Ga0307513_10619201
493 Ga0307408_100080816
494 Ga0307408_100411252
495 Ga0307408_100762588
496 Ga0265313_10057996
497 Ga0265313_10187021
498 Ga0307508_10011486
499 Ga0307514_10310848
500 Ga0265314_10007680
501 Ga0265314_10091940
502 Ga0265342_10000923
503 Ga0265342_10017558
504 Ga0265342_10112053
505 Ga0307516_10002711
506 Ga0307410_11024568
507 Ga0307412_10180094
508 Ga0307412_10670034
509 Ga0307416_100048833
510 Ga0307411_10981329
511 Ga0373939_0208407
512 Ga0373953_0092267
513 Ga0373953_0124774
514 Ga0373954_0195291
515 Ga0373956_0169211
516 Ga0373957_0062320
517 Ga0373943_0032452
518 Ga0373943_0140190
519 Ga0373946_0190018
520 Ga0373955_0088208
521 Ga0373955_0116085
522 Ga0373924_0040355
523 Ga0373933_0002984
524 Ga0373937_0002274
525 Ga0373937_0162203
526 Ga0373937_0302576
527 Ga0373925_0022860
528 Ga0373925_0090572
529 Ga0436365_0414878
530 Ga0439438_136304
531 Ga0439439_0089009
532 Ga0439453_0104051
533 Ga0451787_121887
534 Ga0451789_0712500
535 Ga0451791_1012978
536 Ga0451791_1156861
537 Ga0451797_0610307
538 Ga0451804_0824254
539 Ga0451807_0472034
540 Ga0451807_0545152
541 Ga0451807_2460438
542 Ga0451835_1035813
543 Ga0451845_0002838
544 Ga0451843_1686106
545 Ga0451855_1152976
546 Ga0451853_0392830
547 Ga0451853_0914067
548 Ga0439445_0026900
549 Ga0439445_0081621
550 Ga0439452_005816
551 Ga0453684_0063588
552 Ga0466957_0846226
553 Ga0466960_0229472
554 Ga0451576_1183715
555 Ga0495617_094731
556 Ga0495584_0093878
557 Ga0495584_0099054
558 Ga0495630_0538949
559 Ga0495668_0585943
560 Ga0495624_0387151
561 Ga0495680_0466604
562 Ga0496101_0931656
563 Ga0496102_0501546
564 Ga0496104_0065697
565 Ga0496107_0472358
566 Ga0496109_0391632
567 Ga0496111_0335663
568 Ga0496112_0073969
569 Ga0496112_0733787
570 Ga0496114_0125056
571 Ga0496114_0221198
572 Ga0496114_0278400
573 Ga0496114_1094551
574 Ga0496115_0090997
575 Ga0501292_088581
576 Ga0501034_0163830
577 Ga0501034_0509742
578 Ga0501040_0252617
579 Ga0501067_0000041
580 Ga0501069_0076174
581 Ga0501069_0177978
582 Ga0501070_0000004
583 Ga0501070_0236089
584 Ga0501071_0298703
585 Ga0501072_0326157
586 Ga0501073_0000704
587 Ga0501073_0114192
588 Ga0501073_0827738
589 Ga0501074_0161758
590 Ga0501074_0241231
591 Ga0501074_0245072
592 Ga0501074_0614850
593 Ga0501077_0055952
594 Ga0501206_019283
595 Ga0501228_022569
596 Ga0501257_006312
597 Ga0501258_055428
598 Ga0501079_0031377
599 Ga0501080_0007475
600 Ga0501080_0067274
601 Ga0501080_0126399
602 Ga0501081_0002907
603 Ga0501081_0023917
604 Ga0501083_0002517
605 Ga0501083_0028880
606 Ga0501262_001589
607 Ga0501276_022255
608 Ga0501281_01862
609 Ga0501035_0298061
610 Ga0501045_0404315
611 nmdc:mga0k408_285874_c1
612 nmdc:mga0k408_7795_c1
613 nmdc:mga04h51_335921_c1
614 nmdc:mga05p37_420740_c1
615 nmdc:mga05p37_857753_c1
616 nmdc:mga08y16_852_c1
617 nmdc:mga0n895_37557_c1
618 nmdc:mga0n895_706980_c1
619 nmdc:mga0a205_106373_c1
620 nmdc:mga0a205_114908_c1
621 Ga0500568_0328664
622 Ga0500622_0002183
623 Ga0501084_0073211
624 Ga0501084_0230829
625 Ga0501082_0031121
626 Ga0501082_0085713
627 2831869241
628 2921647523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

46

182

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4toc-assembly1.cif.gz_A 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.996 4 156
4toc-assembly1.cif.gz_S 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9959 1 156
4toc-assembly1.cif.gz_C 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9958 2 156
4toc-assembly1.cif.gz_I 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9956 1 156
4toc-assembly1.cif.gz_J 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9956 1 156
ID Description Score Start End Superfamily
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.995 1 156 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9944 1 153 1.20.1260.10
5d8rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9942 1 156 1.20.1260.10
3iseA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9931 3 156 1.20.1260.10
3iseD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9931 3 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2V9SKB7-F1-model_v4 Bacterioferritin 1.003 1 108 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A3C2DH40-F1-model_v4 Bacterioferritin 1.002 1 133 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A3M1EPG4-F1-model_v4 Bacterioferritin 1.002 1 97 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2V9JWY8-F1-model_v4 Bacterioferritin 1.001 1 156 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A7Y2JDK9-F1-model_v4 Bacterioferritin 1.001 1 122 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Map