F402170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 201 | 309 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300011119|Ga0105246_10244516|Ga0105246_102445162 |
| Length | 175 |
| Sequence | MDDFQPDAPTVRRGVRIRPETTHMTNHILAKAVLAACIMTLAGGARADNATSAEATAMVKKGVAFIKANGKDKGYAEISNKTGQFNDRDLYLTVYGLDGTVRAHGANEKMIGKNLIELKDVDGKAFVKERVELGASKGTFWQDYKFTNPVSKKIEPKSMYCERLDDAVVCGGIYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 3 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 4 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 5 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 19 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 95 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 96 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 121 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 123 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 124 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 125 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 162 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 163 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 174 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 185 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 187 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 188 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 189 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 190 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 191 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 193 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 194 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 195 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 198 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 199 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 200 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 0.64 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.09 |
| Nodule | 0 |
| Rhizoplane | 7.67 |
| Rhizosphere | 58.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055528_1032522 | 3300003790 | Bacteria | 1328 |
| 2 | Ga0055530_10065963 | 3300003791 | Bacteria | 793 |
| 3 | Ga0065165_1009224 | 3300005262 | Bacteria | 4462 |
| 4 | Ga0070676_10003760 | 3300005328 | Bacteria | 7957 |
| 5 | Ga0068868_100054263 | 3300005338 | Bacteria | 3158 |
| 6 | Ga0070668_100287172 | 3300005347 | Unclassified | 1376 |
| 7 | Ga0070668_100414121 | 3300005347 | Bacteria | 1153 |
| 8 | Ga0070671_100412812 | 3300005355 | Bacteria | 1156 |
| 9 | Ga0070674_101179655 | 3300005356 | Unclassified | 679 |
| 10 | Ga0070667_100228513 | 3300005367 | Bacteria | 1658 |
| 11 | Ga0070667_100438156 | 3300005367 | Bacteria | 1193 |
| 12 | Ga0070706_100060273 | 3300005467 | Bacteria | 3503 |
| 13 | Ga0068853_100183812 | 3300005539 | Unclassified | 1897 |
| 14 | Ga0068853_100221120 | 3300005539 | Bacteria | 1729 |
| 15 | Ga0070695_100166360 | 3300005545 | Bacteria | 1552 |
| 16 | Ga0070696_100435045 | 3300005546 | Unclassified | 1032 |
| 17 | Ga0068854_100393852 | 3300005578 | Bacteria | 1144 |
| 18 | Ga0070702_100439775 | 3300005615 | Bacteria | 943 |
| 19 | Ga0068852_100115320 | 3300005616 | Bacteria | 2449 |
| 20 | Ga0068852_101605293 | 3300005616 | Bacteria | 673 |
| 21 | Ga0068859_100311625 | 3300005617 | Bacteria | 1667 |
| 22 | Ga0068859_100726793 | 3300005617 | Bacteria | 1083 |
| 23 | Ga0068864_100251995 | 3300005618 | Bacteria | 1639 |
| 24 | Ga0068864_101000233 | 3300005618 | Bacteria | 829 |
| 25 | Ga0068870_10098345 | 3300005840 | Bacteria | 1648 |
| 26 | Ga0068863_100258723 | 3300005841 | Bacteria | 1682 |
| 27 | Ga0068863_100263023 | 3300005841 | Bacteria | 1668 |
| 28 | Ga0068863_100341775 | 3300005841 | Bacteria | 1456 |
| 29 | Ga0068863_100566129 | 3300005841 | Bacteria | 1123 |
| 30 | Ga0068863_101557457 | 3300005841 | Bacteria | 670 |
| 31 | Ga0068860_100177501 | 3300005843 | Bacteria | 2058 |
| 32 | Ga0068860_100218021 | 3300005843 | Bacteria | 1852 |
| 33 | Ga0075365_10191818 | 3300006038 | Bacteria | 1430 |
| 34 | Ga0075368_10034165 | 3300006042 | Bacteria | 1980 |
| 35 | Ga0075364_10178675 | 3300006051 | Bacteria | 1436 |
| 36 | Ga0075432_10037592 | 3300006058 | Unclassified | 1686 |
| 37 | Ga0075432_10063496 | 3300006058 | Bacteria | 1318 |
| 38 | Ga0070715_10126669 | 3300006163 | Unclassified | 1224 |
| 39 | Ga0075362_10029907 | 3300006177 | Bacteria | 2350 |
| 40 | Ga0075362_10030177 | 3300006177 | Bacteria | 2340 |
| 41 | Ga0075362_10066757 | 3300006177 | Bacteria | 1635 |
| 42 | Ga0075367_10096385 | 3300006178 | Bacteria | 1804 |
| 43 | Ga0075366_10076629 | 3300006195 | Bacteria | 1996 |
| 44 | Ga0075366_10095391 | 3300006195 | Bacteria | 1783 |
| 45 | Ga0075366_10128031 | 3300006195 | Bacteria | 1532 |
| 46 | Ga0075366_10134233 | 3300006195 | Bacteria | 1494 |
| 47 | Ga0075370_10048336 | 3300006353 | Bacteria | 2410 |
| 48 | Ga0075370_10061738 | 3300006353 | Bacteria | 2135 |
| 49 | Ga0075370_10074734 | 3300006353 | Bacteria | 1942 |
| 50 | Ga0075370_10084493 | 3300006353 | Bacteria | 1827 |
| 51 | Ga0075370_10105264 | 3300006353 | Bacteria | 1635 |
| 52 | Ga0068871_100841599 | 3300006358 | Bacteria | 848 |
| 53 | Ga0075433_10207104 | 3300006852 | Bacteria | 1744 |
| 54 | Ga0097620_100311615 | 3300006931 | Bacteria | 1667 |
| 55 | Ga0097620_100535654 | 3300006931 | Bacteria | 1266 |
| 56 | Ga0097620_100726724 | 3300006931 | Bacteria | 1083 |
| 57 | Ga0105240_10002209 | 3300009093 | Bacteria | 31729 |
| 58 | Ga0105240_11899938 | 3300009093 | Bacteria | 619 |
| 59 | Ga0111539_11966137 | 3300009094 | Bacteria | 678 |
| 60 | Ga0105245_10201956 | 3300009098 | Bacteria | 1909 |
| 61 | Ga0105245_10322990 | 3300009098 | Bacteria | 1521 |
| 62 | Ga0105245_10487688 | 3300009098 | Bacteria | 1246 |
| 63 | Ga0114129_12372362 | 3300009147 | Bacteria | 636 |
| 64 | Ga0105243_10643675 | 3300009148 | Unclassified | 1026 |
| 65 | Ga0105248_12079073 | 3300009177 | Bacteria | 646 |
| 66 | Ga0105237_10157912 | 3300009545 | Bacteria | 2265 |
| 67 | Ga0105238_10026216 | 3300009551 | Bacteria | 5940 |
| 68 | Ga0105239_10000677 | 3300010375 | Bacteria | 48572 |
| 69 | Ga0105239_11585310 | 3300010375 | Bacteria | 757 |
| 70 | Ga0105246_10244516 | 3300011119 | Bacteria | 1420 |
| 71 | Ga0157369_10491327 | 3300013105 | Bacteria | 1270 |
| 72 | Ga0157374_10397694 | 3300013296 | Unclassified | 1374 |
| 73 | Ga0163162_10334189 | 3300013306 | Bacteria | 1647 |
| 74 | Ga0157375_10211931 | 3300013308 | Bacteria | 2095 |
| 75 | Ga0157375_10410497 | 3300013308 | Bacteria | 1520 |
| 76 | Ga0157375_10471967 | 3300013308 | Bacteria | 1420 |
| 77 | Ga0163163_10189973 | 3300014325 | Bacteria | 2102 |
| 78 | Ga0157379_11139316 | 3300014968 | Bacteria | 748 |
| 79 | Ga0157376_10409610 | 3300014969 | Unclassified | 1313 |
| 80 | Ga0157376_11810215 | 3300014969 | Bacteria | 647 |
| 81 | Ga0163161_10228633 | 3300017792 | Bacteria | 1443 |
| 82 | Ga0209673_1013853 | 3300025273 | Bacteria | 3159 |
| 83 | Ga0209050_1004917 | 3300025298 | Bacteria | 8735 |
| 84 | Ga0209050_1021838 | 3300025298 | Bacteria | 2315 |
| 85 | Ga0209051_1004360 | 3300025303 | Bacteria | 8761 |
| 86 | Ga0209051_1015013 | 3300025303 | Bacteria | 3586 |
| 87 | Ga0207642_10216943 | 3300025899 | Unclassified | 1067 |
| 88 | Ga0207680_10260993 | 3300025903 | Bacteria | 1199 |
| 89 | Ga0207685_10167691 | 3300025905 | Unclassified | 1008 |
| 90 | Ga0207645_10033411 | 3300025907 | Bacteria | 3306 |
| 91 | Ga0207643_10054855 | 3300025908 | Bacteria | 2266 |
| 92 | Ga0207684_10068763 | 3300025910 | Bacteria | 3010 |
| 93 | Ga0207695_10051136 | 3300025913 | Bacteria | 4341 |
| 94 | Ga0207695_10230543 | 3300025913 | Bacteria | 1757 |
| 95 | Ga0207671_10093679 | 3300025914 | Bacteria | 2266 |
| 96 | Ga0207657_10416652 | 3300025919 | Unclassified | 1056 |
| 97 | Ga0207694_10086197 | 3300025924 | Unclassified | 2473 |
| 98 | Ga0207650_10885034 | 3300025925 | Bacteria | 758 |
| 99 | Ga0207650_11162756 | 3300025925 | Bacteria | 657 |
| 100 | Ga0207650_11352980 | 3300025925 | Bacteria | 606 |
| 101 | Ga0207659_10404635 | 3300025926 | Bacteria | 1142 |
| 102 | Ga0207687_10278805 | 3300025927 | Bacteria | 1339 |
| 103 | Ga0207687_10500941 | 3300025927 | Bacteria | 1014 |
| 104 | Ga0207644_10156396 | 3300025931 | Bacteria | 1768 |
| 105 | Ga0207644_10452825 | 3300025931 | Bacteria | 1054 |
| 106 | Ga0207709_10071016 | 3300025935 | Bacteria | 2209 |
| 107 | Ga0207689_10021076 | 3300025942 | Bacteria | 5478 |
| 108 | Ga0207689_10305960 | 3300025942 | Bacteria | 1318 |
| 109 | Ga0207651_10411669 | 3300025960 | Bacteria | 1152 |
| 110 | Ga0207651_10511548 | 3300025960 | Bacteria | 1039 |
| 111 | Ga0207668_10360636 | 3300025972 | Bacteria | 1218 |
| 112 | Ga0207640_10161115 | 3300025981 | Bacteria | 1660 |
| 113 | Ga0207640_10340912 | 3300025981 | Bacteria | 1200 |
| 114 | Ga0207658_10200546 | 3300025986 | Bacteria | 1665 |
| 115 | Ga0207658_10397694 | 3300025986 | Bacteria | 1210 |
| 116 | Ga0207677_10123284 | 3300026023 | Bacteria | 1954 |
| 117 | Ga0207703_11017895 | 3300026035 | Bacteria | 795 |
| 118 | Ga0207639_10061365 | 3300026041 | Unclassified | 2903 |
| 119 | Ga0207639_10158944 | 3300026041 | Bacteria | 1902 |
| 120 | Ga0207641_10057585 | 3300026088 | Bacteria | 3305 |
| 121 | Ga0207641_10686161 | 3300026088 | Bacteria | 1008 |
| 122 | Ga0207641_11247793 | 3300026088 | Unclassified | 743 |
| 123 | Ga0207641_12349234 | 3300026088 | Bacteria | 532 |
| 124 | Ga0207676_10336776 | 3300026095 | Bacteria | 1390 |
| 125 | Ga0207676_10516276 | 3300026095 | Bacteria | 1137 |
| 126 | Ga0207674_10009995 | 3300026116 | Bacteria | 10799 |
| 127 | Ga0207674_10582067 | 3300026116 | Bacteria | 1081 |
| 128 | Ga0207674_11231875 | 3300026116 | Unclassified | 718 |
| 129 | Ga0207675_100579815 | 3300026118 | Bacteria | 1123 |
| 130 | Ga0207683_10105677 | 3300026121 | Bacteria | 2517 |
| 131 | Ga0207683_10159179 | 3300026121 | Bacteria | 2041 |
| 132 | Ga0207698_11441392 | 3300026142 | Bacteria | 704 |
| 133 | Ga0209995_1054587 | 3300027471 | Bacteria | 679 |
| 134 | Ga0209813_10180988 | 3300027866 | Bacteria | 771 |
| 135 | Ga0207428_10272139 | 3300027907 | Bacteria | 1259 |
| 136 | Ga0268266_10603978 | 3300028379 | Unclassified | 1054 |
| 137 | Ga0268264_10124207 | 3300028381 | Bacteria | 2279 |
| 138 | Ga0268264_10376219 | 3300028381 | Bacteria | 1359 |
| 139 | Ga0268264_12092396 | 3300028381 | Bacteria | 575 |
| 140 | Ga0265318_10148583 | 3300028577 | Unclassified | 860 |
| 141 | Ga0307517_10001591 | 3300028786 | Bacteria | 37812 |
| 142 | Ga0307517_10167178 | 3300028786 | Bacteria | 1457 |
| 143 | Ga0307517_10209361 | 3300028786 | Bacteria | 1204 |
| 144 | Ga0307515_10000103 | 3300028794 | Bacteria | 198308 |
| 145 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 146 | Ga0307515_10010735 | 3300028794 | Bacteria | 17494 |
| 147 | Ga0307515_10020933 | 3300028794 | Bacteria | 11625 |
| 148 | Ga0307515_10096625 | 3300028794 | Bacteria | 3621 |
| 149 | Ga0307515_10182586 | 3300028794 | Bacteria | 2041 |
| 150 | Ga0307515_10282278 | 3300028794 | Bacteria | 1366 |
| 151 | Ga0307515_10356637 | 3300028794 | Bacteria | 1106 |
| 152 | Ga0265316_10000005 | 3300031344 | Bacteria | 304442 |
| 153 | Ga0307513_10209689 | 3300031456 | Bacteria | 1781 |
| 154 | Ga0307513_10209997 | 3300031456 | Bacteria | 1779 |
| 155 | Ga0307513_10295747 | 3300031456 | Bacteria | 1388 |
| 156 | Ga0307509_10021989 | 3300031507 | Bacteria | 7200 |
| 157 | Ga0307509_10062124 | 3300031507 | Bacteria | 3940 |
| 158 | Ga0307509_10094299 | 3300031507 | Bacteria | 3052 |
| 159 | Ga0307509_10292619 | 3300031507 | Bacteria | 1382 |
| 160 | Ga0307509_10598427 | 3300031507 | Bacteria | 775 |
| 161 | Ga0307408_100320303 | 3300031548 | Bacteria | 1306 |
| 162 | Ga0307508_10000368 | 3300031616 | Bacteria | 54659 |
| 163 | Ga0307508_10011417 | 3300031616 | Bacteria | 8120 |
| 164 | Ga0307508_10014137 | 3300031616 | Bacteria | 7283 |
| 165 | Ga0307514_10001565 | 3300031649 | Bacteria | 27095 |
| 166 | Ga0307514_10017566 | 3300031649 | Bacteria | 5882 |
| 167 | Ga0307514_10135668 | 3300031649 | Bacteria | 1685 |
| 168 | Ga0307516_10070669 | 3300031730 | Bacteria | 3354 |
| 169 | Ga0307516_10180001 | 3300031730 | Bacteria | 1848 |
| 170 | Ga0307516_10473961 | 3300031730 | Bacteria | 907 |
| 171 | Ga0307405_10293342 | 3300031731 | Bacteria | 1230 |
| 172 | Ga0307410_10392643 | 3300031852 | Bacteria | 1119 |
| 173 | Ga0307507_10036764 | 3300033179 | Bacteria | 4998 |
| 174 | Ga0307507_10084566 | 3300033179 | Bacteria | 2764 |
| 175 | Ga0307510_10232874 | 3300033180 | Bacteria | 1343 |
| 176 | Ga0373940_0189349 | 3300035088 | Bacteria | 672 |
| 177 | Ga0373939_0122320 | 3300035114 | Bacteria | 919 |
| 178 | Ga0373931_0048335 | 3300035691 | Bacteria | 2255 |
| 179 | Ga0373937_0272712 | 3300036401 | Bacteria | 1597 |
| 180 | Ga0373937_0585693 | 3300036401 | Bacteria | 1059 |
| 181 | Ga0373925_0592293 | 3300037068 | Bacteria | 913 |
| 182 | Ga0451789_0124233 | 3300041443 | Bacteria | 1513 |
| 183 | Ga0451791_0808117 | 3300041451 | Bacteria | 1521 |
| 184 | Ga0451793_0014778 | 3300041452 | Bacteria | 2476 |
| 185 | Ga0451793_0462623 | 3300041452 | Bacteria | 592 |
| 186 | Ga0451793_1263303 | 3300041452 | Bacteria | 1225 |
| 187 | Ga0451797_0276331 | 3300041453 | Bacteria | 569 |
| 188 | Ga0451797_0968387 | 3300041453 | Bacteria | 1128 |
| 189 | Ga0451795_0246322 | 3300041456 | Bacteria | 891 |
| 190 | Ga0451798_0403471 | 3300041458 | Bacteria | 928 |
| 191 | Ga0451800_0506324 | 3300041459 | Bacteria | 2840 |
| 192 | Ga0451800_0740856 | 3300041459 | Bacteria | 1660 |
| 193 | Ga0451802_0493372 | 3300041460 | Bacteria | 2338 |
| 194 | Ga0451802_0600920 | 3300041460 | Bacteria | 4126 |
| 195 | Ga0451805_013476 | 3300041461 | Bacteria | 747 |
| 196 | Ga0451804_0030771 | 3300041463 | Bacteria | 1182 |
| 197 | Ga0451841_1368528 | 3300041498 | Bacteria | 1634 |
| 198 | Ga0451849_0680273 | 3300041505 | Bacteria | 2032 |
| 199 | Ga0451843_0827713 | 3300041509 | Bacteria | 656 |
| 200 | Ga0451853_1179119 | 3300041512 | Bacteria | 796 |
| 201 | Ga0451577_0001547 | 3300042876 | Bacteria | 30192 |
| 202 | Ga0451577_0249832 | 3300042876 | Bacteria | 1605 |
| 203 | Ga0451577_1419677 | 3300042876 | Unclassified | 615 |
| 204 | Ga0453684_0123821 | 3300044712 | Bacteria | 3116 |
| 205 | Ga0453684_0196612 | 3300044712 | Bacteria | 2354 |
| 206 | Ga0453684_0367750 | 3300044712 | Bacteria | 1617 |
| 207 | Ga0453684_0868683 | 3300044712 | Bacteria | 968 |
| 208 | Ga0451576_0208209 | 3300045051 | Bacteria | 2042 |
| 209 | Ga0451576_1083126 | 3300045051 | Bacteria | 839 |
| 210 | Ga0451576_1350950 | 3300045051 | Bacteria | 742 |
| 211 | Ga0495590_0123725 | 3300046457 | Bacteria | 927 |
| 212 | Ga0495629_0622456 | 3300046459 | Bacteria | 721 |
| 213 | Ga0495638_0055615 | 3300046460 | Bacteria | 2457 |
| 214 | Ga0495650_0006891 | 3300046471 | Bacteria | 6971 |
| 215 | Ga0495605_0032527 | 3300046474 | Bacteria | 2655 |
| 216 | Ga0495639_0407970 | 3300046475 | Bacteria | 687 |
| 217 | Ga0495606_0069303 | 3300046507 | Bacteria | 2228 |
| 218 | Ga0495610_0037135 | 3300046512 | Bacteria | 2482 |
| 219 | Ga0495610_0230843 | 3300046512 | Bacteria | 742 |
| 220 | Ga0495630_0121698 | 3300046517 | Bacteria | 1980 |
| 221 | Ga0495632_0033075 | 3300046519 | Bacteria | 2658 |
| 222 | Ga0495632_0037075 | 3300046519 | Bacteria | 2477 |
| 223 | Ga0495632_0101648 | 3300046519 | Bacteria | 1354 |
| 224 | Ga0495632_0219412 | 3300046519 | Bacteria | 860 |
| 225 | Ga0495637_0292539 | 3300046520 | Bacteria | 579 |
| 226 | Ga0495643_0022777 | 3300046522 | Bacteria | 3568 |
| 227 | Ga0495597_0128637 | 3300046542 | Bacteria | 1051 |
| 228 | Ga0495668_0161761 | 3300046616 | Bacteria | 1226 |
| 229 | Ga0495668_0478157 | 3300046616 | Bacteria | 686 |
| 230 | Ga0495668_0811698 | 3300046616 | Bacteria | 518 |
| 231 | Ga0495625_0002284 | 3300046660 | Bacteria | 21038 |
| 232 | Ga0495625_0294959 | 3300046660 | Bacteria | 1039 |
| 233 | Ga0495625_0377055 | 3300046660 | Bacteria | 891 |
| 234 | Ga0495623_0642049 | 3300046679 | Bacteria | 548 |
| 235 | Ga0495658_0104228 | 3300046683 | Bacteria | 1697 |
| 236 | Ga0495658_0165801 | 3300046683 | Bacteria | 1365 |
| 237 | Ga0495624_0088876 | 3300046690 | Bacteria | 1907 |
| 238 | Ga0495671_0503034 | 3300046692 | Bacteria | 578 |
| 239 | Ga0495649_0271598 | 3300046694 | Bacteria | 867 |
| 240 | Ga0495660_0007305 | 3300046810 | Bacteria | 6494 |
| 241 | Ga0495636_0538869 | 3300047318 | Bacteria | 567 |
| 242 | Ga0495676_0054642 | 3300047321 | Bacteria | 3173 |
| 243 | Ga0495687_006585 | 3300047443 | Bacteria | 7075 |
| 244 | Ga0496102_0013652 | 3300048905 | Bacteria | 7040 |
| 245 | Ga0496103_0082190 | 3300048906 | Bacteria | 2027 |
| 246 | Ga0496104_1640761 | 3300048907 | Bacteria | 545 |
| 247 | Ga0496105_0390210 | 3300048908 | Unclassified | 1107 |
| 248 | Ga0496110_0062142 | 3300048913 | Bacteria | 3298 |
| 249 | Ga0496110_0843592 | 3300048913 | Unclassified | 821 |
| 250 | Ga0496111_0113223 | 3300048914 | Bacteria | 1999 |
| 251 | Ga0496113_0416275 | 3300048916 | Bacteria | 1079 |
| 252 | Ga0496115_0491760 | 3300048918 | Bacteria | 987 |
| 253 | Ga0496121_0007977 | 3300048924 | Bacteria | 12643 |
| 254 | Ga0496124_0133188 | 3300048927 | Bacteria | 1972 |
| 255 | Ga0501310_021938 | 3300049130 | Bacteria | 802 |
| 256 | Ga0501040_0331675 | 3300049576 | Bacteria | 1089 |
| 257 | Ga0501041_0166031 | 3300049577 | Bacteria | 1381 |
| 258 | Ga0501046_0422983 | 3300049580 | Bacteria | 960 |
| 259 | Ga0501071_0241153 | 3300049587 | Bacteria | 1363 |
| 260 | Ga0501075_0028249 | 3300049591 | Bacteria | 4140 |
| 261 | Ga0501076_0072722 | 3300049592 | Bacteria | 2752 |
| 262 | Ga0501081_0371875 | 3300049743 | Bacteria | 1055 |
| 263 | Ga0501045_0397648 | 3300049824 | Bacteria | 1025 |
| 264 | nmdc:mga03683_129057_c1 | 3300050489 | Bacteria | 1130 |
| 265 | nmdc:mga03683_47196_c1 | 3300050489 | Bacteria | 1787 |
| 266 | nmdc:mga03683_7808_c1 | 3300050489 | Bacteria | 3733 |
| 267 | nmdc:mga03n38_181087_c1 | 3300050490 | Bacteria | 1080 |
| 268 | nmdc:mga00v17_844939_c1 | 3300050491 | Bacteria | 582 |
| 269 | nmdc:mga0yw44_99354_c1 | 3300050492 | Bacteria | 1851 |
| 270 | nmdc:mga0k408_79803_c2 | 3300050493 | Bacteria | 1485 |
| 271 | nmdc:mga0k408_97968_c1 | 3300050493 | Bacteria | 1728 |
| 272 | nmdc:mga06z11_111720_c1 | 3300050494 | Bacteria | 1514 |
| 273 | nmdc:mga06z11_578404_c1 | 3300050494 | Bacteria | 683 |
| 274 | nmdc:mga04h51_424031_c1 | 3300050495 | Bacteria | 560 |
| 275 | nmdc:mga04h51_67510_c1 | 3300050495 | Bacteria | 1241 |
| 276 | nmdc:mga07m45_46580_c1 | 3300050496 | Bacteria | 2437 |
| 277 | nmdc:mga07m45_65673_c1 | 3300050496 | Bacteria | 2060 |
| 278 | nmdc:mga07m45_78629_c1 | 3300050496 | Bacteria | 1882 |
| 279 | nmdc:mga07m45_93110_c1 | 3300050496 | Bacteria | 1728 |
| 280 | nmdc:mga05p37_2228903_c1 | 3300050507 | Unclassified | 507 |
| 281 | nmdc:mga05p37_480786_c1 | 3300050507 | Bacteria | 1431 |
| 282 | nmdc:mga0n895_2051932_c1 | 3300050512 | Unclassified | 529 |
| 283 | nmdc:mga0n895_249554_c1 | 3300050512 | Bacteria | 1801 |
| 284 | nmdc:mga0sz30_22293_c1 | 3300050516 | Bacteria | 2570 |
| 285 | nmdc:mga0sz30_69708_c1 | 3300050516 | Bacteria | 1512 |
| 286 | Ga0495601_0396621 | 3300053077 | Bacteria | 895 |
| 287 | Ga0500578_0013820 | 3300053086 | Bacteria | 5197 |
| 288 | Ga0500644_0027200 | 3300053088 | Bacteria | 1777 |
| 289 | Ga0500646_0048331 | 3300053090 | Bacteria | 1219 |
| 290 | Ga0500583_0373350 | 3300053092 | Bacteria | 688 |
| 291 | Ga0500651_0017219 | 3300053093 | Bacteria | 4453 |
| 292 | Ga0500651_0469825 | 3300053093 | Bacteria | 697 |
| 293 | Ga0500651_0668129 | 3300053093 | Bacteria | 558 |
| 294 | Ga0500650_0051228 | 3300053098 | Bacteria | 1917 |
| 295 | Ga0500557_233256 | 3300053105 | Bacteria | 581 |
| 296 | Ga0500623_092226 | 3300053127 | Bacteria | 1409 |
| 297 | Ga0500628_006860 | 3300053129 | Bacteria | 1936 |
| 298 | Ga0500642_0132288 | 3300053130 | Bacteria | 1169 |
| 299 | Ga0500652_004014 | 3300053131 | Bacteria | 4509 |
| 300 | Ga0500658_0010582 | 3300053134 | Bacteria | 3403 |
| 301 | Ga0500561_0046868 | 3300053137 | Bacteria | 1165 |
| 302 | Ga0500568_0055669 | 3300053139 | Bacteria | 1543 |
| 303 | Ga0500568_0072711 | 3300053139 | Bacteria | 1314 |
| 304 | Ga0500604_0028316 | 3300053151 | Bacteria | 1626 |
| 305 | Ga0500622_0000221 | 3300053156 | Bacteria | 59833 |
| 306 | Ga0500622_0126051 | 3300053156 | Bacteria | 1236 |
| 307 | Ga0500645_006448 | 3300053730 | Bacteria | 4189 |
| 308 | Ga0500645_118154 | 3300053730 | Bacteria | 741 |
| 309 | Ga0500587_003848 | 3300053739 | Bacteria | 2083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0196612 | Ga0453684_0196612_1266_1736 | 134 |
| 2 | 3300025298 | Ga0209050_1021838 | Ga0209050_10218382 | 139 |
| 3 | 3300050507 | nmdc:mga05p37_2228903_c1 | nmdc:mga05p37_2228903_c1_53_481 | 139 |
| 4 | 3300048907 | Ga0496104_1640761 | Ga0496104_1640761_29_463 | 140 |
| 5 | 3300048913 | Ga0496110_0843592 | Ga0496110_0843592_125_556 | 140 |
| 6 | 3300050512 | nmdc:mga0n895_2051932_c1 | nmdc:mga0n895_2051932_c1_72_506 | 140 |
| 7 | 3300005467 | Ga0070706_100060273 | Ga0070706_1000602733 | 141 |
| 8 | 3300025910 | Ga0207684_10068763 | Ga0207684_100687633 | 141 |
| 9 | 3300026121 | Ga0207683_10159179 | Ga0207683_101591792 | 141 |
| 10 | 3300042876 | Ga0451577_0249832 | Ga0451577_0249832_424_879 | 141 |
| 11 | 3300044712 | Ga0453684_0367750 | Ga0453684_0367750_131_586 | 141 |
| 12 | 3300046616 | Ga0495668_0161761 | Ga0495668_0161761_388_849 | 141 |
| 13 | 3300050489 | nmdc:mga03683_129057_c1 | nmdc:mga03683_129057_c1_99_560 | 141 |
| 14 | 3300053139 | Ga0500568_0055669 | Ga0500568_0055669_980_1441 | 141 |
| 15 | 3300005617 | Ga0068859_100726793 | Ga0068859_1007267931 | 142 |
| 16 | 3300006931 | Ga0097620_100726724 | Ga0097620_1007267241 | 142 |
| 17 | 3300026088 | Ga0207641_10686161 | Ga0207641_106861611 | 142 |
| 18 | 3300028794 | Ga0307515_10000103 | Ga0307515_1000010381 | 142 |
| 19 | 3300005367 | Ga0070667_100438156 | Ga0070667_1004381562 | 144 |
| 20 | 3300005616 | Ga0068852_101605293 | Ga0068852_1016052931 | 144 |
| 21 | 3300005617 | Ga0068859_100311625 | Ga0068859_1003116252 | 144 |
| 22 | 3300005618 | Ga0068864_100251995 | Ga0068864_1002519952 | 144 |
| 23 | 3300005841 | Ga0068863_100258723 | Ga0068863_1002587232 | 144 |
| 24 | 3300006358 | Ga0068871_100841599 | Ga0068871_1008415992 | 144 |
| 25 | 3300006931 | Ga0097620_100311615 | Ga0097620_1003116152 | 144 |
| 26 | 3300009098 | Ga0105245_10201956 | Ga0105245_102019562 | 144 |
| 27 | 3300013308 | Ga0157375_10410497 | Ga0157375_104104972 | 144 |
| 28 | 3300014325 | Ga0163163_10189973 | Ga0163163_101899732 | 144 |
| 29 | 3300025903 | Ga0207680_10260993 | Ga0207680_102609932 | 144 |
| 30 | 3300025925 | Ga0207650_10885034 | Ga0207650_108850342 | 144 |
| 31 | 3300025927 | Ga0207687_10500941 | Ga0207687_105009412 | 144 |
| 32 | 3300025931 | Ga0207644_10452825 | Ga0207644_104528252 | 144 |
| 33 | 3300025935 | Ga0207709_10071016 | Ga0207709_100710162 | 144 |
| 34 | 3300025942 | Ga0207689_10305960 | Ga0207689_103059602 | 144 |
| 35 | 3300025986 | Ga0207658_10397694 | Ga0207658_103976941 | 144 |
| 36 | 3300026023 | Ga0207677_10123284 | Ga0207677_101232842 | 144 |
| 37 | 3300026088 | Ga0207641_10057585 | Ga0207641_100575852 | 144 |
| 38 | 3300026095 | Ga0207676_10336776 | Ga0207676_103367762 | 144 |
| 39 | 3300026142 | Ga0207698_11441392 | Ga0207698_114413922 | 144 |
| 40 | 3300028381 | Ga0268264_10376219 | Ga0268264_103762192 | 144 |
| 41 | 3300031507 | Ga0307509_10094299 | Ga0307509_100942992 | 144 |
| 42 | 3300033180 | Ga0307510_10232874 | Ga0307510_102328742 | 144 |
| 43 | 3300046616 | Ga0495668_0478157 | Ga0495668_0478157_214_675 | 144 |
| 44 | 3300005539 | Ga0068853_100183812 | Ga0068853_1001838122 | 145 |
| 45 | 3300005616 | Ga0068852_100115320 | Ga0068852_1001153202 | 145 |
| 46 | 3300009093 | Ga0105240_10002209 | Ga0105240_1000220923 | 145 |
| 47 | 3300009551 | Ga0105238_10026216 | Ga0105238_100262163 | 145 |
| 48 | 3300010375 | Ga0105239_10000677 | Ga0105239_100006775 | 145 |
| 49 | 3300025913 | Ga0207695_10051136 | Ga0207695_100511365 | 145 |
| 50 | 3300025924 | Ga0207694_10086197 | Ga0207694_100861972 | 145 |
| 51 | 3300026041 | Ga0207639_10061365 | Ga0207639_100613654 | 145 |
| 52 | 3300028379 | Ga0268266_10603978 | Ga0268266_106039781 | 145 |
| 53 | 3300042876 | Ga0451577_1419677 | Ga0451577_1419677_48_512 | 145 |
| 54 | 3300044712 | Ga0453684_0123821 | Ga0453684_0123821_134_595 | 145 |
| 55 | 3300045051 | Ga0451576_0208209 | Ga0451576_0208209_1469_1945 | 145 |
| 56 | 3300005615 | Ga0070702_100439775 | Ga0070702_1004397751 | 146 |
| 57 | 3300005841 | Ga0068863_100341775 | Ga0068863_1003417752 | 146 |
| 58 | 3300006353 | Ga0075370_10084493 | Ga0075370_100844932 | 146 |
| 59 | 3300014969 | Ga0157376_11810215 | Ga0157376_118102151 | 146 |
| 60 | 3300026088 | Ga0207641_11247793 | Ga0207641_112477931 | 146 |
| 61 | 3300028577 | Ga0265318_10148583 | Ga0265318_101485831 | 146 |
| 62 | 3300028794 | Ga0307515_10096625 | Ga0307515_100966252 | 146 |
| 63 | 3300031548 | Ga0307408_100320303 | Ga0307408_1003203031 | 146 |
| 64 | 3300031649 | Ga0307514_10001565 | Ga0307514_1000156524 | 146 |
| 65 | 3300031731 | Ga0307405_10293342 | Ga0307405_102933422 | 146 |
| 66 | 3300031852 | Ga0307410_10392643 | Ga0307410_103926432 | 146 |
| 67 | 3300036401 | Ga0373937_0272712 | Ga0373937_0272712_901_1353 | 146 |
| 68 | 3300037068 | Ga0373925_0592293 | Ga0373925_0592293_424_876 | 146 |
| 69 | 3300042876 | Ga0451577_0001547 | Ga0451577_0001547_3938_4402 | 146 |
| 70 | 3300044712 | Ga0453684_0868683 | Ga0453684_0868683_323_787 | 146 |
| 71 | 3300048913 | Ga0496110_0062142 | Ga0496110_0062142_2673_3134 | 146 |
| 72 | 3300048916 | Ga0496113_0416275 | Ga0496113_0416275_613_1065 | 146 |
| 73 | 3300048924 | Ga0496121_0007977 | Ga0496121_0007977_8166_8630 | 146 |
| 74 | 3300048927 | Ga0496124_0133188 | Ga0496124_0133188_1324_1791 | 146 |
| 75 | 3300049130 | Ga0501310_021938 | Ga0501310_021938_120_572 | 146 |
| 76 | 3300050496 | nmdc:mga07m45_78629_c1 | nmdc:mga07m45_78629_c1_329_781 | 146 |
| 77 | 3300050512 | nmdc:mga0n895_249554_c1 | nmdc:mga0n895_249554_c1_768_1235 | 146 |
| 78 | 3300053077 | Ga0495601_0396621 | Ga0495601_0396621_184_636 | 146 |
| 79 | 3300053105 | Ga0500557_233256 | Ga0500557_233256_36_494 | 146 |
| 80 | iso_pu_bacteria | 2585428062 | 2587756141 | 146 |
| 81 | iso_pu_bacteria | 2643221592 | 2643966922 | 146 |
| 82 | iso_pu_bacteria | 2643221625 | 2644142710 | 146 |
| 83 | iso_pu_bacteria | 2643221648 | 2644273618 | 146 |
| 84 | 3300005841 | Ga0068863_100566129 | Ga0068863_1005661291 | 147 |
| 85 | 3300005843 | Ga0068860_100218021 | Ga0068860_1002180213 | 147 |
| 86 | 3300009148 | Ga0105243_10643675 | Ga0105243_106436752 | 147 |
| 87 | 3300009177 | Ga0105248_12079073 | Ga0105248_120790732 | 147 |
| 88 | 3300014968 | Ga0157379_11139316 | Ga0157379_111393162 | 147 |
| 89 | 3300025905 | Ga0207685_10167691 | Ga0207685_101676912 | 147 |
| 90 | 3300026088 | Ga0207641_12349234 | Ga0207641_123492341 | 147 |
| 91 | 3300026116 | Ga0207674_11231875 | Ga0207674_112318751 | 147 |
| 92 | 3300028381 | Ga0268264_10124207 | Ga0268264_101242072 | 147 |
| 93 | 3300031507 | Ga0307509_10292619 | Ga0307509_102926192 | 147 |
| 94 | 3300045051 | Ga0451576_1083126 | Ga0451576_1083126_222_677 | 147 |
| 95 | 3300005347 | Ga0070668_100287172 | Ga0070668_1002871721 | 149 |
| 96 | 3300005356 | Ga0070674_101179655 | Ga0070674_1011796552 | 149 |
| 97 | 3300005545 | Ga0070695_100166360 | Ga0070695_1001663602 | 149 |
| 98 | 3300005546 | Ga0070696_100435045 | Ga0070696_1004350451 | 149 |
| 99 | 3300006058 | Ga0075432_10037592 | Ga0075432_100375924 | 149 |
| 100 | 3300006163 | Ga0070715_10126669 | Ga0070715_101266692 | 149 |
| 101 | 3300013105 | Ga0157369_10491327 | Ga0157369_104913272 | 149 |
| 102 | 3300013296 | Ga0157374_10397694 | Ga0157374_103976941 | 149 |
| 103 | 3300013306 | Ga0163162_10334189 | Ga0163162_103341892 | 149 |
| 104 | 3300014969 | Ga0157376_10409610 | Ga0157376_104096101 | 149 |
| 105 | 3300025899 | Ga0207642_10216943 | Ga0207642_102169432 | 149 |
| 106 | 3300025919 | Ga0207657_10416652 | Ga0207657_104166522 | 149 |
| 107 | 3300026121 | Ga0207683_10105677 | Ga0207683_101056772 | 149 |
| 108 | 3300027907 | Ga0207428_10272139 | Ga0207428_102721391 | 149 |
| 109 | 3300041452 | Ga0451793_0462623 | Ga0451793_0462623_77_532 | 149 |
| 110 | 3300046683 | Ga0495658_0104228 | Ga0495658_0104228_181_648 | 149 |
| 111 | 3300048905 | Ga0496102_0013652 | Ga0496102_0013652_987_1454 | 149 |
| 112 | 3300048906 | Ga0496103_0082190 | Ga0496103_0082190_1019_1486 | 149 |
| 113 | 3300048908 | Ga0496105_0390210 | Ga0496105_0390210_508_975 | 149 |
| 114 | 3300048914 | Ga0496111_0113223 | Ga0496111_0113223_289_756 | 149 |
| 115 | 3300048918 | Ga0496115_0491760 | Ga0496115_0491760_335_802 | 149 |
| 116 | 3300050507 | nmdc:mga05p37_480786_c1 | nmdc:mga05p37_480786_c1_267_734 | 149 |
| 117 | 3300003790 | Ga0055528_1032522 | Ga0055528_10325222 | 150 |
| 118 | 3300003791 | Ga0055530_10065963 | Ga0055530_100659632 | 150 |
| 119 | 3300005262 | Ga0065165_1009224 | Ga0065165_10092241 | 150 |
| 120 | 3300005328 | Ga0070676_10003760 | Ga0070676_100037606 | 150 |
| 121 | 3300005338 | Ga0068868_100054263 | Ga0068868_1000542632 | 150 |
| 122 | 3300005347 | Ga0070668_100414121 | Ga0070668_1004141211 | 150 |
| 123 | 3300005355 | Ga0070671_100412812 | Ga0070671_1004128121 | 150 |
| 124 | 3300005367 | Ga0070667_100228513 | Ga0070667_1002285132 | 150 |
| 125 | 3300005539 | Ga0068853_100221120 | Ga0068853_1002211202 | 150 |
| 126 | 3300005578 | Ga0068854_100393852 | Ga0068854_1003938522 | 150 |
| 127 | 3300005618 | Ga0068864_101000233 | Ga0068864_1010002331 | 150 |
| 128 | 3300005840 | Ga0068870_10098345 | Ga0068870_100983452 | 150 |
| 129 | 3300005841 | Ga0068863_100263023 | Ga0068863_1002630232 | 150 |
| 130 | 3300005841 | Ga0068863_101557457 | Ga0068863_1015574571 | 150 |
| 131 | 3300005843 | Ga0068860_100177501 | Ga0068860_1001775012 | 150 |
| 132 | 3300006038 | Ga0075365_10191818 | Ga0075365_101918182 | 150 |
| 133 | 3300006042 | Ga0075368_10034165 | Ga0075368_100341652 | 150 |
| 134 | 3300006051 | Ga0075364_10178675 | Ga0075364_101786752 | 150 |
| 135 | 3300006058 | Ga0075432_10063496 | Ga0075432_100634962 | 150 |
| 136 | 3300006177 | Ga0075362_10029907 | Ga0075362_100299072 | 150 |
| 137 | 3300006177 | Ga0075362_10030177 | Ga0075362_100301772 | 150 |
| 138 | 3300006177 | Ga0075362_10066757 | Ga0075362_100667571 | 150 |
| 139 | 3300006178 | Ga0075367_10096385 | Ga0075367_100963852 | 150 |
| 140 | 3300006195 | Ga0075366_10076629 | Ga0075366_100766292 | 150 |
| 141 | 3300006195 | Ga0075366_10095391 | Ga0075366_100953912 | 150 |
| 142 | 3300006195 | Ga0075366_10128031 | Ga0075366_101280312 | 150 |
| 143 | 3300006195 | Ga0075366_10134233 | Ga0075366_101342331 | 150 |
| 144 | 3300006353 | Ga0075370_10048336 | Ga0075370_100483362 | 150 |
| 145 | 3300006353 | Ga0075370_10061738 | Ga0075370_100617382 | 150 |
| 146 | 3300006353 | Ga0075370_10074734 | Ga0075370_100747342 | 150 |
| 147 | 3300006353 | Ga0075370_10105264 | Ga0075370_101052642 | 150 |
| 148 | 3300006852 | Ga0075433_10207104 | Ga0075433_102071042 | 150 |
| 149 | 3300006931 | Ga0097620_100535654 | Ga0097620_1005356542 | 150 |
| 150 | 3300009093 | Ga0105240_11899938 | Ga0105240_118999381 | 150 |
| 151 | 3300009094 | Ga0111539_11966137 | Ga0111539_119661371 | 150 |
| 152 | 3300009098 | Ga0105245_10322990 | Ga0105245_103229902 | 150 |
| 153 | 3300009098 | Ga0105245_10487688 | Ga0105245_104876882 | 150 |
| 154 | 3300009147 | Ga0114129_12372362 | Ga0114129_123723621 | 150 |
| 155 | 3300009545 | Ga0105237_10157912 | Ga0105237_101579122 | 150 |
| 156 | 3300010375 | Ga0105239_11585310 | Ga0105239_115853102 | 150 |
| 157 | 3300011119 | Ga0105246_10244516 | Ga0105246_102445162 | 150 |
| 158 | 3300013308 | Ga0157375_10211931 | Ga0157375_102119311 | 150 |
| 159 | 3300013308 | Ga0157375_10471967 | Ga0157375_104719672 | 150 |
| 160 | 3300017792 | Ga0163161_10228633 | Ga0163161_102286331 | 150 |
| 161 | 3300025273 | Ga0209673_1013853 | Ga0209673_10138531 | 150 |
| 162 | 3300025298 | Ga0209050_1004917 | Ga0209050_10049174 | 150 |
| 163 | 3300025303 | Ga0209051_1004360 | Ga0209051_10043607 | 150 |
| 164 | 3300025303 | Ga0209051_1015013 | Ga0209051_10150133 | 150 |
| 165 | 3300025907 | Ga0207645_10033411 | Ga0207645_100334114 | 150 |
| 166 | 3300025908 | Ga0207643_10054855 | Ga0207643_100548552 | 150 |
| 167 | 3300025913 | Ga0207695_10230543 | Ga0207695_102305432 | 150 |
| 168 | 3300025914 | Ga0207671_10093679 | Ga0207671_100936792 | 150 |
| 169 | 3300025925 | Ga0207650_11162756 | Ga0207650_111627562 | 150 |
| 170 | 3300025925 | Ga0207650_11352980 | Ga0207650_113529801 | 150 |
| 171 | 3300025926 | Ga0207659_10404635 | Ga0207659_104046351 | 150 |
| 172 | 3300025927 | Ga0207687_10278805 | Ga0207687_102788052 | 150 |
| 173 | 3300025931 | Ga0207644_10156396 | Ga0207644_101563962 | 150 |
| 174 | 3300025942 | Ga0207689_10021076 | Ga0207689_100210764 | 150 |
| 175 | 3300025960 | Ga0207651_10411669 | Ga0207651_104116692 | 150 |
| 176 | 3300025960 | Ga0207651_10511548 | Ga0207651_105115481 | 150 |
| 177 | 3300025972 | Ga0207668_10360636 | Ga0207668_103606362 | 150 |
| 178 | 3300025981 | Ga0207640_10161115 | Ga0207640_101611152 | 150 |
| 179 | 3300025981 | Ga0207640_10340912 | Ga0207640_103409121 | 150 |
| 180 | 3300025986 | Ga0207658_10200546 | Ga0207658_102005462 | 150 |
| 181 | 3300026035 | Ga0207703_11017895 | Ga0207703_110178952 | 150 |
| 182 | 3300026041 | Ga0207639_10158944 | Ga0207639_101589442 | 150 |
| 183 | 3300026095 | Ga0207676_10516276 | Ga0207676_105162762 | 150 |
| 184 | 3300026116 | Ga0207674_10009995 | Ga0207674_100099952 | 150 |
| 185 | 3300026116 | Ga0207674_10582067 | Ga0207674_105820672 | 150 |
| 186 | 3300026118 | Ga0207675_100579815 | Ga0207675_1005798152 | 150 |
| 187 | 3300027471 | Ga0209995_1054587 | Ga0209995_10545871 | 150 |
| 188 | 3300027866 | Ga0209813_10180988 | Ga0209813_101809882 | 150 |
| 189 | 3300028381 | Ga0268264_12092396 | Ga0268264_120923961 | 150 |
| 190 | 3300028786 | Ga0307517_10001591 | Ga0307517_100015916 | 150 |
| 191 | 3300028786 | Ga0307517_10167178 | Ga0307517_101671782 | 150 |
| 192 | 3300028786 | Ga0307517_10209361 | Ga0307517_102093612 | 150 |
| 193 | 3300028794 | Ga0307515_10000232 | Ga0307515_10000232103 | 150 |
| 194 | 3300028794 | Ga0307515_10010735 | Ga0307515_100107355 | 150 |
| 195 | 3300028794 | Ga0307515_10020933 | Ga0307515_100209332 | 150 |
| 196 | 3300028794 | Ga0307515_10182586 | Ga0307515_101825862 | 150 |
| 197 | 3300028794 | Ga0307515_10282278 | Ga0307515_102822782 | 150 |
| 198 | 3300028794 | Ga0307515_10356637 | Ga0307515_103566371 | 150 |
| 199 | 3300031344 | Ga0265316_10000005 | Ga0265316_10000005130 | 150 |
| 200 | 3300031456 | Ga0307513_10209689 | Ga0307513_102096892 | 150 |
| 201 | 3300031456 | Ga0307513_10209997 | Ga0307513_102099972 | 150 |
| 202 | 3300031456 | Ga0307513_10295747 | Ga0307513_102957472 | 150 |
| 203 | 3300031507 | Ga0307509_10021989 | Ga0307509_100219894 | 150 |
| 204 | 3300031507 | Ga0307509_10062124 | Ga0307509_100621243 | 150 |
| 205 | 3300031507 | Ga0307509_10598427 | Ga0307509_105984271 | 150 |
| 206 | 3300031616 | Ga0307508_10000368 | Ga0307508_1000036821 | 150 |
| 207 | 3300031616 | Ga0307508_10011417 | Ga0307508_100114177 | 150 |
| 208 | 3300031616 | Ga0307508_10014137 | Ga0307508_100141374 | 150 |
| 209 | 3300031649 | Ga0307514_10017566 | Ga0307514_100175663 | 150 |
| 210 | 3300031649 | Ga0307514_10135668 | Ga0307514_101356682 | 150 |
| 211 | 3300031730 | Ga0307516_10070669 | Ga0307516_100706693 | 150 |
| 212 | 3300031730 | Ga0307516_10180001 | Ga0307516_101800012 | 150 |
| 213 | 3300031730 | Ga0307516_10473961 | Ga0307516_104739611 | 150 |
| 214 | 3300033179 | Ga0307507_10036764 | Ga0307507_100367642 | 150 |
| 215 | 3300033179 | Ga0307507_10084566 | Ga0307507_100845661 | 150 |
| 216 | 3300035088 | Ga0373940_0189349 | Ga0373940_0189349_54_518 | 150 |
| 217 | 3300035114 | Ga0373939_0122320 | Ga0373939_0122320_161_625 | 150 |
| 218 | 3300035691 | Ga0373931_0048335 | Ga0373931_0048335_1105_1569 | 150 |
| 219 | 3300036401 | Ga0373937_0585693 | Ga0373937_0585693_259_873 | 150 |
| 220 | 3300041443 | Ga0451789_0124233 | Ga0451789_0124233_710_1162 | 150 |
| 221 | 3300041451 | Ga0451791_0808117 | Ga0451791_0808117_711_1175 | 150 |
| 222 | 3300041452 | Ga0451793_0014778 | Ga0451793_0014778_764_1228 | 150 |
| 223 | 3300041452 | Ga0451793_1263303 | Ga0451793_1263303_154_606 | 150 |
| 224 | 3300041453 | Ga0451797_0276331 | Ga0451797_0276331_70_531 | 150 |
| 225 | 3300041453 | Ga0451797_0968387 | Ga0451797_0968387_525_977 | 150 |
| 226 | 3300041456 | Ga0451795_0246322 | Ga0451795_0246322_251_703 | 150 |
| 227 | 3300041458 | Ga0451798_0403471 | Ga0451798_0403471_277_729 | 150 |
| 228 | 3300041459 | Ga0451800_0506324 | Ga0451800_0506324_639_1091 | 150 |
| 229 | 3300041459 | Ga0451800_0740856 | Ga0451800_0740856_615_1079 | 150 |
| 230 | 3300041460 | Ga0451802_0493372 | Ga0451802_0493372_803_1267 | 150 |
| 231 | 3300041460 | Ga0451802_0600920 | Ga0451802_0600920_425_877 | 150 |
| 232 | 3300041461 | Ga0451805_013476 | Ga0451805_013476_224_688 | 150 |
| 233 | 3300041463 | Ga0451804_0030771 | Ga0451804_0030771_82_534 | 150 |
| 234 | 3300041498 | Ga0451841_1368528 | Ga0451841_1368528_1006_1470 | 150 |
| 235 | 3300041505 | Ga0451849_0680273 | Ga0451849_0680273_479_943 | 150 |
| 236 | 3300041509 | Ga0451843_0827713 | Ga0451843_0827713_85_549 | 150 |
| 237 | 3300041512 | Ga0451853_1179119 | Ga0451853_1179119_64_516 | 150 |
| 238 | 3300045051 | Ga0451576_1350950 | Ga0451576_1350950_153_626 | 150 |
| 239 | 3300046457 | Ga0495590_0123725 | Ga0495590_0123725_424_885 | 150 |
| 240 | 3300046459 | Ga0495629_0622456 | Ga0495629_0622456_36_500 | 150 |
| 241 | 3300046460 | Ga0495638_0055615 | Ga0495638_0055615_1459_1911 | 150 |
| 242 | 3300046471 | Ga0495650_0006891 | Ga0495650_0006891_4767_5234 | 150 |
| 243 | 3300046474 | Ga0495605_0032527 | Ga0495605_0032527_1793_2254 | 150 |
| 244 | 3300046475 | Ga0495639_0407970 | Ga0495639_0407970_202_666 | 150 |
| 245 | 3300046507 | Ga0495606_0069303 | Ga0495606_0069303_1104_1556 | 150 |
| 246 | 3300046512 | Ga0495610_0037135 | Ga0495610_0037135_1006_1470 | 150 |
| 247 | 3300046512 | Ga0495610_0230843 | Ga0495610_0230843_23_484 | 150 |
| 248 | 3300046517 | Ga0495630_0121698 | Ga0495630_0121698_1200_1664 | 150 |
| 249 | 3300046519 | Ga0495632_0033075 | Ga0495632_0033075_1415_1876 | 150 |
| 250 | 3300046519 | Ga0495632_0037075 | Ga0495632_0037075_1426_1881 | 150 |
| 251 | 3300046519 | Ga0495632_0101648 | Ga0495632_0101648_551_1015 | 150 |
| 252 | 3300046519 | Ga0495632_0219412 | Ga0495632_0219412_332_784 | 150 |
| 253 | 3300046520 | Ga0495637_0292539 | Ga0495637_0292539_28_480 | 150 |
| 254 | 3300046522 | Ga0495643_0022777 | Ga0495643_0022777_3073_3537 | 150 |
| 255 | 3300046542 | Ga0495597_0128637 | Ga0495597_0128637_166_627 | 150 |
| 256 | 3300046616 | Ga0495668_0811698 | Ga0495668_0811698_54_506 | 150 |
| 257 | 3300046660 | Ga0495625_0002284 | Ga0495625_0002284_14196_14660 | 150 |
| 258 | 3300046660 | Ga0495625_0294959 | Ga0495625_0294959_540_995 | 150 |
| 259 | 3300046660 | Ga0495625_0377055 | Ga0495625_0377055_172_624 | 150 |
| 260 | 3300046679 | Ga0495623_0642049 | Ga0495623_0642049_36_500 | 150 |
| 261 | 3300046683 | Ga0495658_0165801 | Ga0495658_0165801_589_1053 | 150 |
| 262 | 3300046690 | Ga0495624_0088876 | Ga0495624_0088876_1409_1873 | 150 |
| 263 | 3300046692 | Ga0495671_0503034 | Ga0495671_0503034_39_500 | 150 |
| 264 | 3300046694 | Ga0495649_0271598 | Ga0495649_0271598_381_842 | 150 |
| 265 | 3300046810 | Ga0495660_0007305 | Ga0495660_0007305_6020_6481 | 150 |
| 266 | 3300047318 | Ga0495636_0538869 | Ga0495636_0538869_81_542 | 150 |
| 267 | 3300047321 | Ga0495676_0054642 | Ga0495676_0054642_752_1216 | 150 |
| 268 | 3300047443 | Ga0495687_006585 | Ga0495687_006585_4789_5250 | 150 |
| 269 | 3300049576 | Ga0501040_0331675 | Ga0501040_0331675_498_962 | 150 |
| 270 | 3300049577 | Ga0501041_0166031 | Ga0501041_0166031_31_495 | 150 |
| 271 | 3300049580 | Ga0501046_0422983 | Ga0501046_0422983_196_660 | 150 |
| 272 | 3300049587 | Ga0501071_0241153 | Ga0501071_0241153_714_1178 | 150 |
| 273 | 3300049591 | Ga0501075_0028249 | Ga0501075_0028249_30_494 | 150 |
| 274 | 3300049592 | Ga0501076_0072722 | Ga0501076_0072722_1066_1530 | 150 |
| 275 | 3300049743 | Ga0501081_0371875 | Ga0501081_0371875_434_898 | 150 |
| 276 | 3300049824 | Ga0501045_0397648 | Ga0501045_0397648_271_735 | 150 |
| 277 | 3300050489 | nmdc:mga03683_47196_c1 | nmdc:mga03683_47196_c1_518_979 | 150 |
| 278 | 3300050489 | nmdc:mga03683_7808_c1 | nmdc:mga03683_7808_c1_287_748 | 150 |
| 279 | 3300050490 | nmdc:mga03n38_181087_c1 | nmdc:mga03n38_181087_c1_141_602 | 150 |
| 280 | 3300050491 | nmdc:mga00v17_844939_c1 | nmdc:mga00v17_844939_c1_24_485 | 150 |
| 281 | 3300050492 | nmdc:mga0yw44_99354_c1 | nmdc:mga0yw44_99354_c1_380_841 | 150 |
| 282 | 3300050493 | nmdc:mga0k408_79803_c2 | nmdc:mga0k408_79803_c2_638_1099 | 150 |
| 283 | 3300050493 | nmdc:mga0k408_97968_c1 | nmdc:mga0k408_97968_c1_977_1438 | 150 |
| 284 | 3300050494 | nmdc:mga06z11_111720_c1 | nmdc:mga06z11_111720_c1_70_531 | 150 |
| 285 | 3300050494 | nmdc:mga06z11_578404_c1 | nmdc:mga06z11_578404_c1_160_624 | 150 |
| 286 | 3300050495 | nmdc:mga04h51_424031_c1 | nmdc:mga04h51_424031_c1_16_480 | 150 |
| 287 | 3300050495 | nmdc:mga04h51_67510_c1 | nmdc:mga04h51_67510_c1_734_1195 | 150 |
| 288 | 3300050496 | nmdc:mga07m45_46580_c1 | nmdc:mga07m45_46580_c1_708_1169 | 150 |
| 289 | 3300050496 | nmdc:mga07m45_65673_c1 | nmdc:mga07m45_65673_c1_726_1253 | 150 |
| 290 | 3300050496 | nmdc:mga07m45_93110_c1 | nmdc:mga07m45_93110_c1_977_1438 | 150 |
| 291 | 3300050516 | nmdc:mga0sz30_22293_c1 | nmdc:mga0sz30_22293_c1_673_1134 | 150 |
| 292 | 3300050516 | nmdc:mga0sz30_69708_c1 | nmdc:mga0sz30_69708_c1_175_636 | 150 |
| 293 | 3300053086 | Ga0500578_0013820 | Ga0500578_0013820_4283_4804 | 150 |
| 294 | 3300053088 | Ga0500644_0027200 | Ga0500644_0027200_324_776 | 150 |
| 295 | 3300053090 | Ga0500646_0048331 | Ga0500646_0048331_325_777 | 150 |
| 296 | 3300053092 | Ga0500583_0373350 | Ga0500583_0373350_70_525 | 150 |
| 297 | 3300053093 | Ga0500651_0017219 | Ga0500651_0017219_3660_4112 | 150 |
| 298 | 3300053093 | Ga0500651_0469825 | Ga0500651_0469825_177_641 | 150 |
| 299 | 3300053093 | Ga0500651_0668129 | Ga0500651_0668129_23_484 | 150 |
| 300 | 3300053098 | Ga0500650_0051228 | Ga0500650_0051228_1147_1599 | 150 |
| 301 | 3300053127 | Ga0500623_092226 | Ga0500623_092226_658_1110 | 150 |
| 302 | 3300053129 | Ga0500628_006860 | Ga0500628_006860_325_777 | 150 |
| 303 | 3300053130 | Ga0500642_0132288 | Ga0500642_0132288_399_851 | 150 |
| 304 | 3300053131 | Ga0500652_004014 | Ga0500652_004014_398_850 | 150 |
| 305 | 3300053134 | Ga0500658_0010582 | Ga0500658_0010582_303_767 | 150 |
| 306 | 3300053137 | Ga0500561_0046868 | Ga0500561_0046868_501_953 | 150 |
| 307 | 3300053139 | Ga0500568_0072711 | Ga0500568_0072711_546_998 | 150 |
| 308 | 3300053151 | Ga0500604_0028316 | Ga0500604_0028316_601_1053 | 150 |
| 309 | 3300053156 | Ga0500622_0000221 | Ga0500622_0000221_650_1102 | 150 |
| 310 | 3300053156 | Ga0500622_0126051 | Ga0500622_0126051_323_775 | 150 |
| 311 | 3300053730 | Ga0500645_006448 | Ga0500645_006448_1108_1629 | 150 |
| 312 | 3300053730 | Ga0500645_118154 | Ga0500645_118154_278_730 | 150 |
| 313 | 3300053739 | Ga0500587_003848 | Ga0500587_003848_986_1450 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g7g-assembly2.cif.gz_C | crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 | 0.8386 | 130 | 150 |
| 3g7g-assembly2.cif.gz_G | crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 | 0.8123 | 130 | 150 |
| 2qhk-assembly1.cif.gz_A | crystal structure of methyl-accepting chemotaxis protein from vibrio parahaemolyticus rimd 2210633 | 0.8069 | 28 | 149 |
| 4tx4-assembly1.cif.gz_B | crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata) | 0.7983 | 114 | 140 |
| 8sj5-assembly2.cif.gz_D | walnut tree phytocystatin | 0.7947 | 114 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3g7gG00 | Mainly Beta;Beta Barrel;Porin; | 0.8123 | 130 | 150 | 2.40.160.20 |
| af_P47107_10_380_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7935 | 115 | 138 | 2.130.10.10 |
| af_Q4DBW5_237_558_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7556 | 114 | 138 | 1.10.510.10 |
| af_P31471_131_389_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7534 | 113 | 137 | 3.40.50.1820 |
| af_O02219_282_409_3.30.450.20 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.7533 | 64 | 150 | 3.30.450.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A4G167-F1-model_v4 | Methyl-accepting chemotaxis protein | 0.9837 | 21 | 150 |
GO:0004888
GO:0005886 GO:0006935 GO:0007165 |
| AF-A0A4R3HX83-F1-model_v4 | Methyl-accepting chemotaxis protein | 0.981 | 24 | 150 |
GO:0004888
GO:0005886 GO:0006935 GO:0007165 |
| AF-A0A3A6NX35-F1-model_v4 | HAMP domain-containing protein | 0.9796 | 20 | 150 |
GO:0004888
GO:0005886 GO:0006935 GO:0007165 |
| AF-A0A4Y9RLS2-F1-model_v4 | HAMP domain-containing protein | 0.9755 | 26 | 150 |
GO:0004888
GO:0005886 GO:0006935 GO:0007165 |
| AF-A0A2G1YHS0-F1-model_v4 | Histidine kinase | 0.9753 | 34 | 150 |
GO:0005886
GO:0016301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar