F402170

General Info

Members Datasets Scaffolds Average Seq Length
313 201 309 152

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10244516|Ga0105246_102445162
Length 175
Sequence MDDFQPDAPTVRRGVRIRPETTHMTNHILAKAVLAACIMTLAGGARADNATSAEATAMVKKGVAFIKANGKDKGYAEISNKTGQFNDRDLYLTVYGLDGTVRAHGANEKMIGKNLIELKDVDGKAFVKERVELGASKGTFWQDYKFTNPVSKKIEPKSMYCERLDDAVVCGGIYK

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
3 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
4 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
191 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0.64
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.09
Nodule 0
Rhizoplane 7.67
Rhizosphere 58.47
Stem 0
Stem Tuber 0
Unclassified 12.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055528_1032522 3300003790 Bacteria 1328
2 Ga0055530_10065963 3300003791 Bacteria 793
3 Ga0065165_1009224 3300005262 Bacteria 4462
4 Ga0070676_10003760 3300005328 Bacteria 7957
5 Ga0068868_100054263 3300005338 Bacteria 3158
6 Ga0070668_100287172 3300005347 Unclassified 1376
7 Ga0070668_100414121 3300005347 Bacteria 1153
8 Ga0070671_100412812 3300005355 Bacteria 1156
9 Ga0070674_101179655 3300005356 Unclassified 679
10 Ga0070667_100228513 3300005367 Bacteria 1658
11 Ga0070667_100438156 3300005367 Bacteria 1193
12 Ga0070706_100060273 3300005467 Bacteria 3503
13 Ga0068853_100183812 3300005539 Unclassified 1897
14 Ga0068853_100221120 3300005539 Bacteria 1729
15 Ga0070695_100166360 3300005545 Bacteria 1552
16 Ga0070696_100435045 3300005546 Unclassified 1032
17 Ga0068854_100393852 3300005578 Bacteria 1144
18 Ga0070702_100439775 3300005615 Bacteria 943
19 Ga0068852_100115320 3300005616 Bacteria 2449
20 Ga0068852_101605293 3300005616 Bacteria 673
21 Ga0068859_100311625 3300005617 Bacteria 1667
22 Ga0068859_100726793 3300005617 Bacteria 1083
23 Ga0068864_100251995 3300005618 Bacteria 1639
24 Ga0068864_101000233 3300005618 Bacteria 829
25 Ga0068870_10098345 3300005840 Bacteria 1648
26 Ga0068863_100258723 3300005841 Bacteria 1682
27 Ga0068863_100263023 3300005841 Bacteria 1668
28 Ga0068863_100341775 3300005841 Bacteria 1456
29 Ga0068863_100566129 3300005841 Bacteria 1123
30 Ga0068863_101557457 3300005841 Bacteria 670
31 Ga0068860_100177501 3300005843 Bacteria 2058
32 Ga0068860_100218021 3300005843 Bacteria 1852
33 Ga0075365_10191818 3300006038 Bacteria 1430
34 Ga0075368_10034165 3300006042 Bacteria 1980
35 Ga0075364_10178675 3300006051 Bacteria 1436
36 Ga0075432_10037592 3300006058 Unclassified 1686
37 Ga0075432_10063496 3300006058 Bacteria 1318
38 Ga0070715_10126669 3300006163 Unclassified 1224
39 Ga0075362_10029907 3300006177 Bacteria 2350
40 Ga0075362_10030177 3300006177 Bacteria 2340
41 Ga0075362_10066757 3300006177 Bacteria 1635
42 Ga0075367_10096385 3300006178 Bacteria 1804
43 Ga0075366_10076629 3300006195 Bacteria 1996
44 Ga0075366_10095391 3300006195 Bacteria 1783
45 Ga0075366_10128031 3300006195 Bacteria 1532
46 Ga0075366_10134233 3300006195 Bacteria 1494
47 Ga0075370_10048336 3300006353 Bacteria 2410
48 Ga0075370_10061738 3300006353 Bacteria 2135
49 Ga0075370_10074734 3300006353 Bacteria 1942
50 Ga0075370_10084493 3300006353 Bacteria 1827
51 Ga0075370_10105264 3300006353 Bacteria 1635
52 Ga0068871_100841599 3300006358 Bacteria 848
53 Ga0075433_10207104 3300006852 Bacteria 1744
54 Ga0097620_100311615 3300006931 Bacteria 1667
55 Ga0097620_100535654 3300006931 Bacteria 1266
56 Ga0097620_100726724 3300006931 Bacteria 1083
57 Ga0105240_10002209 3300009093 Bacteria 31729
58 Ga0105240_11899938 3300009093 Bacteria 619
59 Ga0111539_11966137 3300009094 Bacteria 678
60 Ga0105245_10201956 3300009098 Bacteria 1909
61 Ga0105245_10322990 3300009098 Bacteria 1521
62 Ga0105245_10487688 3300009098 Bacteria 1246
63 Ga0114129_12372362 3300009147 Bacteria 636
64 Ga0105243_10643675 3300009148 Unclassified 1026
65 Ga0105248_12079073 3300009177 Bacteria 646
66 Ga0105237_10157912 3300009545 Bacteria 2265
67 Ga0105238_10026216 3300009551 Bacteria 5940
68 Ga0105239_10000677 3300010375 Bacteria 48572
69 Ga0105239_11585310 3300010375 Bacteria 757
70 Ga0105246_10244516 3300011119 Bacteria 1420
71 Ga0157369_10491327 3300013105 Bacteria 1270
72 Ga0157374_10397694 3300013296 Unclassified 1374
73 Ga0163162_10334189 3300013306 Bacteria 1647
74 Ga0157375_10211931 3300013308 Bacteria 2095
75 Ga0157375_10410497 3300013308 Bacteria 1520
76 Ga0157375_10471967 3300013308 Bacteria 1420
77 Ga0163163_10189973 3300014325 Bacteria 2102
78 Ga0157379_11139316 3300014968 Bacteria 748
79 Ga0157376_10409610 3300014969 Unclassified 1313
80 Ga0157376_11810215 3300014969 Bacteria 647
81 Ga0163161_10228633 3300017792 Bacteria 1443
82 Ga0209673_1013853 3300025273 Bacteria 3159
83 Ga0209050_1004917 3300025298 Bacteria 8735
84 Ga0209050_1021838 3300025298 Bacteria 2315
85 Ga0209051_1004360 3300025303 Bacteria 8761
86 Ga0209051_1015013 3300025303 Bacteria 3586
87 Ga0207642_10216943 3300025899 Unclassified 1067
88 Ga0207680_10260993 3300025903 Bacteria 1199
89 Ga0207685_10167691 3300025905 Unclassified 1008
90 Ga0207645_10033411 3300025907 Bacteria 3306
91 Ga0207643_10054855 3300025908 Bacteria 2266
92 Ga0207684_10068763 3300025910 Bacteria 3010
93 Ga0207695_10051136 3300025913 Bacteria 4341
94 Ga0207695_10230543 3300025913 Bacteria 1757
95 Ga0207671_10093679 3300025914 Bacteria 2266
96 Ga0207657_10416652 3300025919 Unclassified 1056
97 Ga0207694_10086197 3300025924 Unclassified 2473
98 Ga0207650_10885034 3300025925 Bacteria 758
99 Ga0207650_11162756 3300025925 Bacteria 657
100 Ga0207650_11352980 3300025925 Bacteria 606
101 Ga0207659_10404635 3300025926 Bacteria 1142
102 Ga0207687_10278805 3300025927 Bacteria 1339
103 Ga0207687_10500941 3300025927 Bacteria 1014
104 Ga0207644_10156396 3300025931 Bacteria 1768
105 Ga0207644_10452825 3300025931 Bacteria 1054
106 Ga0207709_10071016 3300025935 Bacteria 2209
107 Ga0207689_10021076 3300025942 Bacteria 5478
108 Ga0207689_10305960 3300025942 Bacteria 1318
109 Ga0207651_10411669 3300025960 Bacteria 1152
110 Ga0207651_10511548 3300025960 Bacteria 1039
111 Ga0207668_10360636 3300025972 Bacteria 1218
112 Ga0207640_10161115 3300025981 Bacteria 1660
113 Ga0207640_10340912 3300025981 Bacteria 1200
114 Ga0207658_10200546 3300025986 Bacteria 1665
115 Ga0207658_10397694 3300025986 Bacteria 1210
116 Ga0207677_10123284 3300026023 Bacteria 1954
117 Ga0207703_11017895 3300026035 Bacteria 795
118 Ga0207639_10061365 3300026041 Unclassified 2903
119 Ga0207639_10158944 3300026041 Bacteria 1902
120 Ga0207641_10057585 3300026088 Bacteria 3305
121 Ga0207641_10686161 3300026088 Bacteria 1008
122 Ga0207641_11247793 3300026088 Unclassified 743
123 Ga0207641_12349234 3300026088 Bacteria 532
124 Ga0207676_10336776 3300026095 Bacteria 1390
125 Ga0207676_10516276 3300026095 Bacteria 1137
126 Ga0207674_10009995 3300026116 Bacteria 10799
127 Ga0207674_10582067 3300026116 Bacteria 1081
128 Ga0207674_11231875 3300026116 Unclassified 718
129 Ga0207675_100579815 3300026118 Bacteria 1123
130 Ga0207683_10105677 3300026121 Bacteria 2517
131 Ga0207683_10159179 3300026121 Bacteria 2041
132 Ga0207698_11441392 3300026142 Bacteria 704
133 Ga0209995_1054587 3300027471 Bacteria 679
134 Ga0209813_10180988 3300027866 Bacteria 771
135 Ga0207428_10272139 3300027907 Bacteria 1259
136 Ga0268266_10603978 3300028379 Unclassified 1054
137 Ga0268264_10124207 3300028381 Bacteria 2279
138 Ga0268264_10376219 3300028381 Bacteria 1359
139 Ga0268264_12092396 3300028381 Bacteria 575
140 Ga0265318_10148583 3300028577 Unclassified 860
141 Ga0307517_10001591 3300028786 Bacteria 37812
142 Ga0307517_10167178 3300028786 Bacteria 1457
143 Ga0307517_10209361 3300028786 Bacteria 1204
144 Ga0307515_10000103 3300028794 Bacteria 198308
145 Ga0307515_10000232 3300028794 Bacteria 137778
146 Ga0307515_10010735 3300028794 Bacteria 17494
147 Ga0307515_10020933 3300028794 Bacteria 11625
148 Ga0307515_10096625 3300028794 Bacteria 3621
149 Ga0307515_10182586 3300028794 Bacteria 2041
150 Ga0307515_10282278 3300028794 Bacteria 1366
151 Ga0307515_10356637 3300028794 Bacteria 1106
152 Ga0265316_10000005 3300031344 Bacteria 304442
153 Ga0307513_10209689 3300031456 Bacteria 1781
154 Ga0307513_10209997 3300031456 Bacteria 1779
155 Ga0307513_10295747 3300031456 Bacteria 1388
156 Ga0307509_10021989 3300031507 Bacteria 7200
157 Ga0307509_10062124 3300031507 Bacteria 3940
158 Ga0307509_10094299 3300031507 Bacteria 3052
159 Ga0307509_10292619 3300031507 Bacteria 1382
160 Ga0307509_10598427 3300031507 Bacteria 775
161 Ga0307408_100320303 3300031548 Bacteria 1306
162 Ga0307508_10000368 3300031616 Bacteria 54659
163 Ga0307508_10011417 3300031616 Bacteria 8120
164 Ga0307508_10014137 3300031616 Bacteria 7283
165 Ga0307514_10001565 3300031649 Bacteria 27095
166 Ga0307514_10017566 3300031649 Bacteria 5882
167 Ga0307514_10135668 3300031649 Bacteria 1685
168 Ga0307516_10070669 3300031730 Bacteria 3354
169 Ga0307516_10180001 3300031730 Bacteria 1848
170 Ga0307516_10473961 3300031730 Bacteria 907
171 Ga0307405_10293342 3300031731 Bacteria 1230
172 Ga0307410_10392643 3300031852 Bacteria 1119
173 Ga0307507_10036764 3300033179 Bacteria 4998
174 Ga0307507_10084566 3300033179 Bacteria 2764
175 Ga0307510_10232874 3300033180 Bacteria 1343
176 Ga0373940_0189349 3300035088 Bacteria 672
177 Ga0373939_0122320 3300035114 Bacteria 919
178 Ga0373931_0048335 3300035691 Bacteria 2255
179 Ga0373937_0272712 3300036401 Bacteria 1597
180 Ga0373937_0585693 3300036401 Bacteria 1059
181 Ga0373925_0592293 3300037068 Bacteria 913
182 Ga0451789_0124233 3300041443 Bacteria 1513
183 Ga0451791_0808117 3300041451 Bacteria 1521
184 Ga0451793_0014778 3300041452 Bacteria 2476
185 Ga0451793_0462623 3300041452 Bacteria 592
186 Ga0451793_1263303 3300041452 Bacteria 1225
187 Ga0451797_0276331 3300041453 Bacteria 569
188 Ga0451797_0968387 3300041453 Bacteria 1128
189 Ga0451795_0246322 3300041456 Bacteria 891
190 Ga0451798_0403471 3300041458 Bacteria 928
191 Ga0451800_0506324 3300041459 Bacteria 2840
192 Ga0451800_0740856 3300041459 Bacteria 1660
193 Ga0451802_0493372 3300041460 Bacteria 2338
194 Ga0451802_0600920 3300041460 Bacteria 4126
195 Ga0451805_013476 3300041461 Bacteria 747
196 Ga0451804_0030771 3300041463 Bacteria 1182
197 Ga0451841_1368528 3300041498 Bacteria 1634
198 Ga0451849_0680273 3300041505 Bacteria 2032
199 Ga0451843_0827713 3300041509 Bacteria 656
200 Ga0451853_1179119 3300041512 Bacteria 796
201 Ga0451577_0001547 3300042876 Bacteria 30192
202 Ga0451577_0249832 3300042876 Bacteria 1605
203 Ga0451577_1419677 3300042876 Unclassified 615
204 Ga0453684_0123821 3300044712 Bacteria 3116
205 Ga0453684_0196612 3300044712 Bacteria 2354
206 Ga0453684_0367750 3300044712 Bacteria 1617
207 Ga0453684_0868683 3300044712 Bacteria 968
208 Ga0451576_0208209 3300045051 Bacteria 2042
209 Ga0451576_1083126 3300045051 Bacteria 839
210 Ga0451576_1350950 3300045051 Bacteria 742
211 Ga0495590_0123725 3300046457 Bacteria 927
212 Ga0495629_0622456 3300046459 Bacteria 721
213 Ga0495638_0055615 3300046460 Bacteria 2457
214 Ga0495650_0006891 3300046471 Bacteria 6971
215 Ga0495605_0032527 3300046474 Bacteria 2655
216 Ga0495639_0407970 3300046475 Bacteria 687
217 Ga0495606_0069303 3300046507 Bacteria 2228
218 Ga0495610_0037135 3300046512 Bacteria 2482
219 Ga0495610_0230843 3300046512 Bacteria 742
220 Ga0495630_0121698 3300046517 Bacteria 1980
221 Ga0495632_0033075 3300046519 Bacteria 2658
222 Ga0495632_0037075 3300046519 Bacteria 2477
223 Ga0495632_0101648 3300046519 Bacteria 1354
224 Ga0495632_0219412 3300046519 Bacteria 860
225 Ga0495637_0292539 3300046520 Bacteria 579
226 Ga0495643_0022777 3300046522 Bacteria 3568
227 Ga0495597_0128637 3300046542 Bacteria 1051
228 Ga0495668_0161761 3300046616 Bacteria 1226
229 Ga0495668_0478157 3300046616 Bacteria 686
230 Ga0495668_0811698 3300046616 Bacteria 518
231 Ga0495625_0002284 3300046660 Bacteria 21038
232 Ga0495625_0294959 3300046660 Bacteria 1039
233 Ga0495625_0377055 3300046660 Bacteria 891
234 Ga0495623_0642049 3300046679 Bacteria 548
235 Ga0495658_0104228 3300046683 Bacteria 1697
236 Ga0495658_0165801 3300046683 Bacteria 1365
237 Ga0495624_0088876 3300046690 Bacteria 1907
238 Ga0495671_0503034 3300046692 Bacteria 578
239 Ga0495649_0271598 3300046694 Bacteria 867
240 Ga0495660_0007305 3300046810 Bacteria 6494
241 Ga0495636_0538869 3300047318 Bacteria 567
242 Ga0495676_0054642 3300047321 Bacteria 3173
243 Ga0495687_006585 3300047443 Bacteria 7075
244 Ga0496102_0013652 3300048905 Bacteria 7040
245 Ga0496103_0082190 3300048906 Bacteria 2027
246 Ga0496104_1640761 3300048907 Bacteria 545
247 Ga0496105_0390210 3300048908 Unclassified 1107
248 Ga0496110_0062142 3300048913 Bacteria 3298
249 Ga0496110_0843592 3300048913 Unclassified 821
250 Ga0496111_0113223 3300048914 Bacteria 1999
251 Ga0496113_0416275 3300048916 Bacteria 1079
252 Ga0496115_0491760 3300048918 Bacteria 987
253 Ga0496121_0007977 3300048924 Bacteria 12643
254 Ga0496124_0133188 3300048927 Bacteria 1972
255 Ga0501310_021938 3300049130 Bacteria 802
256 Ga0501040_0331675 3300049576 Bacteria 1089
257 Ga0501041_0166031 3300049577 Bacteria 1381
258 Ga0501046_0422983 3300049580 Bacteria 960
259 Ga0501071_0241153 3300049587 Bacteria 1363
260 Ga0501075_0028249 3300049591 Bacteria 4140
261 Ga0501076_0072722 3300049592 Bacteria 2752
262 Ga0501081_0371875 3300049743 Bacteria 1055
263 Ga0501045_0397648 3300049824 Bacteria 1025
264 nmdc:mga03683_129057_c1 3300050489 Bacteria 1130
265 nmdc:mga03683_47196_c1 3300050489 Bacteria 1787
266 nmdc:mga03683_7808_c1 3300050489 Bacteria 3733
267 nmdc:mga03n38_181087_c1 3300050490 Bacteria 1080
268 nmdc:mga00v17_844939_c1 3300050491 Bacteria 582
269 nmdc:mga0yw44_99354_c1 3300050492 Bacteria 1851
270 nmdc:mga0k408_79803_c2 3300050493 Bacteria 1485
271 nmdc:mga0k408_97968_c1 3300050493 Bacteria 1728
272 nmdc:mga06z11_111720_c1 3300050494 Bacteria 1514
273 nmdc:mga06z11_578404_c1 3300050494 Bacteria 683
274 nmdc:mga04h51_424031_c1 3300050495 Bacteria 560
275 nmdc:mga04h51_67510_c1 3300050495 Bacteria 1241
276 nmdc:mga07m45_46580_c1 3300050496 Bacteria 2437
277 nmdc:mga07m45_65673_c1 3300050496 Bacteria 2060
278 nmdc:mga07m45_78629_c1 3300050496 Bacteria 1882
279 nmdc:mga07m45_93110_c1 3300050496 Bacteria 1728
280 nmdc:mga05p37_2228903_c1 3300050507 Unclassified 507
281 nmdc:mga05p37_480786_c1 3300050507 Bacteria 1431
282 nmdc:mga0n895_2051932_c1 3300050512 Unclassified 529
283 nmdc:mga0n895_249554_c1 3300050512 Bacteria 1801
284 nmdc:mga0sz30_22293_c1 3300050516 Bacteria 2570
285 nmdc:mga0sz30_69708_c1 3300050516 Bacteria 1512
286 Ga0495601_0396621 3300053077 Bacteria 895
287 Ga0500578_0013820 3300053086 Bacteria 5197
288 Ga0500644_0027200 3300053088 Bacteria 1777
289 Ga0500646_0048331 3300053090 Bacteria 1219
290 Ga0500583_0373350 3300053092 Bacteria 688
291 Ga0500651_0017219 3300053093 Bacteria 4453
292 Ga0500651_0469825 3300053093 Bacteria 697
293 Ga0500651_0668129 3300053093 Bacteria 558
294 Ga0500650_0051228 3300053098 Bacteria 1917
295 Ga0500557_233256 3300053105 Bacteria 581
296 Ga0500623_092226 3300053127 Bacteria 1409
297 Ga0500628_006860 3300053129 Bacteria 1936
298 Ga0500642_0132288 3300053130 Bacteria 1169
299 Ga0500652_004014 3300053131 Bacteria 4509
300 Ga0500658_0010582 3300053134 Bacteria 3403
301 Ga0500561_0046868 3300053137 Bacteria 1165
302 Ga0500568_0055669 3300053139 Bacteria 1543
303 Ga0500568_0072711 3300053139 Bacteria 1314
304 Ga0500604_0028316 3300053151 Bacteria 1626
305 Ga0500622_0000221 3300053156 Bacteria 59833
306 Ga0500622_0126051 3300053156 Bacteria 1236
307 Ga0500645_006448 3300053730 Bacteria 4189
308 Ga0500645_118154 3300053730 Bacteria 741
309 Ga0500587_003848 3300053739 Bacteria 2083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0196612 Ga0453684_0196612_1266_1736 134
2 3300025298 Ga0209050_1021838 Ga0209050_10218382 139
3 3300050507 nmdc:mga05p37_2228903_c1 nmdc:mga05p37_2228903_c1_53_481 139
4 3300048907 Ga0496104_1640761 Ga0496104_1640761_29_463 140
5 3300048913 Ga0496110_0843592 Ga0496110_0843592_125_556 140
6 3300050512 nmdc:mga0n895_2051932_c1 nmdc:mga0n895_2051932_c1_72_506 140
7 3300005467 Ga0070706_100060273 Ga0070706_1000602733 141
8 3300025910 Ga0207684_10068763 Ga0207684_100687633 141
9 3300026121 Ga0207683_10159179 Ga0207683_101591792 141
10 3300042876 Ga0451577_0249832 Ga0451577_0249832_424_879 141
11 3300044712 Ga0453684_0367750 Ga0453684_0367750_131_586 141
12 3300046616 Ga0495668_0161761 Ga0495668_0161761_388_849 141
13 3300050489 nmdc:mga03683_129057_c1 nmdc:mga03683_129057_c1_99_560 141
14 3300053139 Ga0500568_0055669 Ga0500568_0055669_980_1441 141
15 3300005617 Ga0068859_100726793 Ga0068859_1007267931 142
16 3300006931 Ga0097620_100726724 Ga0097620_1007267241 142
17 3300026088 Ga0207641_10686161 Ga0207641_106861611 142
18 3300028794 Ga0307515_10000103 Ga0307515_1000010381 142
19 3300005367 Ga0070667_100438156 Ga0070667_1004381562 144
20 3300005616 Ga0068852_101605293 Ga0068852_1016052931 144
21 3300005617 Ga0068859_100311625 Ga0068859_1003116252 144
22 3300005618 Ga0068864_100251995 Ga0068864_1002519952 144
23 3300005841 Ga0068863_100258723 Ga0068863_1002587232 144
24 3300006358 Ga0068871_100841599 Ga0068871_1008415992 144
25 3300006931 Ga0097620_100311615 Ga0097620_1003116152 144
26 3300009098 Ga0105245_10201956 Ga0105245_102019562 144
27 3300013308 Ga0157375_10410497 Ga0157375_104104972 144
28 3300014325 Ga0163163_10189973 Ga0163163_101899732 144
29 3300025903 Ga0207680_10260993 Ga0207680_102609932 144
30 3300025925 Ga0207650_10885034 Ga0207650_108850342 144
31 3300025927 Ga0207687_10500941 Ga0207687_105009412 144
32 3300025931 Ga0207644_10452825 Ga0207644_104528252 144
33 3300025935 Ga0207709_10071016 Ga0207709_100710162 144
34 3300025942 Ga0207689_10305960 Ga0207689_103059602 144
35 3300025986 Ga0207658_10397694 Ga0207658_103976941 144
36 3300026023 Ga0207677_10123284 Ga0207677_101232842 144
37 3300026088 Ga0207641_10057585 Ga0207641_100575852 144
38 3300026095 Ga0207676_10336776 Ga0207676_103367762 144
39 3300026142 Ga0207698_11441392 Ga0207698_114413922 144
40 3300028381 Ga0268264_10376219 Ga0268264_103762192 144
41 3300031507 Ga0307509_10094299 Ga0307509_100942992 144
42 3300033180 Ga0307510_10232874 Ga0307510_102328742 144
43 3300046616 Ga0495668_0478157 Ga0495668_0478157_214_675 144
44 3300005539 Ga0068853_100183812 Ga0068853_1001838122 145
45 3300005616 Ga0068852_100115320 Ga0068852_1001153202 145
46 3300009093 Ga0105240_10002209 Ga0105240_1000220923 145
47 3300009551 Ga0105238_10026216 Ga0105238_100262163 145
48 3300010375 Ga0105239_10000677 Ga0105239_100006775 145
49 3300025913 Ga0207695_10051136 Ga0207695_100511365 145
50 3300025924 Ga0207694_10086197 Ga0207694_100861972 145
51 3300026041 Ga0207639_10061365 Ga0207639_100613654 145
52 3300028379 Ga0268266_10603978 Ga0268266_106039781 145
53 3300042876 Ga0451577_1419677 Ga0451577_1419677_48_512 145
54 3300044712 Ga0453684_0123821 Ga0453684_0123821_134_595 145
55 3300045051 Ga0451576_0208209 Ga0451576_0208209_1469_1945 145
56 3300005615 Ga0070702_100439775 Ga0070702_1004397751 146
57 3300005841 Ga0068863_100341775 Ga0068863_1003417752 146
58 3300006353 Ga0075370_10084493 Ga0075370_100844932 146
59 3300014969 Ga0157376_11810215 Ga0157376_118102151 146
60 3300026088 Ga0207641_11247793 Ga0207641_112477931 146
61 3300028577 Ga0265318_10148583 Ga0265318_101485831 146
62 3300028794 Ga0307515_10096625 Ga0307515_100966252 146
63 3300031548 Ga0307408_100320303 Ga0307408_1003203031 146
64 3300031649 Ga0307514_10001565 Ga0307514_1000156524 146
65 3300031731 Ga0307405_10293342 Ga0307405_102933422 146
66 3300031852 Ga0307410_10392643 Ga0307410_103926432 146
67 3300036401 Ga0373937_0272712 Ga0373937_0272712_901_1353 146
68 3300037068 Ga0373925_0592293 Ga0373925_0592293_424_876 146
69 3300042876 Ga0451577_0001547 Ga0451577_0001547_3938_4402 146
70 3300044712 Ga0453684_0868683 Ga0453684_0868683_323_787 146
71 3300048913 Ga0496110_0062142 Ga0496110_0062142_2673_3134 146
72 3300048916 Ga0496113_0416275 Ga0496113_0416275_613_1065 146
73 3300048924 Ga0496121_0007977 Ga0496121_0007977_8166_8630 146
74 3300048927 Ga0496124_0133188 Ga0496124_0133188_1324_1791 146
75 3300049130 Ga0501310_021938 Ga0501310_021938_120_572 146
76 3300050496 nmdc:mga07m45_78629_c1 nmdc:mga07m45_78629_c1_329_781 146
77 3300050512 nmdc:mga0n895_249554_c1 nmdc:mga0n895_249554_c1_768_1235 146
78 3300053077 Ga0495601_0396621 Ga0495601_0396621_184_636 146
79 3300053105 Ga0500557_233256 Ga0500557_233256_36_494 146
80 iso_pu_bacteria 2585428062 2587756141 146
81 iso_pu_bacteria 2643221592 2643966922 146
82 iso_pu_bacteria 2643221625 2644142710 146
83 iso_pu_bacteria 2643221648 2644273618 146
84 3300005841 Ga0068863_100566129 Ga0068863_1005661291 147
85 3300005843 Ga0068860_100218021 Ga0068860_1002180213 147
86 3300009148 Ga0105243_10643675 Ga0105243_106436752 147
87 3300009177 Ga0105248_12079073 Ga0105248_120790732 147
88 3300014968 Ga0157379_11139316 Ga0157379_111393162 147
89 3300025905 Ga0207685_10167691 Ga0207685_101676912 147
90 3300026088 Ga0207641_12349234 Ga0207641_123492341 147
91 3300026116 Ga0207674_11231875 Ga0207674_112318751 147
92 3300028381 Ga0268264_10124207 Ga0268264_101242072 147
93 3300031507 Ga0307509_10292619 Ga0307509_102926192 147
94 3300045051 Ga0451576_1083126 Ga0451576_1083126_222_677 147
95 3300005347 Ga0070668_100287172 Ga0070668_1002871721 149
96 3300005356 Ga0070674_101179655 Ga0070674_1011796552 149
97 3300005545 Ga0070695_100166360 Ga0070695_1001663602 149
98 3300005546 Ga0070696_100435045 Ga0070696_1004350451 149
99 3300006058 Ga0075432_10037592 Ga0075432_100375924 149
100 3300006163 Ga0070715_10126669 Ga0070715_101266692 149
101 3300013105 Ga0157369_10491327 Ga0157369_104913272 149
102 3300013296 Ga0157374_10397694 Ga0157374_103976941 149
103 3300013306 Ga0163162_10334189 Ga0163162_103341892 149
104 3300014969 Ga0157376_10409610 Ga0157376_104096101 149
105 3300025899 Ga0207642_10216943 Ga0207642_102169432 149
106 3300025919 Ga0207657_10416652 Ga0207657_104166522 149
107 3300026121 Ga0207683_10105677 Ga0207683_101056772 149
108 3300027907 Ga0207428_10272139 Ga0207428_102721391 149
109 3300041452 Ga0451793_0462623 Ga0451793_0462623_77_532 149
110 3300046683 Ga0495658_0104228 Ga0495658_0104228_181_648 149
111 3300048905 Ga0496102_0013652 Ga0496102_0013652_987_1454 149
112 3300048906 Ga0496103_0082190 Ga0496103_0082190_1019_1486 149
113 3300048908 Ga0496105_0390210 Ga0496105_0390210_508_975 149
114 3300048914 Ga0496111_0113223 Ga0496111_0113223_289_756 149
115 3300048918 Ga0496115_0491760 Ga0496115_0491760_335_802 149
116 3300050507 nmdc:mga05p37_480786_c1 nmdc:mga05p37_480786_c1_267_734 149
117 3300003790 Ga0055528_1032522 Ga0055528_10325222 150
118 3300003791 Ga0055530_10065963 Ga0055530_100659632 150
119 3300005262 Ga0065165_1009224 Ga0065165_10092241 150
120 3300005328 Ga0070676_10003760 Ga0070676_100037606 150
121 3300005338 Ga0068868_100054263 Ga0068868_1000542632 150
122 3300005347 Ga0070668_100414121 Ga0070668_1004141211 150
123 3300005355 Ga0070671_100412812 Ga0070671_1004128121 150
124 3300005367 Ga0070667_100228513 Ga0070667_1002285132 150
125 3300005539 Ga0068853_100221120 Ga0068853_1002211202 150
126 3300005578 Ga0068854_100393852 Ga0068854_1003938522 150
127 3300005618 Ga0068864_101000233 Ga0068864_1010002331 150
128 3300005840 Ga0068870_10098345 Ga0068870_100983452 150
129 3300005841 Ga0068863_100263023 Ga0068863_1002630232 150
130 3300005841 Ga0068863_101557457 Ga0068863_1015574571 150
131 3300005843 Ga0068860_100177501 Ga0068860_1001775012 150
132 3300006038 Ga0075365_10191818 Ga0075365_101918182 150
133 3300006042 Ga0075368_10034165 Ga0075368_100341652 150
134 3300006051 Ga0075364_10178675 Ga0075364_101786752 150
135 3300006058 Ga0075432_10063496 Ga0075432_100634962 150
136 3300006177 Ga0075362_10029907 Ga0075362_100299072 150
137 3300006177 Ga0075362_10030177 Ga0075362_100301772 150
138 3300006177 Ga0075362_10066757 Ga0075362_100667571 150
139 3300006178 Ga0075367_10096385 Ga0075367_100963852 150
140 3300006195 Ga0075366_10076629 Ga0075366_100766292 150
141 3300006195 Ga0075366_10095391 Ga0075366_100953912 150
142 3300006195 Ga0075366_10128031 Ga0075366_101280312 150
143 3300006195 Ga0075366_10134233 Ga0075366_101342331 150
144 3300006353 Ga0075370_10048336 Ga0075370_100483362 150
145 3300006353 Ga0075370_10061738 Ga0075370_100617382 150
146 3300006353 Ga0075370_10074734 Ga0075370_100747342 150
147 3300006353 Ga0075370_10105264 Ga0075370_101052642 150
148 3300006852 Ga0075433_10207104 Ga0075433_102071042 150
149 3300006931 Ga0097620_100535654 Ga0097620_1005356542 150
150 3300009093 Ga0105240_11899938 Ga0105240_118999381 150
151 3300009094 Ga0111539_11966137 Ga0111539_119661371 150
152 3300009098 Ga0105245_10322990 Ga0105245_103229902 150
153 3300009098 Ga0105245_10487688 Ga0105245_104876882 150
154 3300009147 Ga0114129_12372362 Ga0114129_123723621 150
155 3300009545 Ga0105237_10157912 Ga0105237_101579122 150
156 3300010375 Ga0105239_11585310 Ga0105239_115853102 150
157 3300011119 Ga0105246_10244516 Ga0105246_102445162 150
158 3300013308 Ga0157375_10211931 Ga0157375_102119311 150
159 3300013308 Ga0157375_10471967 Ga0157375_104719672 150
160 3300017792 Ga0163161_10228633 Ga0163161_102286331 150
161 3300025273 Ga0209673_1013853 Ga0209673_10138531 150
162 3300025298 Ga0209050_1004917 Ga0209050_10049174 150
163 3300025303 Ga0209051_1004360 Ga0209051_10043607 150
164 3300025303 Ga0209051_1015013 Ga0209051_10150133 150
165 3300025907 Ga0207645_10033411 Ga0207645_100334114 150
166 3300025908 Ga0207643_10054855 Ga0207643_100548552 150
167 3300025913 Ga0207695_10230543 Ga0207695_102305432 150
168 3300025914 Ga0207671_10093679 Ga0207671_100936792 150
169 3300025925 Ga0207650_11162756 Ga0207650_111627562 150
170 3300025925 Ga0207650_11352980 Ga0207650_113529801 150
171 3300025926 Ga0207659_10404635 Ga0207659_104046351 150
172 3300025927 Ga0207687_10278805 Ga0207687_102788052 150
173 3300025931 Ga0207644_10156396 Ga0207644_101563962 150
174 3300025942 Ga0207689_10021076 Ga0207689_100210764 150
175 3300025960 Ga0207651_10411669 Ga0207651_104116692 150
176 3300025960 Ga0207651_10511548 Ga0207651_105115481 150
177 3300025972 Ga0207668_10360636 Ga0207668_103606362 150
178 3300025981 Ga0207640_10161115 Ga0207640_101611152 150
179 3300025981 Ga0207640_10340912 Ga0207640_103409121 150
180 3300025986 Ga0207658_10200546 Ga0207658_102005462 150
181 3300026035 Ga0207703_11017895 Ga0207703_110178952 150
182 3300026041 Ga0207639_10158944 Ga0207639_101589442 150
183 3300026095 Ga0207676_10516276 Ga0207676_105162762 150
184 3300026116 Ga0207674_10009995 Ga0207674_100099952 150
185 3300026116 Ga0207674_10582067 Ga0207674_105820672 150
186 3300026118 Ga0207675_100579815 Ga0207675_1005798152 150
187 3300027471 Ga0209995_1054587 Ga0209995_10545871 150
188 3300027866 Ga0209813_10180988 Ga0209813_101809882 150
189 3300028381 Ga0268264_12092396 Ga0268264_120923961 150
190 3300028786 Ga0307517_10001591 Ga0307517_100015916 150
191 3300028786 Ga0307517_10167178 Ga0307517_101671782 150
192 3300028786 Ga0307517_10209361 Ga0307517_102093612 150
193 3300028794 Ga0307515_10000232 Ga0307515_10000232103 150
194 3300028794 Ga0307515_10010735 Ga0307515_100107355 150
195 3300028794 Ga0307515_10020933 Ga0307515_100209332 150
196 3300028794 Ga0307515_10182586 Ga0307515_101825862 150
197 3300028794 Ga0307515_10282278 Ga0307515_102822782 150
198 3300028794 Ga0307515_10356637 Ga0307515_103566371 150
199 3300031344 Ga0265316_10000005 Ga0265316_10000005130 150
200 3300031456 Ga0307513_10209689 Ga0307513_102096892 150
201 3300031456 Ga0307513_10209997 Ga0307513_102099972 150
202 3300031456 Ga0307513_10295747 Ga0307513_102957472 150
203 3300031507 Ga0307509_10021989 Ga0307509_100219894 150
204 3300031507 Ga0307509_10062124 Ga0307509_100621243 150
205 3300031507 Ga0307509_10598427 Ga0307509_105984271 150
206 3300031616 Ga0307508_10000368 Ga0307508_1000036821 150
207 3300031616 Ga0307508_10011417 Ga0307508_100114177 150
208 3300031616 Ga0307508_10014137 Ga0307508_100141374 150
209 3300031649 Ga0307514_10017566 Ga0307514_100175663 150
210 3300031649 Ga0307514_10135668 Ga0307514_101356682 150
211 3300031730 Ga0307516_10070669 Ga0307516_100706693 150
212 3300031730 Ga0307516_10180001 Ga0307516_101800012 150
213 3300031730 Ga0307516_10473961 Ga0307516_104739611 150
214 3300033179 Ga0307507_10036764 Ga0307507_100367642 150
215 3300033179 Ga0307507_10084566 Ga0307507_100845661 150
216 3300035088 Ga0373940_0189349 Ga0373940_0189349_54_518 150
217 3300035114 Ga0373939_0122320 Ga0373939_0122320_161_625 150
218 3300035691 Ga0373931_0048335 Ga0373931_0048335_1105_1569 150
219 3300036401 Ga0373937_0585693 Ga0373937_0585693_259_873 150
220 3300041443 Ga0451789_0124233 Ga0451789_0124233_710_1162 150
221 3300041451 Ga0451791_0808117 Ga0451791_0808117_711_1175 150
222 3300041452 Ga0451793_0014778 Ga0451793_0014778_764_1228 150
223 3300041452 Ga0451793_1263303 Ga0451793_1263303_154_606 150
224 3300041453 Ga0451797_0276331 Ga0451797_0276331_70_531 150
225 3300041453 Ga0451797_0968387 Ga0451797_0968387_525_977 150
226 3300041456 Ga0451795_0246322 Ga0451795_0246322_251_703 150
227 3300041458 Ga0451798_0403471 Ga0451798_0403471_277_729 150
228 3300041459 Ga0451800_0506324 Ga0451800_0506324_639_1091 150
229 3300041459 Ga0451800_0740856 Ga0451800_0740856_615_1079 150
230 3300041460 Ga0451802_0493372 Ga0451802_0493372_803_1267 150
231 3300041460 Ga0451802_0600920 Ga0451802_0600920_425_877 150
232 3300041461 Ga0451805_013476 Ga0451805_013476_224_688 150
233 3300041463 Ga0451804_0030771 Ga0451804_0030771_82_534 150
234 3300041498 Ga0451841_1368528 Ga0451841_1368528_1006_1470 150
235 3300041505 Ga0451849_0680273 Ga0451849_0680273_479_943 150
236 3300041509 Ga0451843_0827713 Ga0451843_0827713_85_549 150
237 3300041512 Ga0451853_1179119 Ga0451853_1179119_64_516 150
238 3300045051 Ga0451576_1350950 Ga0451576_1350950_153_626 150
239 3300046457 Ga0495590_0123725 Ga0495590_0123725_424_885 150
240 3300046459 Ga0495629_0622456 Ga0495629_0622456_36_500 150
241 3300046460 Ga0495638_0055615 Ga0495638_0055615_1459_1911 150
242 3300046471 Ga0495650_0006891 Ga0495650_0006891_4767_5234 150
243 3300046474 Ga0495605_0032527 Ga0495605_0032527_1793_2254 150
244 3300046475 Ga0495639_0407970 Ga0495639_0407970_202_666 150
245 3300046507 Ga0495606_0069303 Ga0495606_0069303_1104_1556 150
246 3300046512 Ga0495610_0037135 Ga0495610_0037135_1006_1470 150
247 3300046512 Ga0495610_0230843 Ga0495610_0230843_23_484 150
248 3300046517 Ga0495630_0121698 Ga0495630_0121698_1200_1664 150
249 3300046519 Ga0495632_0033075 Ga0495632_0033075_1415_1876 150
250 3300046519 Ga0495632_0037075 Ga0495632_0037075_1426_1881 150
251 3300046519 Ga0495632_0101648 Ga0495632_0101648_551_1015 150
252 3300046519 Ga0495632_0219412 Ga0495632_0219412_332_784 150
253 3300046520 Ga0495637_0292539 Ga0495637_0292539_28_480 150
254 3300046522 Ga0495643_0022777 Ga0495643_0022777_3073_3537 150
255 3300046542 Ga0495597_0128637 Ga0495597_0128637_166_627 150
256 3300046616 Ga0495668_0811698 Ga0495668_0811698_54_506 150
257 3300046660 Ga0495625_0002284 Ga0495625_0002284_14196_14660 150
258 3300046660 Ga0495625_0294959 Ga0495625_0294959_540_995 150
259 3300046660 Ga0495625_0377055 Ga0495625_0377055_172_624 150
260 3300046679 Ga0495623_0642049 Ga0495623_0642049_36_500 150
261 3300046683 Ga0495658_0165801 Ga0495658_0165801_589_1053 150
262 3300046690 Ga0495624_0088876 Ga0495624_0088876_1409_1873 150
263 3300046692 Ga0495671_0503034 Ga0495671_0503034_39_500 150
264 3300046694 Ga0495649_0271598 Ga0495649_0271598_381_842 150
265 3300046810 Ga0495660_0007305 Ga0495660_0007305_6020_6481 150
266 3300047318 Ga0495636_0538869 Ga0495636_0538869_81_542 150
267 3300047321 Ga0495676_0054642 Ga0495676_0054642_752_1216 150
268 3300047443 Ga0495687_006585 Ga0495687_006585_4789_5250 150
269 3300049576 Ga0501040_0331675 Ga0501040_0331675_498_962 150
270 3300049577 Ga0501041_0166031 Ga0501041_0166031_31_495 150
271 3300049580 Ga0501046_0422983 Ga0501046_0422983_196_660 150
272 3300049587 Ga0501071_0241153 Ga0501071_0241153_714_1178 150
273 3300049591 Ga0501075_0028249 Ga0501075_0028249_30_494 150
274 3300049592 Ga0501076_0072722 Ga0501076_0072722_1066_1530 150
275 3300049743 Ga0501081_0371875 Ga0501081_0371875_434_898 150
276 3300049824 Ga0501045_0397648 Ga0501045_0397648_271_735 150
277 3300050489 nmdc:mga03683_47196_c1 nmdc:mga03683_47196_c1_518_979 150
278 3300050489 nmdc:mga03683_7808_c1 nmdc:mga03683_7808_c1_287_748 150
279 3300050490 nmdc:mga03n38_181087_c1 nmdc:mga03n38_181087_c1_141_602 150
280 3300050491 nmdc:mga00v17_844939_c1 nmdc:mga00v17_844939_c1_24_485 150
281 3300050492 nmdc:mga0yw44_99354_c1 nmdc:mga0yw44_99354_c1_380_841 150
282 3300050493 nmdc:mga0k408_79803_c2 nmdc:mga0k408_79803_c2_638_1099 150
283 3300050493 nmdc:mga0k408_97968_c1 nmdc:mga0k408_97968_c1_977_1438 150
284 3300050494 nmdc:mga06z11_111720_c1 nmdc:mga06z11_111720_c1_70_531 150
285 3300050494 nmdc:mga06z11_578404_c1 nmdc:mga06z11_578404_c1_160_624 150
286 3300050495 nmdc:mga04h51_424031_c1 nmdc:mga04h51_424031_c1_16_480 150
287 3300050495 nmdc:mga04h51_67510_c1 nmdc:mga04h51_67510_c1_734_1195 150
288 3300050496 nmdc:mga07m45_46580_c1 nmdc:mga07m45_46580_c1_708_1169 150
289 3300050496 nmdc:mga07m45_65673_c1 nmdc:mga07m45_65673_c1_726_1253 150
290 3300050496 nmdc:mga07m45_93110_c1 nmdc:mga07m45_93110_c1_977_1438 150
291 3300050516 nmdc:mga0sz30_22293_c1 nmdc:mga0sz30_22293_c1_673_1134 150
292 3300050516 nmdc:mga0sz30_69708_c1 nmdc:mga0sz30_69708_c1_175_636 150
293 3300053086 Ga0500578_0013820 Ga0500578_0013820_4283_4804 150
294 3300053088 Ga0500644_0027200 Ga0500644_0027200_324_776 150
295 3300053090 Ga0500646_0048331 Ga0500646_0048331_325_777 150
296 3300053092 Ga0500583_0373350 Ga0500583_0373350_70_525 150
297 3300053093 Ga0500651_0017219 Ga0500651_0017219_3660_4112 150
298 3300053093 Ga0500651_0469825 Ga0500651_0469825_177_641 150
299 3300053093 Ga0500651_0668129 Ga0500651_0668129_23_484 150
300 3300053098 Ga0500650_0051228 Ga0500650_0051228_1147_1599 150
301 3300053127 Ga0500623_092226 Ga0500623_092226_658_1110 150
302 3300053129 Ga0500628_006860 Ga0500628_006860_325_777 150
303 3300053130 Ga0500642_0132288 Ga0500642_0132288_399_851 150
304 3300053131 Ga0500652_004014 Ga0500652_004014_398_850 150
305 3300053134 Ga0500658_0010582 Ga0500658_0010582_303_767 150
306 3300053137 Ga0500561_0046868 Ga0500561_0046868_501_953 150
307 3300053139 Ga0500568_0072711 Ga0500568_0072711_546_998 150
308 3300053151 Ga0500604_0028316 Ga0500604_0028316_601_1053 150
309 3300053156 Ga0500622_0000221 Ga0500622_0000221_650_1102 150
310 3300053156 Ga0500622_0126051 Ga0500622_0126051_323_775 150
311 3300053730 Ga0500645_006448 Ga0500645_006448_1108_1629 150
312 3300053730 Ga0500645_118154 Ga0500645_118154_278_730 150
313 3300053739 Ga0500587_003848 Ga0500587_003848_986_1450 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08269

dCache_2

Cache domain

76

169

0.86

PF17200

sCache_2

Single Cache domain 2

33

175

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7g-assembly2.cif.gz_C crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 0.8386 130 150
3g7g-assembly2.cif.gz_G crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 0.8123 130 150
2qhk-assembly1.cif.gz_A crystal structure of methyl-accepting chemotaxis protein from vibrio parahaemolyticus rimd 2210633 0.8069 28 149
4tx4-assembly1.cif.gz_B crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata) 0.7983 114 140
8sj5-assembly2.cif.gz_D walnut tree phytocystatin 0.7947 114 139
ID Description Score Start End Superfamily
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.8123 130 150 2.40.160.20
af_P47107_10_380_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7935 115 138 2.130.10.10
af_Q4DBW5_237_558_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7556 114 138 1.10.510.10
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7534 113 137 3.40.50.1820
af_O02219_282_409_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7533 64 150 3.30.450.20
ID Description Score Start End GO Terms
AF-A4G167-F1-model_v4 Methyl-accepting chemotaxis protein 0.9837 21 150 GO:0004888
GO:0005886
GO:0006935
GO:0007165
AF-A0A4R3HX83-F1-model_v4 Methyl-accepting chemotaxis protein 0.981 24 150 GO:0004888
GO:0005886
GO:0006935
GO:0007165
AF-A0A3A6NX35-F1-model_v4 HAMP domain-containing protein 0.9796 20 150 GO:0004888
GO:0005886
GO:0006935
GO:0007165
AF-A0A4Y9RLS2-F1-model_v4 HAMP domain-containing protein 0.9755 26 150 GO:0004888
GO:0005886
GO:0006935
GO:0007165
AF-A0A2G1YHS0-F1-model_v4 Histidine kinase 0.9753 34 150 GO:0005886
GO:0016301

Feature Viewer

pLDDT pTM Quality
90.23 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map