F402392

General Info

Members Datasets Scaffolds Average Seq Length
313 191 626 232

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0007588|Ga0501033_0007588_6309_7097
Length 262
Sequence VKPIGLRYDEPLETDRFPACLEMPMTSIKNTVALVTGGSRGLGKALVEELYTRGAAKVYATARDPRTVTHPDAEPLALEVTDPASVAAAAAHAQDVTLVINNAGVSVGAHAFLEAPLADVRREFEVNFFGPLLVTRAFAPVLERNGGGHLLNVHSVLSWIGVAGSYSATKAALWSQTNTLRLELRPRGIGVTGLHVGYIDTDMVSHIDAPKSAARDVAALALDGVEAGAHEVLADDLTRDVKARLSGDLADLYPQLADHGAR

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
47 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
48 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
62 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
152 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
153 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
154 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
155 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
163 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
164 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
165 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
166 2643221647 Streptomyces sp. Root369 Isolate Unclassified
167 2643221714 Streptomyces sp. Root264 Isolate Unclassified
168 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
169 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
170 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
171 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
174 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
175 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
176 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
177 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
178 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
179 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
180 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
181 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
182 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
183 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
184 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
185 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
186 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
187 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
188 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
189 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
190 8002784119 Frankia sp. AgB1.9 Isolate Nodule
191 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.18
Metatranscriptomes 0
Isolates 11.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.99
Nodule 0.64
Rhizoplane 0.64
Rhizosphere 76.68
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0007588 3300049570 Bacteria 8436
2 JGI25406J46586_10014965 3300003203 Bacteria 3283
3 rootL2_10063894 3300003322 Bacteria 1976
4 rootH1_10257059 3300003323 Bacteria 1018
5 Ga0055531_10000001 3300003794 Bacteria 543586
6 Ga0070713_100096360 3300005436 Bacteria 2554
7 Ga0070708_100242657 3300005445 Bacteria 1692
8 Ga0068857_100407946 3300005577 Bacteria 1265
9 Ga0081455_10009828 3300005937 Bacteria 9797
10 Ga0081455_10066501 3300005937 Bacteria 3010
11 Ga0081540_1000295 3300005983 Bacteria 51899
12 Ga0081539_10000299 3300005985 Bacteria 111908
13 Ga0070717_10330683 3300006028 Bacteria 1359
14 Ga0075365_10045327 3300006038 Bacteria 2885
15 Ga0075363_100112837 3300006048 Bacteria 1512
16 Ga0075367_10003279 3300006178 Bacteria 7666
17 Ga0099826_10075714 3300006948 Bacteria 2117
18 Ga0105251_10014564 3300009011 Bacteria 4338
19 Ga0105245_10359478 3300009098 Bacteria 1445
20 Ga0105246_10028839 3300011119 Bacteria 3649
21 Ga0182008_10012617 3300014497 Bacteria 4458
22 Ga0183367_1004 3300015688 Bacteria 716880
23 Ga0209050_1007733 3300025298 Bacteria 5932
24 Ga0209051_1007873 3300025303 Bacteria 5748
25 Ga0209257_1000033 3300025304 Bacteria 671006
26 Ga0207647_10093479 3300025904 Bacteria 1792
27 Ga0207647_10115846 3300025904 Bacteria 1582
28 Ga0207664_10414045 3300025929 Bacteria 1200
29 Ga0207674_10386609 3300026116 Bacteria 1353
30 Ga0207674_10834019 3300026116 Bacteria 889
31 Ga0209813_10005527 3300027866 Bacteria 3072
32 Ga0268266_10343027 3300028379 Bacteria 1402
33 Ga0307517_10005215 3300028786 Bacteria 19679
34 Ga0307515_10001006 3300028794 Bacteria 64436
35 Ga0307515_10002574 3300028794 Bacteria 39147
36 Ga0307515_10031374 3300028794 Bacteria 8865
37 Ga0307511_10000010 3300030521 Bacteria 146716
38 Ga0307511_10069682 3300030521 Bacteria 2582
39 Ga0307511_10078879 3300030521 Bacteria 2332
40 Ga0307513_10007065 3300031456 Bacteria 14595
41 Ga0307513_10008664 3300031456 Bacteria 12964
42 Ga0307513_10027506 3300031456 Bacteria 6530
43 Ga0307513_10046050 3300031456 Bacteria 4761
44 Ga0307513_10116284 3300031456 Bacteria 2654
45 Ga0307513_10278138 3300031456 Bacteria 1453
46 Ga0307509_10020897 3300031507 Bacteria 7421
47 Ga0307509_10023384 3300031507 Bacteria 6943
48 Ga0307509_10037539 3300031507 Bacteria 5295
49 Ga0307509_10058423 3300031507 Bacteria 4085
50 Ga0307508_10011682 3300031616 Bacteria 8027
51 Ga0307508_10024975 3300031616 Bacteria 5420
52 Ga0307508_10101303 3300031616 Bacteria 2476
53 Ga0307514_10022493 3300031649 Bacteria 5122
54 Ga0307514_10085012 3300031649 Bacteria 2327
55 Ga0307516_10056050 3300031730 Bacteria 3844
56 Ga0307413_10455132 3300031824 Bacteria 1017
57 Ga0307518_10043834 3300031838 Bacteria 3257
58 Ga0307518_10072505 3300031838 Bacteria 2493
59 Ga0307507_10014471 3300033179 Bacteria 9400
60 Ga0307507_10015453 3300033179 Bacteria 8979
61 Ga0307510_10001558 3300033180 Bacteria 25339
62 Ga0307510_10115988 3300033180 Bacteria 2401
63 Ga0395900_0040414 3300037418 Bacteria 4807
64 Ga0395898_0006152 3300037466 Bacteria 12853
65 Ga0395898_0141476 3300037466 Bacteria 2303
66 Ga0395898_0603037 3300037466 Bacteria 1041
67 Ga0436364_0597839 3300037853 Bacteria 2374
68 Ga0395901_0369711 3300038443 Bacteria 1477
69 Ga0451837_0645840 3300041494 Bacteria 3123
70 Ga0439455_0032092 3300042012 Bacteria 1311
71 Ga0450903_003394 3300042138 Bacteria 2760
72 Ga0439458_0000510 3300042157 Bacteria 9966
73 Ga0466972_0029699 3300044658 Bacteria 2692
74 Ga0466963_0324146 3300044694 Bacteria 1084
75 Ga0466964_0139014 3300044706 Bacteria 1114
76 Ga0466970_0072841 3300044765 Bacteria 1848
77 Ga0466970_0345983 3300044765 Bacteria 843
78 Ga0466967_0078718 3300045976 Bacteria 2970
79 Ga0466967_0129810 3300045976 Bacteria 2338
80 Ga0495617_023628 3300046452 Bacteria 2076
81 Ga0495592_0024740 3300046454 Bacteria 4564
82 Ga0495592_0030334 3300046454 Bacteria 4090
83 Ga0495592_0063798 3300046454 Bacteria 2701
84 Ga0495592_0109279 3300046454 Bacteria 1959
85 Ga0495603_0000595 3300046455 Bacteria 20318
86 Ga0495603_0025102 3300046455 Bacteria 3604
87 Ga0495603_0293712 3300046455 Bacteria 933
88 Ga0495629_0001822 3300046459 Bacteria 16694
89 Ga0495629_0002250 3300046459 Bacteria 14878
90 Ga0495629_0003752 3300046459 Bacteria 11443
91 Ga0495629_0046220 3300046459 Bacteria 3053
92 Ga0495629_0054211 3300046459 Bacteria 2804
93 Ga0495629_0135107 3300046459 Bacteria 1717
94 Ga0495638_0072256 3300046460 Bacteria 2109
95 Ga0495638_0121497 3300046460 Bacteria 1543
96 Ga0495651_0021462 3300046462 Bacteria 5019
97 Ga0495651_0357406 3300046462 Bacteria 963
98 Ga0495653_0002310 3300046463 Bacteria 15102
99 Ga0495653_0176271 3300046463 Bacteria 1471
100 Ga0495580_0012268 3300046472 Bacteria 6580
101 Ga0495582_0045609 3300046473 Bacteria 2414
102 Ga0495582_0434058 3300046473 Bacteria 758
103 Ga0495605_0004996 3300046474 Bacteria 7747
104 Ga0495639_0002867 3300046475 Bacteria 7501
105 Ga0495662_0008598 3300046476 Bacteria 5016
106 Ga0495662_0020993 3300046476 Bacteria 3158
107 Ga0495662_0036362 3300046476 Bacteria 2376
108 Ga0495662_0038630 3300046476 Bacteria 2307
109 Ga0495662_0052432 3300046476 Bacteria 1969
110 Ga0495664_0001064 3300046477 Bacteria 14191
111 Ga0495664_0028064 3300046477 Bacteria 3285
112 Ga0495664_0165708 3300046477 Bacteria 1341
113 Ga0495585_0049560 3300046492 Bacteria 2331
114 Ga0495585_0134702 3300046492 Bacteria 1297
115 Ga0495594_0225429 3300046499 Bacteria 1069
116 Ga0495596_0171868 3300046500 Bacteria 842
117 Ga0495607_0026555 3300046501 Bacteria 3592
118 Ga0495607_0120205 3300046501 Bacteria 1380
119 Ga0495583_0015494 3300046506 Bacteria 4143
120 Ga0495606_0003194 3300046507 Bacteria 17671
121 Ga0495606_0019410 3300046507 Bacteria 5059
122 Ga0495608_0011758 3300046511 Bacteria 6087
123 Ga0495616_0003925 3300046513 Bacteria 9469
124 Ga0495618_0008899 3300046514 Bacteria 6058
125 Ga0495618_0133954 3300046514 Bacteria 1585
126 Ga0495620_0002556 3300046515 Bacteria 10518
127 Ga0495620_0031749 3300046515 Bacteria 2415
128 Ga0495620_0059077 3300046515 Bacteria 1604
129 Ga0495628_0009301 3300046516 Bacteria 8396
130 Ga0495628_0044691 3300046516 Bacteria 3522
131 Ga0495628_0168519 3300046516 Bacteria 1661
132 Ga0495630_0076938 3300046517 Bacteria 2515
133 Ga0495630_0228059 3300046517 Bacteria 1423
134 Ga0495631_0019169 3300046518 Bacteria 3210
135 Ga0495631_0030041 3300046518 Bacteria 2467
136 Ga0495632_0118044 3300046519 Bacteria 1241
137 Ga0495632_0249732 3300046519 Bacteria 796
138 Ga0495643_0007489 3300046522 Bacteria 7027
139 Ga0495643_0043180 3300046522 Bacteria 2454
140 Ga0495648_0055865 3300046524 Bacteria 2378
141 Ga0495666_0028120 3300046526 Bacteria 2767
142 Ga0495666_0035637 3300046526 Bacteria 2425
143 Ga0495666_0159223 3300046526 Bacteria 1047
144 Ga0495652_0002722 3300046529 Bacteria 17935
145 Ga0495652_0011416 3300046529 Bacteria 8036
146 Ga0495652_0026384 3300046529 Bacteria 5134
147 Ga0495652_0057495 3300046529 Bacteria 3297
148 Ga0495665_0002393 3300046531 Bacteria 10136
149 Ga0495640_0032703 3300046533 Bacteria 3701
150 Ga0495640_0050477 3300046533 Bacteria 2865
151 Ga0495640_0097689 3300046533 Bacteria 1931
152 Ga0495586_0021448 3300046535 Bacteria 3444
153 Ga0495587_0002095 3300046536 Bacteria 13320
154 Ga0495587_0023762 3300046536 Bacteria 3764
155 Ga0495587_0063000 3300046536 Bacteria 2170
156 Ga0495609_0006018 3300046538 Bacteria 6257
157 Ga0495597_0011519 3300046542 Bacteria 4286
158 Ga0495645_0047073 3300046543 Bacteria 3142
159 Ga0495645_0054529 3300046543 Bacteria 2904
160 Ga0495622_0011718 3300046557 Bacteria 4053
161 Ga0495633_0035587 3300046558 Bacteria 2390
162 Ga0495667_0030777 3300046559 Bacteria 3606
163 Ga0495667_0048059 3300046559 Bacteria 2817
164 Ga0495668_0062402 3300046616 Bacteria 2053
165 Ga0495668_0114553 3300046616 Bacteria 1474
166 Ga0495634_0002581 3300046642 Bacteria 14936
167 Ga0495634_0003612 3300046642 Bacteria 12353
168 Ga0495634_0024037 3300046642 Bacteria 4279
169 Ga0495634_0121540 3300046642 Bacteria 1672
170 Ga0495634_0360166 3300046642 Bacteria 870
171 Ga0495611_0015796 3300046648 Bacteria 3226
172 Ga0495625_0021142 3300046660 Bacteria 5013
173 Ga0495625_0435473 3300046660 Bacteria 813
174 Ga0495635_0003949 3300046663 Bacteria 10313
175 Ga0495635_0014814 3300046663 Bacteria 5454
176 Ga0495635_0253275 3300046663 Bacteria 1186
177 Ga0495661_0057751 3300046665 Bacteria 2315
178 Ga0495588_0005988 3300046674 Bacteria 5455
179 Ga0495657_0001939 3300046675 Bacteria 17648
180 Ga0495657_0004703 3300046675 Bacteria 10875
181 Ga0495657_0016631 3300046675 Bacteria 5356
182 Ga0495657_0041998 3300046675 Bacteria 3125
183 Ga0495599_0026323 3300046678 Bacteria 3644
184 Ga0495623_0059294 3300046679 Bacteria 2404
185 Ga0495623_0100798 3300046679 Bacteria 1759
186 Ga0495646_0000204 3300046680 Bacteria 29112
187 Ga0495646_0078810 3300046680 Bacteria 1924
188 Ga0495658_0011134 3300046683 Bacteria 4515
189 Ga0495613_0000570 3300046689 Bacteria 30354
190 Ga0495613_0002302 3300046689 Bacteria 14464
191 Ga0495613_0024055 3300046689 Bacteria 4539
192 Ga0495613_0044990 3300046689 Bacteria 3265
193 Ga0495671_0026474 3300046692 Bacteria 3006
194 Ga0495671_0187255 3300046692 Bacteria 1005
195 Ga0495649_0018272 3300046694 Bacteria 3948
196 Ga0495649_0043611 3300046694 Bacteria 2448
197 Ga0495600_0030911 3300046809 Bacteria 3467
198 Ga0495600_0030973 3300046809 Bacteria 3464
199 Ga0495600_0328289 3300046809 Bacteria 961
200 Ga0495581_0002286 3300047315 Bacteria 10778
201 Ga0495581_0023462 3300047315 Bacteria 3575
202 Ga0495581_0053274 3300047315 Bacteria 2337
203 Ga0495581_0171465 3300047315 Bacteria 1269
204 Ga0495604_0001112 3300047317 Bacteria 22290
205 Ga0495604_0001812 3300047317 Bacteria 17405
206 Ga0495636_0000453 3300047318 Bacteria 15195
207 Ga0495636_0046035 3300047318 Bacteria 1819
208 Ga0495674_0308708 3300047319 Bacteria 1291
209 Ga0495672_0261612 3300047320 Bacteria 835
210 Ga0495676_0004491 3300047321 Bacteria 12747
211 Ga0495676_0010621 3300047321 Bacteria 8339
212 Ga0495676_0051636 3300047321 Bacteria 3287
213 Ga0495680_0024907 3300047322 Bacteria 4955
214 Ga0495683_0031439 3300047323 Bacteria 2705
215 Ga0495687_002208 3300047443 Bacteria 16078
216 Ga0495687_017243 3300047443 Bacteria 3608
217 Ga0495687_043054 3300047443 Bacteria 1969
218 Ga0495687_077546 3300047443 Bacteria 1312
219 Ga0495675_0011317 3300047444 Bacteria 5600
220 Ga0495675_0020308 3300047444 Bacteria 4224
221 Ga0495675_0092452 3300047444 Bacteria 1898
222 Ga0495685_038149 3300047447 Bacteria 1646
223 Ga0495681_0003990 3300047470 Bacteria 10156
224 Ga0495681_0081651 3300047470 Bacteria 1442
225 Ga0495684_0356155 3300047471 Bacteria 1038
226 Ga0495686_0120260 3300047472 Bacteria 1566
227 Ga0495686_0140138 3300047472 Bacteria 1427
228 Ga0495593_0012822 3300047673 Bacteria 4788
229 Ga0495593_0033889 3300047673 Bacteria 2779
230 Ga0495593_0045898 3300047673 Bacteria 2330
231 Ga0495602_0100133 3300048088 Bacteria 2381
232 Ga0495602_0155042 3300048088 Bacteria 1794
233 Ga0495602_0167746 3300048088 Bacteria 1707
234 Ga0495614_0002340 3300048089 Bacteria 8432
235 Ga0495614_0004103 3300048089 Bacteria 6556
236 Ga0495614_0088949 3300048089 Bacteria 1342
237 Ga0495626_0173260 3300048091 Bacteria 898
238 Ga0496102_0615444 3300048905 Bacteria 1009
239 Ga0496109_0042007 3300048912 Bacteria 4141
240 Ga0496126_0076505 3300048929 Bacteria 2969
241 Ga0495678_124393 3300049459 Bacteria 862
242 Ga0501032_0151790 3300049569 Bacteria 1523
243 Ga0501036_0477192 3300049572 Bacteria 1038
244 Ga0501047_0036644 3300049581 Bacteria 4741
245 Ga0501047_0309854 3300049581 Bacteria 1419
246 Ga0501070_0142912 3300049586 Bacteria 1976
247 Ga0501080_0041207 3300049742 Bacteria 4304
248 Ga0501035_0084776 3300049822 Bacteria 2794
249 Ga0501035_0254332 3300049822 Bacteria 1491
250 Ga0501035_0432289 3300049822 Bacteria 1091
251 Ga0501044_0008363 3300049823 Bacteria 11345
252 Ga0501044_0037140 3300049823 Bacteria 5092
253 nmdc:mga03n38_81526_c1 3300050490 Bacteria 1521
254 nmdc:mga0yw44_85698_c1 3300050492 Unclassified 1983
255 nmdc:mga06z11_24634_c1 3300050494 Bacteria 2842
256 nmdc:mga04h51_4979_c1 3300050495 Bacteria 3351
257 nmdc:mga07m45_36243_c1 3300050496 Bacteria 2746
258 Ga0495601_0004040 3300053077 Bacteria 8455
259 Ga0495601_0010672 3300053077 Bacteria 5477
260 Ga0495601_0101393 3300053077 Bacteria 1859
261 Ga0495612_0011128 3300053078 Bacteria 3631
262 Ga0495655_0024891 3300053083 Bacteria 1395
263 Ga0495619_0293165 3300053085 Bacteria 1127
264 Ga0500644_0025398 3300053088 Bacteria 1822
265 Ga0500640_009227 3300053095 Bacteria 3933
266 Ga0500650_0161809 3300053098 Bacteria 1032
267 Ga0500553_037530 3300053101 Bacteria 2392
268 Ga0500560_000395 3300053107 Bacteria 5882
269 Ga0500572_026660 3300053111 Bacteria 1577
270 Ga0500573_0012550 3300053140 Bacteria 4759
271 Ga0500573_0238163 3300053140 Bacteria 945
272 Ga0500600_0120859 3300053149 Bacteria 1350
273 Ga0500624_002044 3300053157 Bacteria 2829
274 Ga0500636_0213754 3300053177 Bacteria 1010
275 Ga0500570_053602 3300053724 Bacteria 2008
276 Ga0466962_0022541 3300061719 Bacteria 3026
277 2585305508 2582581313 Bacteria 10042643
278 2585315056 2582581314 Bacteria 11452267
279 2587757004 2585428062 Bacteria 6842168
280 2616702480 2616644814 Bacteria 11555299
281 2644266684 2643221647 Bacteria 10741251
282 2644630333 2643221714 Bacteria 9015452
283 2753039381 2751185725 Bacteria 5740550
284 2753327996 2751185792 Bacteria 5739090
285 2785370245 2784746768 Bacteria 10036182
286 2786674436 2786546132 Bacteria 10419719
287 2786675975 2786546132 Bacteria 10419719
288 2808915357 2808606375 Bacteria 9466072
289 2812353968 2811994879 Bacteria 9313447
290 2852639159 2852635781 Bacteria 8251373
291 2877678501 2877676314 Bacteria 9512378
292 2912715660 2912715099 Bacteria 9460473
293 2912727119 2912723979 Bacteria 8557534
294 2946071724 2946064051 Bacteria 8957905
295 2946079280 2946072368 Bacteria 8999607
296 2954680970 2954673503 Bacteria 9685905
297 2954683187 2954682443 Bacteria 9862841
298 2954692915 2954691527 Bacteria 10720516
299 2954707988 2954701450 Bacteria 10834262
300 2954712542 2954711539 Bacteria 10867210
301 2954715534 2954711539 Bacteria 10867210
302 2954722497 2954721474 Bacteria 10456478
303 2954725471 2954721474 Bacteria 10456478
304 2954736342 2954731030 Bacteria 10243860
305 2954739361 2954731030 Bacteria 10243860
306 2954741376 2954740390 Bacteria 10229294
307 2954744408 2954740390 Bacteria 10229294
308 2954755189 2954749733 Bacteria 10366972
309 2954758189 2954749733 Bacteria 10366972
310 2954760392 2954759201 Bacteria 9358192
311 2954763393 2954759201 Bacteria 9358192
312 8002790385 8002784119 Bacteria 9788632
313 8008575341 8008574985 Bacteria 7815457
314 Ga0501033_0007588
315 JGI25406J46586_10014965
316 rootL2_10063894
317 rootH1_10257059
318 Ga0055531_10000001
319 Ga0070713_100096360
320 Ga0070708_100242657
321 Ga0068857_100407946
322 Ga0081455_10009828
323 Ga0081455_10066501
324 Ga0081540_1000295
325 Ga0081539_10000299
326 Ga0070717_10330683
327 Ga0075365_10045327
328 Ga0075363_100112837
329 Ga0075367_10003279
330 Ga0099826_10075714
331 Ga0105251_10014564
332 Ga0105245_10359478
333 Ga0105246_10028839
334 Ga0182008_10012617
335 Ga0183367_1004
336 Ga0209050_1007733
337 Ga0209051_1007873
338 Ga0209257_1000033
339 Ga0207647_10093479
340 Ga0207647_10115846
341 Ga0207664_10414045
342 Ga0207674_10386609
343 Ga0207674_10834019
344 Ga0209813_10005527
345 Ga0268266_10343027
346 Ga0307517_10005215
347 Ga0307515_10001006
348 Ga0307515_10002574
349 Ga0307515_10031374
350 Ga0307511_10000010
351 Ga0307511_10069682
352 Ga0307511_10078879
353 Ga0307513_10007065
354 Ga0307513_10008664
355 Ga0307513_10027506
356 Ga0307513_10046050
357 Ga0307513_10116284
358 Ga0307513_10278138
359 Ga0307509_10020897
360 Ga0307509_10023384
361 Ga0307509_10037539
362 Ga0307509_10058423
363 Ga0307508_10011682
364 Ga0307508_10024975
365 Ga0307508_10101303
366 Ga0307514_10022493
367 Ga0307514_10085012
368 Ga0307516_10056050
369 Ga0307413_10455132
370 Ga0307518_10043834
371 Ga0307518_10072505
372 Ga0307507_10014471
373 Ga0307507_10015453
374 Ga0307510_10001558
375 Ga0307510_10115988
376 Ga0395900_0040414
377 Ga0395898_0006152
378 Ga0395898_0141476
379 Ga0395898_0603037
380 Ga0436364_0597839
381 Ga0395901_0369711
382 Ga0451837_0645840
383 Ga0439455_0032092
384 Ga0450903_003394
385 Ga0439458_0000510
386 Ga0466972_0029699
387 Ga0466963_0324146
388 Ga0466964_0139014
389 Ga0466970_0072841
390 Ga0466970_0345983
391 Ga0466967_0078718
392 Ga0466967_0129810
393 Ga0495617_023628
394 Ga0495592_0024740
395 Ga0495592_0030334
396 Ga0495592_0063798
397 Ga0495592_0109279
398 Ga0495603_0000595
399 Ga0495603_0025102
400 Ga0495603_0293712
401 Ga0495629_0001822
402 Ga0495629_0002250
403 Ga0495629_0003752
404 Ga0495629_0046220
405 Ga0495629_0054211
406 Ga0495629_0135107
407 Ga0495638_0072256
408 Ga0495638_0121497
409 Ga0495651_0021462
410 Ga0495651_0357406
411 Ga0495653_0002310
412 Ga0495653_0176271
413 Ga0495580_0012268
414 Ga0495582_0045609
415 Ga0495582_0434058
416 Ga0495605_0004996
417 Ga0495639_0002867
418 Ga0495662_0008598
419 Ga0495662_0020993
420 Ga0495662_0036362
421 Ga0495662_0038630
422 Ga0495662_0052432
423 Ga0495664_0001064
424 Ga0495664_0028064
425 Ga0495664_0165708
426 Ga0495585_0049560
427 Ga0495585_0134702
428 Ga0495594_0225429
429 Ga0495596_0171868
430 Ga0495607_0026555
431 Ga0495607_0120205
432 Ga0495583_0015494
433 Ga0495606_0003194
434 Ga0495606_0019410
435 Ga0495608_0011758
436 Ga0495616_0003925
437 Ga0495618_0008899
438 Ga0495618_0133954
439 Ga0495620_0002556
440 Ga0495620_0031749
441 Ga0495620_0059077
442 Ga0495628_0009301
443 Ga0495628_0044691
444 Ga0495628_0168519
445 Ga0495630_0076938
446 Ga0495630_0228059
447 Ga0495631_0019169
448 Ga0495631_0030041
449 Ga0495632_0118044
450 Ga0495632_0249732
451 Ga0495643_0007489
452 Ga0495643_0043180
453 Ga0495648_0055865
454 Ga0495666_0028120
455 Ga0495666_0035637
456 Ga0495666_0159223
457 Ga0495652_0002722
458 Ga0495652_0011416
459 Ga0495652_0026384
460 Ga0495652_0057495
461 Ga0495665_0002393
462 Ga0495640_0032703
463 Ga0495640_0050477
464 Ga0495640_0097689
465 Ga0495586_0021448
466 Ga0495587_0002095
467 Ga0495587_0023762
468 Ga0495587_0063000
469 Ga0495609_0006018
470 Ga0495597_0011519
471 Ga0495645_0047073
472 Ga0495645_0054529
473 Ga0495622_0011718
474 Ga0495633_0035587
475 Ga0495667_0030777
476 Ga0495667_0048059
477 Ga0495668_0062402
478 Ga0495668_0114553
479 Ga0495634_0002581
480 Ga0495634_0003612
481 Ga0495634_0024037
482 Ga0495634_0121540
483 Ga0495634_0360166
484 Ga0495611_0015796
485 Ga0495625_0021142
486 Ga0495625_0435473
487 Ga0495635_0003949
488 Ga0495635_0014814
489 Ga0495635_0253275
490 Ga0495661_0057751
491 Ga0495588_0005988
492 Ga0495657_0001939
493 Ga0495657_0004703
494 Ga0495657_0016631
495 Ga0495657_0041998
496 Ga0495599_0026323
497 Ga0495623_0059294
498 Ga0495623_0100798
499 Ga0495646_0000204
500 Ga0495646_0078810
501 Ga0495658_0011134
502 Ga0495613_0000570
503 Ga0495613_0002302
504 Ga0495613_0024055
505 Ga0495613_0044990
506 Ga0495671_0026474
507 Ga0495671_0187255
508 Ga0495649_0018272
509 Ga0495649_0043611
510 Ga0495600_0030911
511 Ga0495600_0030973
512 Ga0495600_0328289
513 Ga0495581_0002286
514 Ga0495581_0023462
515 Ga0495581_0053274
516 Ga0495581_0171465
517 Ga0495604_0001112
518 Ga0495604_0001812
519 Ga0495636_0000453
520 Ga0495636_0046035
521 Ga0495674_0308708
522 Ga0495672_0261612
523 Ga0495676_0004491
524 Ga0495676_0010621
525 Ga0495676_0051636
526 Ga0495680_0024907
527 Ga0495683_0031439
528 Ga0495687_002208
529 Ga0495687_017243
530 Ga0495687_043054
531 Ga0495687_077546
532 Ga0495675_0011317
533 Ga0495675_0020308
534 Ga0495675_0092452
535 Ga0495685_038149
536 Ga0495681_0003990
537 Ga0495681_0081651
538 Ga0495684_0356155
539 Ga0495686_0120260
540 Ga0495686_0140138
541 Ga0495593_0012822
542 Ga0495593_0033889
543 Ga0495593_0045898
544 Ga0495602_0100133
545 Ga0495602_0155042
546 Ga0495602_0167746
547 Ga0495614_0002340
548 Ga0495614_0004103
549 Ga0495614_0088949
550 Ga0495626_0173260
551 Ga0496102_0615444
552 Ga0496109_0042007
553 Ga0496126_0076505
554 Ga0495678_124393
555 Ga0501032_0151790
556 Ga0501036_0477192
557 Ga0501047_0036644
558 Ga0501047_0309854
559 Ga0501070_0142912
560 Ga0501080_0041207
561 Ga0501035_0084776
562 Ga0501035_0254332
563 Ga0501035_0432289
564 Ga0501044_0008363
565 Ga0501044_0037140
566 nmdc:mga03n38_81526_c1
567 nmdc:mga0yw44_85698_c1
568 nmdc:mga06z11_24634_c1
569 nmdc:mga04h51_4979_c1
570 nmdc:mga07m45_36243_c1
571 Ga0495601_0004040
572 Ga0495601_0010672
573 Ga0495601_0101393
574 Ga0495612_0011128
575 Ga0495655_0024891
576 Ga0495619_0293165
577 Ga0500644_0025398
578 Ga0500640_009227
579 Ga0500650_0161809
580 Ga0500553_037530
581 Ga0500560_000395
582 Ga0500572_026660
583 Ga0500573_0012550
584 Ga0500573_0238163
585 Ga0500600_0120859
586 Ga0500624_002044
587 Ga0500636_0213754
588 Ga0500570_053602
589 Ga0466962_0022541
590 2585305508
591 2585315056
592 2587757004
593 2616702480
594 2644266684
595 2644630333
596 2753039381
597 2753327996
598 2785370245
599 2786674436
600 2786675975
601 2808915357
602 2812353968
603 2852639159
604 2877678501
605 2912715660
606 2912727119
607 2946071724
608 2946079280
609 2954680970
610 2954683187
611 2954692915
612 2954707988
613 2954712542
614 2954715534
615 2954722497
616 2954725471
617 2954736342
618 2954739361
619 2954741376
620 2954744408
621 2954755189
622 2954758189
623 2954760392
624 2954763393
625 8002790385
626 8008575341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

212

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

234

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

128

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.9581 1 229
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.9501 1 229
5u4s-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.946 1 229
4cqm-assembly4.cif.gz_H crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9212 2 207
3op4-assembly1.cif.gz_A crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+ 0.9206 2 211
ID Description Score Start End Superfamily
af_O53324_1_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 1 218 3.40.50.720
af_A0A1D8PJ12_2_249_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9282 4 206 3.40.50.720
af_Q6NNV7_1_241_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9257 4 208 3.40.50.720
af_Q9VD30_2_245_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 4 206 3.40.50.720
af_Q07530_36_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9207 4 212 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0S2PGQ6-F1-model_v4 deleted 0.9891 1 168
AF-A0A399Q5E1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9887 1 209 GO:0016491
AF-A0A1E7KTX3-F1-model_v4 Short-chain dehydrogenase 0.9869 1 220 GO:0016491
AF-A0A1I4LNJ2-F1-model_v4 Short-chain dehydrogenase 0.9858 1 227 GO:0005829
GO:0016491
AF-A0A7T7L2L3-F1-model_v4 SDR family oxidoreductase 0.9852 1 229 GO:0016491

Map