F402121

General Info

Members Datasets Scaffolds Average Seq Length
313 189 310 255

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100200118|Ga0068871_1002001182
Length 283
Sequence MMLATPPRAPAVFLLATHYSLLTTFPNMSIRKKLIAGNWKMNKTSADAVALVQELVSEIGKQTDVEVVVAPPFTSIESVGKVLDGSVIKLGAQNVHPEASGAYTGEISVGMLRSIFTNYVILGHSERRTYFKETDAFINQKVLASLKGQLKPILCVGETLAEREGNQTLKVVQTQLEAGLEGVSKDLATSVVIAYEPVWAIGTGKVATTEQAQEVHAFIRSLLVKLFGDATAQKVRILYGGSMKPSNAPELLTQKDIDGGLIGGASLESRSFVDLIKAAAAAK

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.64
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 0.64
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1001440 3300002155 Bacteria 2359
2 rootH2_10014581 3300003320 Bacteria 7004
3 rootH2_10018539 3300003320 Bacteria 22550
4 rootL2_10038826 3300003322 Bacteria 2343
5 rootH1_10052629 3300003323 Bacteria 8510
6 Ga0070658_10012826 3300005327 Bacteria 6725
7 Ga0070676_10003308 3300005328 Bacteria 8378
8 Ga0070683_100000678 3300005329 Bacteria 24650
9 Ga0070683_100168274 3300005329 Bacteria 2080
10 Ga0070690_100000961 3300005330 Bacteria 14652
11 Ga0070670_100592285 3300005331 Bacteria 992
12 Ga0068869_100002769 3300005334 Bacteria 10617
13 Ga0070666_10024786 3300005335 Bacteria 3910
14 Ga0070680_100339016 3300005336 Bacteria 1277
15 Ga0068868_100012435 3300005338 Bacteria 6222
16 Ga0068868_100057754 3300005338 Bacteria 3066
17 Ga0068868_100188617 3300005338 Bacteria 1714
18 Ga0068868_100266815 3300005338 Bacteria 1445
19 Ga0070660_100047966 3300005339 Bacteria 3279
20 Ga0070689_100000034 3300005340 Bacteria 91533
21 Ga0070689_100036470 3300005340 Bacteria 3761
22 Ga0070687_100003383 3300005343 Bacteria 6189
23 Ga0070661_100003563 3300005344 Bacteria 10720
24 Ga0070668_100012036 3300005347 Bacteria 6443
25 Ga0070669_100010670 3300005353 Bacteria 6519
26 Ga0070669_100211952 3300005353 Bacteria 1529
27 Ga0070675_100025623 3300005354 Bacteria 4728
28 Ga0070675_100088524 3300005354 Bacteria 2591
29 Ga0070671_100001696 3300005355 Bacteria 16716
30 Ga0070671_100030423 3300005355 Bacteria 4455
31 Ga0070671_100589721 3300005355 Bacteria 960
32 Ga0070674_100021101 3300005356 Bacteria 4176
33 Ga0070674_100077671 3300005356 Bacteria 2364
34 Ga0070674_100172030 3300005356 Bacteria 1652
35 Ga0070673_100085101 3300005364 Bacteria 2573
36 Ga0070673_100384914 3300005364 Bacteria 1251
37 Ga0070688_100001523 3300005365 Bacteria 11571
38 Ga0070659_100060654 3300005366 Bacteria 2988
39 Ga0070667_100008641 3300005367 Bacteria 8441
40 Ga0070667_100019801 3300005367 Bacteria 5583
41 Ga0070667_100651278 3300005367 Bacteria 973
42 Ga0070710_10031738 3300005437 Bacteria 2855
43 Ga0070701_10000354 3300005438 Bacteria 15249
44 Ga0070700_100001338 3300005441 Bacteria 12254
45 Ga0070678_100027103 3300005456 Bacteria 3886
46 Ga0070678_100032667 3300005456 Bacteria 3604
47 Ga0070678_100155992 3300005456 Bacteria 1844
48 Ga0068867_100000837 3300005459 Bacteria 20701
49 Ga0068867_100001590 3300005459 Bacteria 15778
50 Ga0068867_100032706 3300005459 Bacteria 3763
51 Ga0070685_10000278 3300005466 Bacteria 32947
52 Ga0070699_100350983 3300005518 Bacteria 1329
53 Ga0070679_100117285 3300005530 Bacteria 2647
54 Ga0070672_100018454 3300005543 Bacteria 5044
55 Ga0070672_100042393 3300005543 Bacteria 3504
56 Ga0070686_100000053 3300005544 Bacteria 95565
57 Ga0070665_100018595 3300005548 Bacteria 6964
58 Ga0070665_100136672 3300005548 Bacteria 2454
59 Ga0070665_100206681 3300005548 Bacteria 1964
60 Ga0070664_100038634 3300005564 Bacteria 4019
61 Ga0068857_100037001 3300005577 Bacteria 4323
62 Ga0068856_100000326 3300005614 Bacteria 52440
63 Ga0068856_100006226 3300005614 Bacteria 11709
64 Ga0068856_100410002 3300005614 Bacteria 1375
65 Ga0068859_100001151 3300005617 Bacteria 26989
66 Ga0068861_100120476 3300005719 Bacteria 2116
67 Ga0068858_100390618 3300005842 Bacteria 1336
68 Ga0068860_100030343 3300005843 Bacteria 5200
69 Ga0081539_10005759 3300005985 Bacteria 12366
70 Ga0070717_10000016 3300006028 Bacteria 205932
71 Ga0097621_100188320 3300006237 Bacteria 1786
72 Ga0068871_100093115 3300006358 Bacteria 2513
73 Ga0068871_100200118 3300006358 Bacteria 1724
74 Ga0068871_100538031 3300006358 Bacteria 1057
75 Ga0068865_100040221 3300006881 Bacteria 3175
76 Ga0068865_100158911 3300006881 Bacteria 1722
77 Ga0097620_100001151 3300006931 Bacteria 26989
78 Ga0105240_10466353 3300009093 Bacteria 1410
79 Ga0105240_11000263 3300009093 Bacteria 894
80 Ga0105245_10446331 3300009098 Bacteria 1301
81 Ga0114129_10237872 3300009147 Bacteria 2449
82 Ga0105242_10011055 3300009176 Bacteria 6935
83 Ga0105248_10000116 3300009177 Bacteria 90171
84 Ga0105239_10574394 3300010375 Bacteria 1285
85 Ga0157374_10013126 3300013296 Bacteria 7226
86 Ga0157374_10035317 3300013296 Bacteria 4573
87 Ga0157378_10002900 3300013297 Bacteria 15262
88 Ga0157378_10289076 3300013297 Bacteria 1583
89 Ga0157378_10299360 3300013297 Bacteria 1556
90 Ga0163162_10035394 3300013306 Bacteria 4974
91 Ga0163162_10304339 3300013306 Bacteria 1726
92 Ga0163162_10370465 3300013306 Bacteria 1565
93 Ga0157372_10296637 3300013307 Bacteria 1880
94 Ga0157375_10016995 3300013308 Bacteria 6554
95 Ga0157375_10226262 3300013308 Bacteria 2029
96 Ga0163163_10036535 3300014325 Bacteria 4773
97 Ga0163163_10158756 3300014325 Bacteria 2306
98 Ga0157376_10005528 3300014969 Bacteria 8832
99 Ga0157376_10054447 3300014969 Bacteria 3335
100 Ga0163161_10115401 3300017792 Bacteria 2012
101 Ga0213876_10010457 3300021384 Bacteria 4977
102 Ga0213876_10185478 3300021384 Bacteria 1106
103 Ga0207673_1006491 3300025290 Bacteria 1449
104 Ga0209050_1000236 3300025298 Bacteria 120719
105 Ga0207697_10000163 3300025315 Bacteria 33514
106 Ga0207697_10002689 3300025315 Bacteria 9085
107 Ga0207682_10195565 3300025893 Bacteria 928
108 Ga0207688_10010661 3300025901 Bacteria 4999
109 Ga0207688_10083416 3300025901 Bacteria 1828
110 Ga0207680_10011058 3300025903 Bacteria 4545
111 Ga0207645_10005348 3300025907 Bacteria 9333
112 Ga0207645_10005672 3300025907 Bacteria 9016
113 Ga0207705_10002538 3300025909 Bacteria 14060
114 Ga0207705_10035323 3300025909 Bacteria 3576
115 Ga0207695_10411804 3300025913 Bacteria 1236
116 Ga0207663_10194891 3300025916 Bacteria 1457
117 Ga0207657_10374248 3300025919 Bacteria 1122
118 Ga0207657_10437710 3300025919 Bacteria 1026
119 Ga0207649_10000291 3300025920 Bacteria 38912
120 Ga0207681_10014723 3300025923 Bacteria 4869
121 Ga0207681_10086233 3300025923 Bacteria 2230
122 Ga0207650_10407931 3300025925 Bacteria 1126
123 Ga0207659_10023276 3300025926 Bacteria 4132
124 Ga0207659_10104309 3300025926 Bacteria 2144
125 Ga0207644_10018760 3300025931 Bacteria 4684
126 Ga0207644_10028154 3300025931 Bacteria 3887
127 Ga0207690_10040681 3300025932 Bacteria 3041
128 Ga0207670_10000024 3300025936 Bacteria 143058
129 Ga0207669_10053266 3300025937 Bacteria 2436
130 Ga0207669_10180151 3300025937 Bacteria 1514
131 Ga0207691_10001207 3300025940 Bacteria 25737
132 Ga0207689_10006104 3300025942 Bacteria 10657
133 Ga0207661_10006991 3300025944 Bacteria 8003
134 Ga0207679_10046292 3300025945 Bacteria 3152
135 Ga0207651_10028421 3300025960 Bacteria 3527
136 Ga0207668_10016671 3300025972 Bacteria 4589
137 Ga0207658_10010967 3300025986 Bacteria 6170
138 Ga0207677_10004942 3300026023 Bacteria 7201
139 Ga0207677_10052253 3300026023 Bacteria 2775
140 Ga0207703_10006408 3300026035 Bacteria 9405
141 Ga0207703_10329059 3300026035 Bacteria 1401
142 Ga0207708_10001757 3300026075 Bacteria 16003
143 Ga0207702_10000672 3300026078 Bacteria 37239
144 Ga0207702_10001609 3300026078 Bacteria 22347
145 Ga0207648_10000502 3300026089 Bacteria 43633
146 Ga0207648_10006026 3300026089 Bacteria 12089
147 Ga0207648_10041697 3300026089 Bacteria 4031
148 Ga0207674_10037711 3300026116 Bacteria 5023
149 Ga0207683_10012877 3300026121 Bacteria 7139
150 Ga0207683_10016886 3300026121 Bacteria 6211
151 Ga0268266_10281669 3300028379 Bacteria 1546
152 Ga0268264_10387295 3300028381 Bacteria 1340
153 Ga0265319_1000130 3300028563 Bacteria 55833
154 Ga0265319_1002742 3300028563 Bacteria 9455
155 Ga0265319_1006336 3300028563 Bacteria 5495
156 Ga0265319_1008936 3300028563 Bacteria 4330
157 Ga0265319_1018051 3300028563 Bacteria 2669
158 Ga0265319_1034134 3300028563 Bacteria 1753
159 Ga0265334_10016148 3300028573 Bacteria 3089
160 Ga0265318_10000190 3300028577 Bacteria 54275
161 Ga0265318_10000434 3300028577 Bacteria 31774
162 Ga0265318_10001069 3300028577 Bacteria 17274
163 Ga0265318_10003913 3300028577 Bacteria 7338
164 Ga0265318_10124037 3300028577 Bacteria 950
165 Ga0265323_10000080 3300028653 Bacteria 54790
166 Ga0265323_10008972 3300028653 Bacteria 4105
167 Ga0265323_10019478 3300028653 Bacteria 2616
168 Ga0265323_10030610 3300028653 Bacteria 2004
169 Ga0265322_10000087 3300028654 Bacteria 43593
170 Ga0265322_10026957 3300028654 Bacteria 1642
171 Ga0265322_10031861 3300028654 Bacteria 1504
172 Ga0265330_10129043 3300031235 Bacteria 1076
173 Ga0265320_10000205 3300031240 Bacteria 47959
174 Ga0265320_10000412 3300031240 Bacteria 34014
175 Ga0265320_10008391 3300031240 Bacteria 6325
176 Ga0265320_10076817 3300031240 Bacteria 1564
177 Ga0265320_10167028 3300031240 Bacteria 989
178 Ga0265325_10109344 3300031241 Bacteria 1345
179 Ga0265339_10127749 3300031249 Bacteria 1302
180 Ga0265327_10015094 3300031251 Bacteria 5009
181 Ga0265327_10032181 3300031251 Bacteria 2937
182 Ga0265327_10110433 3300031251 Bacteria 1315
183 Ga0265327_10218343 3300031251 Bacteria 858
184 Ga0265316_10002448 3300031344 Bacteria 19259
185 Ga0265316_10016479 3300031344 Bacteria 6407
186 Ga0265316_10077020 3300031344 Bacteria 2561
187 Ga0265316_10081196 3300031344 Bacteria 2486
188 Ga0265316_10095417 3300031344 Bacteria 2265
189 Ga0265316_10195405 3300031344 Bacteria 1502
190 Ga0307509_10376601 3300031507 Bacteria 1134
191 Ga0307408_100000003 3300031548 Bacteria 618438
192 Ga0265313_10003592 3300031595 Bacteria 12461
193 Ga0265313_10005982 3300031595 Bacteria 8790
194 Ga0265313_10019740 3300031595 Bacteria 3740
195 Ga0265314_10008930 3300031711 Bacteria 8537
196 Ga0265314_10011865 3300031711 Bacteria 7158
197 Ga0265314_10038674 3300031711 Bacteria 3444
198 Ga0265314_10148265 3300031711 Bacteria 1442
199 Ga0265342_10014564 3300031712 Bacteria 5216
200 Ga0265342_10019832 3300031712 Bacteria 4325
201 Ga0265342_10040906 3300031712 Bacteria 2809
202 Ga0265342_10120158 3300031712 Bacteria 1480
203 Ga0307405_10069898 3300031731 Bacteria 2253
204 Ga0307410_10000002 3300031852 Bacteria 145309
205 Ga0307407_10032914 3300031903 Bacteria 2823
206 Ga0307412_10116173 3300031911 Bacteria 1919
207 Ga0307409_100006527 3300031995 Bacteria 6867
208 Ga0307416_100000057 3300032002 Bacteria 105624
209 Ga0307414_10020785 3300032004 Bacteria 4100
210 Ga0307414_10743171 3300032004 Bacteria 891
211 Ga0373953_0099625 3300035117 Bacteria 1222
212 Ga0373956_0067614 3300035119 Bacteria 1627
213 Ga0373924_0011635 3300035410 Bacteria 3272
214 Ga0373937_0037149 3300036401 Bacteria 4439
215 Ga0373937_0053673 3300036401 Bacteria 3697
216 Ga0395899_0000349 3300037312 Bacteria 56957
217 Ga0395898_0000026 3300037466 Bacteria 374440
218 Ga0395905_0000119 3300037471 Bacteria 131498
219 Ga0436365_0395979 3300039437 Bacteria 10769
220 Ga0436365_0809833 3300039437 Bacteria 4967
221 Ga0436363_1651109 3300039450 Unclassified 2128
222 Ga0451853_0171139 3300041512 Bacteria 1291
223 Ga0451577_0053670 3300042876 Bacteria 3598
224 Ga0453683_0000264 3300044673 Bacteria 68669
225 Ga0453683_0285282 3300044673 Bacteria 1055
226 Ga0466965_0059428 3300044683 Bacteria 1908
227 Ga0466964_0030857 3300044706 Bacteria 2123
228 Ga0453684_0000045 3300044712 Bacteria 582917
229 Ga0453684_0145170 3300044712 Unclassified 2828
230 Ga0466971_0000020 3300044719 Bacteria 78865
231 Ga0466971_0215970 3300044719 Bacteria 908
232 Ga0466957_0010671 3300044842 Bacteria 5280
233 Ga0451576_0002620 3300045051 Bacteria 26319
234 Ga0451576_0038620 3300045051 Bacteria 5053
235 Ga0451576_0177137 3300045051 Bacteria 2226
236 Ga0451576_0557467 3300045051 Bacteria 1204
237 Ga0466967_0033254 3300045976 Bacteria 4363
238 Ga0466967_0158652 3300045976 Bacteria 2122
239 Ga0495627_009609 3300046453 Bacteria 3551
240 Ga0495580_0129200 3300046472 Bacteria 1753
241 Ga0495594_0240296 3300046499 Bacteria 1032
242 Ga0495607_0010818 3300046501 Bacteria 6105
243 Ga0495606_0366092 3300046507 Bacteria 760
244 Ga0495616_0030534 3300046513 Bacteria 2831
245 Ga0495643_0001055 3300046522 Bacteria 27762
246 Ga0495625_0010644 3300046660 Bacteria 7581
247 Ga0495588_0027351 3300046674 Bacteria 2851
248 Ga0495658_0007689 3300046683 Bacteria 5341
249 Ga0495581_0019021 3300047315 Bacteria 3986
250 Ga0495676_0115055 3300047321 Bacteria 1967
251 Ga0496109_0191362 3300048912 Bacteria 1923
252 Ga0496115_0017679 3300048918 Bacteria 5458
253 Ga0496125_0001048 3300048928 Bacteria 42722
254 Ga0496126_0009112 3300048929 Bacteria 10596
255 Ga0501305_002501 3300049161 Bacteria 1993
256 Ga0501312_006646 3300049528 Bacteria 1451
257 Ga0501031_0000288 3300049568 Bacteria 28555
258 Ga0501031_0305684 3300049568 Bacteria 1030
259 Ga0501032_0001389 3300049569 Bacteria 19217
260 Ga0501032_0001412 3300049569 Bacteria 19072
261 Ga0501032_0008221 3300049569 Bacteria 7603
262 Ga0501032_0042438 3300049569 Bacteria 3085
263 Ga0501033_0000021 3300049570 Bacteria 192208
264 Ga0501033_0000074 3300049570 Bacteria 94345
265 Ga0501033_0000882 3300049570 Bacteria 27415
266 Ga0501033_0001315 3300049570 Bacteria 22076
267 Ga0501034_0147822 3300049571 Bacteria 2326
268 Ga0501036_0075486 3300049572 Bacteria 2850
269 Ga0501036_0097728 3300049572 Bacteria 2482
270 Ga0501036_0110916 3300049572 Bacteria 2318
271 Ga0501037_0000145 3300049573 Bacteria 66010
272 Ga0501037_0014516 3300049573 Bacteria 5794
273 Ga0501037_0019969 3300049573 Bacteria 4945
274 Ga0501038_0000559 3300049574 Bacteria 32919
275 Ga0501038_0046028 3300049574 Bacteria 3784
276 Ga0501038_0107487 3300049574 Bacteria 2314
277 Ga0501039_0010884 3300049575 Bacteria 6933
278 Ga0501043_0002411 3300049579 Bacteria 15826
279 Ga0501043_0020306 3300049579 Bacteria 5211
280 Ga0501046_0001090 3300049580 Bacteria 26582
281 Ga0501046_0160611 3300049580 Bacteria 1690
282 Ga0501047_0005079 3300049581 Bacteria 12352
283 Ga0501047_0263862 3300049581 Bacteria 1569
284 Ga0501048_0119226 3300049582 Bacteria 1864
285 Ga0501048_0127026 3300049582 Bacteria 1803
286 Ga0501070_0007074 3300049586 Bacteria 9544
287 Ga0501070_0037843 3300049586 Bacteria 4027
288 Ga0501070_0192680 3300049586 Bacteria 1675
289 Ga0501070_0242281 3300049586 Bacteria 1476
290 Ga0501070_0480011 3300049586 Bacteria 1000
291 Ga0501243_030354 3300049675 Bacteria 920
292 Ga0501080_0075037 3300049742 Bacteria 3146
293 Ga0501080_0104419 3300049742 Bacteria 2628
294 Ga0501080_0344787 3300049742 Bacteria 1346
295 Ga0501083_0001769 3300049744 Bacteria 14763
296 Ga0501035_0000002 3300049822 Bacteria 585447
297 Ga0501035_0009323 3300049822 Bacteria 9121
298 Ga0501035_0010122 3300049822 Bacteria 8752
299 Ga0501044_0009583 3300049823 Bacteria 10541
300 Ga0501044_0011740 3300049823 Bacteria 9488
301 Ga0501044_0062551 3300049823 Bacteria 3804
302 Ga0501044_0133610 3300049823 Bacteria 2474
303 Ga0501045_0428436 3300049824 Bacteria 984
304 nmdc:mga05p37_242539_c1 3300050507 Bacteria 2166
305 nmdc:mga08y16_221484_c1 3300050511 Bacteria 1958
306 Ga0500646_0028422 3300053090 Bacteria 1526
307 Ga0500641_0000092 3300053096 Bacteria 34933
308 Ga0500642_0028868 3300053130 Bacteria 2293
309 Ga0501082_0240301 3300060353 Bacteria 1576
310 Ga0466962_0000046 3300061719 Bacteria 52219

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10124037 Ga0265318_101240371 239
2 3300046507 Ga0495606_0366092 Ga0495606_0366092_28_747 239
3 3300005328 Ga0070676_10003308 Ga0070676_100033082 241
4 3300005347 Ga0070668_100012036 Ga0070668_1000120362 241
5 3300005353 Ga0070669_100010670 Ga0070669_1000106702 241
6 3300005356 Ga0070674_100077671 Ga0070674_1000776712 241
7 3300005548 Ga0070665_100136672 Ga0070665_1001366722 241
8 3300025290 Ga0207673_1006491 Ga0207673_10064911 241
9 3300025298 Ga0209050_1000236 Ga0209050_100023632 241
10 3300025315 Ga0207697_10000163 Ga0207697_100001632 241
11 3300025940 Ga0207691_10001207 Ga0207691_100012072 241
12 iso_pu_bacteria 2881247448 2881248429 246
13 3300032004 Ga0307414_10020785 Ga0307414_100207853 250
14 3300032004 Ga0307414_10743171 Ga0307414_107431712 250
15 3300046513 Ga0495616_0030534 Ga0495616_0030534_1142_1894 250
16 3300046522 Ga0495643_0001055 Ga0495643_0001055_25568_26320 250
17 3300046660 Ga0495625_0010644 Ga0495625_0010644_1154_1906 250
18 3300048918 Ga0496115_0017679 Ga0496115_0017679_4410_5162 250
19 3300048928 Ga0496125_0001048 Ga0496125_0001048_39070_39822 250
20 3300048929 Ga0496126_0009112 Ga0496126_0009112_2802_3554 250
21 3300053090 Ga0500646_0028422 Ga0500646_0028422_692_1444 250
22 3300053096 Ga0500641_0000092 Ga0500641_0000092_13810_14562 250
23 iso_pu_bacteria 2786546548 2787509096 250
24 iso_pu_bacteria 2786546940 2788435644 250
25 3300005329 Ga0070683_100168274 Ga0070683_1001682743 251
26 3300013307 Ga0157372_10296637 Ga0157372_102966372 251
27 3300017792 Ga0163161_10115401 Ga0163161_101154012 251
28 3300046453 Ga0495627_009609 Ga0495627_009609_1792_2547 251
29 3300005518 Ga0070699_100350983 Ga0070699_1003509832 252
30 3300041512 Ga0451853_0171139 Ga0451853_0171139_381_1139 252
31 3300046472 Ga0495580_0129200 Ga0495580_0129200_257_1024 252
32 3300046499 Ga0495594_0240296 Ga0495594_0240296_253_1020 252
33 3300046674 Ga0495588_0027351 Ga0495588_0027351_726_1493 252
34 3300047321 Ga0495676_0115055 Ga0495676_0115055_524_1291 252
35 3300044712 Ga0453684_0000045 Ga0453684_0000045_462161_462928 253
36 3300046501 Ga0495607_0010818 Ga0495607_0010818_1814_2575 253
37 3300003320 rootH2_10014581 rootH2_100145812 254
38 3300003320 rootH2_10018539 rootH2_1001853923 254
39 3300003322 rootL2_10038826 rootL2_100388262 254
40 3300003323 rootH1_10052629 rootH1_100526292 254
41 3300005327 Ga0070658_10012826 Ga0070658_100128263 254
42 3300005330 Ga0070690_100000961 Ga0070690_10000096113 254
43 3300005331 Ga0070670_100592285 Ga0070670_1005922851 254
44 3300005335 Ga0070666_10024786 Ga0070666_100247862 254
45 3300005336 Ga0070680_100339016 Ga0070680_1003390161 254
46 3300005338 Ga0068868_100057754 Ga0068868_1000577543 254
47 3300005338 Ga0068868_100188617 Ga0068868_1001886172 254
48 3300005339 Ga0070660_100047966 Ga0070660_1000479662 254
49 3300005340 Ga0070689_100000034 Ga0070689_10000003486 254
50 3300005340 Ga0070689_100036470 Ga0070689_1000364704 254
51 3300005343 Ga0070687_100003383 Ga0070687_1000033835 254
52 3300005353 Ga0070669_100211952 Ga0070669_1002119522 254
53 3300005354 Ga0070675_100025623 Ga0070675_1000256235 254
54 3300005355 Ga0070671_100001696 Ga0070671_10000169615 254
55 3300005355 Ga0070671_100030423 Ga0070671_1000304234 254
56 3300005355 Ga0070671_100589721 Ga0070671_1005897212 254
57 3300005356 Ga0070674_100021101 Ga0070674_1000211014 254
58 3300005364 Ga0070673_100085101 Ga0070673_1000851012 254
59 3300005364 Ga0070673_100384914 Ga0070673_1003849141 254
60 3300005365 Ga0070688_100001523 Ga0070688_10000152310 254
61 3300005367 Ga0070667_100008641 Ga0070667_1000086413 254
62 3300005367 Ga0070667_100019801 Ga0070667_1000198014 254
63 3300005367 Ga0070667_100651278 Ga0070667_1006512782 254
64 3300005437 Ga0070710_10031738 Ga0070710_100317383 254
65 3300005438 Ga0070701_10000354 Ga0070701_100003547 254
66 3300005441 Ga0070700_100001338 Ga0070700_1000013385 254
67 3300005456 Ga0070678_100027103 Ga0070678_1000271034 254
68 3300005456 Ga0070678_100032667 Ga0070678_1000326673 254
69 3300005459 Ga0068867_100000837 Ga0068867_1000008374 254
70 3300005459 Ga0068867_100032706 Ga0068867_1000327064 254
71 3300005466 Ga0070685_10000278 Ga0070685_1000027812 254
72 3300005543 Ga0070672_100018454 Ga0070672_1000184545 254
73 3300005543 Ga0070672_100042393 Ga0070672_1000423932 254
74 3300005544 Ga0070686_100000053 Ga0070686_10000005389 254
75 3300005548 Ga0070665_100018595 Ga0070665_1000185955 254
76 3300005548 Ga0070665_100206681 Ga0070665_1002066812 254
77 3300005564 Ga0070664_100038634 Ga0070664_1000386344 254
78 3300005577 Ga0068857_100037001 Ga0068857_1000370013 254
79 3300005614 Ga0068856_100000326 Ga0068856_10000032625 254
80 3300005614 Ga0068856_100006226 Ga0068856_1000062265 254
81 3300005617 Ga0068859_100001151 Ga0068859_10000115112 254
82 3300005719 Ga0068861_100120476 Ga0068861_1001204762 254
83 3300005842 Ga0068858_100390618 Ga0068858_1003906182 254
84 3300005843 Ga0068860_100030343 Ga0068860_1000303434 254
85 3300006028 Ga0070717_10000016 Ga0070717_100000167 254
86 3300006358 Ga0068871_100093115 Ga0068871_1000931152 254
87 3300006358 Ga0068871_100538031 Ga0068871_1005380311 254
88 3300006881 Ga0068865_100040221 Ga0068865_1000402212 254
89 3300006881 Ga0068865_100158911 Ga0068865_1001589112 254
90 3300006931 Ga0097620_100001151 Ga0097620_10000115112 254
91 3300009093 Ga0105240_11000263 Ga0105240_110002631 254
92 3300009098 Ga0105245_10446331 Ga0105245_104463312 254
93 3300009147 Ga0114129_10237872 Ga0114129_102378722 254
94 3300009176 Ga0105242_10011055 Ga0105242_100110556 254
95 3300009177 Ga0105248_10000116 Ga0105248_1000011688 254
96 3300010375 Ga0105239_10574394 Ga0105239_105743942 254
97 3300013296 Ga0157374_10035317 Ga0157374_100353173 254
98 3300013297 Ga0157378_10289076 Ga0157378_102890762 254
99 3300013297 Ga0157378_10299360 Ga0157378_102993601 254
100 3300013306 Ga0163162_10035394 Ga0163162_100353942 254
101 3300013306 Ga0163162_10304339 Ga0163162_103043392 254
102 3300013306 Ga0163162_10370465 Ga0163162_103704652 254
103 3300013308 Ga0157375_10016995 Ga0157375_100169956 254
104 3300014325 Ga0163163_10158756 Ga0163163_101587562 254
105 3300014969 Ga0157376_10005528 Ga0157376_100055288 254
106 3300014969 Ga0157376_10054447 Ga0157376_100544472 254
107 3300021384 Ga0213876_10010457 Ga0213876_100104574 254
108 3300021384 Ga0213876_10185478 Ga0213876_101854782 254
109 3300025315 Ga0207697_10002689 Ga0207697_100026894 254
110 3300025893 Ga0207682_10195565 Ga0207682_101955652 254
111 3300025901 Ga0207688_10010661 Ga0207688_100106612 254
112 3300025901 Ga0207688_10083416 Ga0207688_100834162 254
113 3300025903 Ga0207680_10011058 Ga0207680_100110582 254
114 3300025907 Ga0207645_10005348 Ga0207645_100053487 254
115 3300025907 Ga0207645_10005672 Ga0207645_100056727 254
116 3300025909 Ga0207705_10002538 Ga0207705_100025383 254
117 3300025916 Ga0207663_10194891 Ga0207663_101948912 254
118 3300025919 Ga0207657_10374248 Ga0207657_103742482 254
119 3300025923 Ga0207681_10014723 Ga0207681_100147235 254
120 3300025923 Ga0207681_10086233 Ga0207681_100862332 254
121 3300025925 Ga0207650_10407931 Ga0207650_104079312 254
122 3300025926 Ga0207659_10023276 Ga0207659_100232762 254
123 3300025931 Ga0207644_10018760 Ga0207644_100187602 254
124 3300025931 Ga0207644_10028154 Ga0207644_100281542 254
125 3300025936 Ga0207670_10000024 Ga0207670_1000002413 254
126 3300025937 Ga0207669_10053266 Ga0207669_100532662 254
127 3300025945 Ga0207679_10046292 Ga0207679_100462922 254
128 3300025960 Ga0207651_10028421 Ga0207651_100284212 254
129 3300025972 Ga0207668_10016671 Ga0207668_100166711 254
130 3300025986 Ga0207658_10010967 Ga0207658_100109675 254
131 3300026023 Ga0207677_10052253 Ga0207677_100522532 254
132 3300026035 Ga0207703_10006408 Ga0207703_100064085 254
133 3300026035 Ga0207703_10329059 Ga0207703_103290592 254
134 3300026075 Ga0207708_10001757 Ga0207708_100017576 254
135 3300026078 Ga0207702_10000672 Ga0207702_1000067215 254
136 3300026078 Ga0207702_10001609 Ga0207702_100016094 254
137 3300026089 Ga0207648_10000502 Ga0207648_100005024 254
138 3300026089 Ga0207648_10041697 Ga0207648_100416972 254
139 3300026116 Ga0207674_10037711 Ga0207674_100377114 254
140 3300026121 Ga0207683_10012877 Ga0207683_100128775 254
141 3300028379 Ga0268266_10281669 Ga0268266_102816692 254
142 3300028381 Ga0268264_10387295 Ga0268264_103872952 254
143 3300028563 Ga0265319_1000130 Ga0265319_100013017 254
144 3300028563 Ga0265319_1006336 Ga0265319_10063364 254
145 3300028563 Ga0265319_1008936 Ga0265319_10089366 254
146 3300028563 Ga0265319_1018051 Ga0265319_10180513 254
147 3300028577 Ga0265318_10000190 Ga0265318_100001907 254
148 3300028577 Ga0265318_10000434 Ga0265318_100004344 254
149 3300028577 Ga0265318_10001069 Ga0265318_100010694 254
150 3300028577 Ga0265318_10003913 Ga0265318_100039135 254
151 3300028653 Ga0265323_10008972 Ga0265323_100089723 254
152 3300028654 Ga0265322_10026957 Ga0265322_100269572 254
153 3300031235 Ga0265330_10129043 Ga0265330_101290431 254
154 3300031240 Ga0265320_10000205 Ga0265320_100002054 254
155 3300031240 Ga0265320_10000412 Ga0265320_100004122 254
156 3300031240 Ga0265320_10008391 Ga0265320_100083912 254
157 3300031240 Ga0265320_10076817 Ga0265320_100768172 254
158 3300031240 Ga0265320_10167028 Ga0265320_101670281 254
159 3300031241 Ga0265325_10109344 Ga0265325_101093441 254
160 3300031251 Ga0265327_10015094 Ga0265327_100150944 254
161 3300031251 Ga0265327_10032181 Ga0265327_100321814 254
162 3300031251 Ga0265327_10218343 Ga0265327_102183431 254
163 3300031344 Ga0265316_10077020 Ga0265316_100770202 254
164 3300031344 Ga0265316_10081196 Ga0265316_100811961 254
165 3300031344 Ga0265316_10095417 Ga0265316_100954172 254
166 3300031507 Ga0307509_10376601 Ga0307509_103766011 254
167 3300031595 Ga0265313_10003592 Ga0265313_100035929 254
168 3300031595 Ga0265313_10019740 Ga0265313_100197403 254
169 3300031711 Ga0265314_10008930 Ga0265314_100089304 254
170 3300031711 Ga0265314_10148265 Ga0265314_101482652 254
171 3300031712 Ga0265342_10014564 Ga0265342_100145644 254
172 3300031712 Ga0265342_10040906 Ga0265342_100409063 254
173 3300035117 Ga0373953_0099625 Ga0373953_0099625_67_837 254
174 3300035119 Ga0373956_0067614 Ga0373956_0067614_630_1400 254
175 3300035410 Ga0373924_0011635 Ga0373924_0011635_1288_2058 254
176 3300036401 Ga0373937_0037149 Ga0373937_0037149_3249_4022 254
177 3300036401 Ga0373937_0053673 Ga0373937_0053673_1851_2621 254
178 3300037312 Ga0395899_0000349 Ga0395899_0000349_36162_36926 254
179 3300037466 Ga0395898_0000026 Ga0395898_0000026_54975_55739 254
180 3300037471 Ga0395905_0000119 Ga0395905_0000119_56086_56853 254
181 3300039437 Ga0436365_0395979 Ga0436365_0395979_3856_4629 254
182 3300039437 Ga0436365_0809833 Ga0436365_0809833_3951_4715 254
183 3300039450 Ga0436363_1651109 Ga0436363_1651109_562_1335 254
184 3300044683 Ga0466965_0059428 Ga0466965_0059428_1102_1866 254
185 3300044706 Ga0466964_0030857 Ga0466964_0030857_380_1144 254
186 3300044712 Ga0453684_0145170 Ga0453684_0145170_814_1581 254
187 3300044719 Ga0466971_0000020 Ga0466971_0000020_66403_67167 254
188 3300044719 Ga0466971_0215970 Ga0466971_0215970_17_784 254
189 3300044842 Ga0466957_0010671 Ga0466957_0010671_4221_4985 254
190 3300045051 Ga0451576_0002620 Ga0451576_0002620_9236_10003 254
191 3300045976 Ga0466967_0033254 Ga0466967_0033254_931_1698 254
192 3300045976 Ga0466967_0158652 Ga0466967_0158652_786_1550 254
193 3300046683 Ga0495658_0007689 Ga0495658_0007689_915_1691 254
194 3300047315 Ga0495581_0019021 Ga0495581_0019021_3164_3934 254
195 3300048912 Ga0496109_0191362 Ga0496109_0191362_241_1014 254
196 3300049568 Ga0501031_0000288 Ga0501031_0000288_7722_8486 254
197 3300049569 Ga0501032_0001389 Ga0501032_0001389_6930_7697 254
198 3300049569 Ga0501032_0008221 Ga0501032_0008221_4436_5200 254
199 3300049570 Ga0501033_0000021 Ga0501033_0000021_153799_154563 254
200 3300049570 Ga0501033_0000074 Ga0501033_0000074_64922_65686 254
201 3300049572 Ga0501036_0097728 Ga0501036_0097728_1073_1840 254
202 3300049572 Ga0501036_0110916 Ga0501036_0110916_289_1053 254
203 3300049573 Ga0501037_0000145 Ga0501037_0000145_11871_12635 254
204 3300049574 Ga0501038_0000559 Ga0501038_0000559_29755_30519 254
205 3300049574 Ga0501038_0046028 Ga0501038_0046028_1622_2386 254
206 3300049575 Ga0501039_0010884 Ga0501039_0010884_3210_3974 254
207 3300049579 Ga0501043_0002411 Ga0501043_0002411_3120_3884 254
208 3300049579 Ga0501043_0020306 Ga0501043_0020306_3232_3996 254
209 3300049580 Ga0501046_0160611 Ga0501046_0160611_582_1349 254
210 3300049581 Ga0501047_0005079 Ga0501047_0005079_758_1522 254
211 3300049582 Ga0501048_0127026 Ga0501048_0127026_566_1333 254
212 3300049586 Ga0501070_0007074 Ga0501070_0007074_18_782 254
213 3300049586 Ga0501070_0037843 Ga0501070_0037843_2568_3332 254
214 3300049586 Ga0501070_0192680 Ga0501070_0192680_894_1658 254
215 3300049675 Ga0501243_030354 Ga0501243_030354_32_799 254
216 3300049742 Ga0501080_0344787 Ga0501080_0344787_117_881 254
217 3300049822 Ga0501035_0000002 Ga0501035_0000002_467537_468301 254
218 3300049822 Ga0501035_0009323 Ga0501035_0009323_1445_2212 254
219 3300049823 Ga0501044_0011740 Ga0501044_0011740_169_936 254
220 3300049823 Ga0501044_0133610 Ga0501044_0133610_364_1128 254
221 3300050507 nmdc:mga05p37_242539_c1 nmdc:mga05p37_242539_c1_1139_1912 254
222 3300050511 nmdc:mga08y16_221484_c1 nmdc:mga08y16_221484_c1_208_975 254
223 3300053130 Ga0500642_0028868 Ga0500642_0028868_1345_2109 254
224 3300061719 Ga0466962_0000046 Ga0466962_0000046_29975_30739 254
225 3300005329 Ga0070683_100000678 Ga0070683_1000006787 255
226 3300005334 Ga0068869_100002769 Ga0068869_1000027692 255
227 3300005338 Ga0068868_100012435 Ga0068868_1000124355 255
228 3300005338 Ga0068868_100266815 Ga0068868_1002668152 255
229 3300005456 Ga0070678_100155992 Ga0070678_1001559922 255
230 3300005459 Ga0068867_100001590 Ga0068867_1000015906 255
231 3300005530 Ga0070679_100117285 Ga0070679_1001172852 255
232 3300005614 Ga0068856_100410002 Ga0068856_1004100022 255
233 3300006237 Ga0097621_100188320 Ga0097621_1001883202 255
234 3300006358 Ga0068871_100200118 Ga0068871_1002001182 255
235 3300009093 Ga0105240_10466353 Ga0105240_104663531 255
236 3300014325 Ga0163163_10036535 Ga0163163_100365352 255
237 3300025909 Ga0207705_10035323 Ga0207705_100353232 255
238 3300025913 Ga0207695_10411804 Ga0207695_104118041 255
239 3300025937 Ga0207669_10180151 Ga0207669_101801512 255
240 3300025942 Ga0207689_10006104 Ga0207689_100061047 255
241 3300025944 Ga0207661_10006991 Ga0207661_100069915 255
242 3300026023 Ga0207677_10004942 Ga0207677_100049424 255
243 3300026089 Ga0207648_10006026 Ga0207648_100060265 255
244 3300028563 Ga0265319_1002742 Ga0265319_10027421 255
245 3300028563 Ga0265319_1034134 Ga0265319_10341342 255
246 3300028573 Ga0265334_10016148 Ga0265334_100161482 255
247 3300028653 Ga0265323_10000080 Ga0265323_1000008017 255
248 3300028653 Ga0265323_10019478 Ga0265323_100194782 255
249 3300028653 Ga0265323_10030610 Ga0265323_100306102 255
250 3300028654 Ga0265322_10000087 Ga0265322_1000008718 255
251 3300028654 Ga0265322_10031861 Ga0265322_100318611 255
252 3300031249 Ga0265339_10127749 Ga0265339_101277492 255
253 3300031251 Ga0265327_10110433 Ga0265327_101104332 255
254 3300031344 Ga0265316_10002448 Ga0265316_1000244813 255
255 3300031344 Ga0265316_10016479 Ga0265316_100164792 255
256 3300031344 Ga0265316_10195405 Ga0265316_101954052 255
257 3300031548 Ga0307408_100000003 Ga0307408_100000003171 255
258 3300031595 Ga0265313_10005982 Ga0265313_100059826 255
259 3300031711 Ga0265314_10011865 Ga0265314_100118652 255
260 3300031712 Ga0265342_10019832 Ga0265342_100198323 255
261 3300031712 Ga0265342_10120158 Ga0265342_101201582 255
262 3300031731 Ga0307405_10069898 Ga0307405_100698981 255
263 3300031852 Ga0307410_10000002 Ga0307410_10000002136 255
264 3300031903 Ga0307407_10032914 Ga0307407_100329142 255
265 3300031911 Ga0307412_10116173 Ga0307412_101161732 255
266 3300031995 Ga0307409_100006527 Ga0307409_1000065276 255
267 3300032002 Ga0307416_100000057 Ga0307416_10000005790 255
268 3300042876 Ga0451577_0053670 Ga0451577_0053670_201_971 255
269 3300044673 Ga0453683_0000264 Ga0453683_0000264_34718_35488 255
270 3300044673 Ga0453683_0285282 Ga0453683_0285282_246_1016 255
271 3300045051 Ga0451576_0038620 Ga0451576_0038620_4134_4904 255
272 3300045051 Ga0451576_0177137 Ga0451576_0177137_270_1040 255
273 3300045051 Ga0451576_0557467 Ga0451576_0557467_314_1084 255
274 3300049161 Ga0501305_002501 Ga0501305_002501_1080_1850 255
275 3300049528 Ga0501312_006646 Ga0501312_006646_670_1440 255
276 3300049568 Ga0501031_0305684 Ga0501031_0305684_213_983 255
277 3300049569 Ga0501032_0001412 Ga0501032_0001412_11149_11919 255
278 3300049569 Ga0501032_0042438 Ga0501032_0042438_255_1025 255
279 3300049570 Ga0501033_0000882 Ga0501033_0000882_20512_21282 255
280 3300049570 Ga0501033_0001315 Ga0501033_0001315_489_1259 255
281 3300049571 Ga0501034_0147822 Ga0501034_0147822_411_1181 255
282 3300049572 Ga0501036_0075486 Ga0501036_0075486_1300_2070 255
283 3300049573 Ga0501037_0014516 Ga0501037_0014516_1012_1782 255
284 3300049573 Ga0501037_0019969 Ga0501037_0019969_1174_1944 255
285 3300049574 Ga0501038_0107487 Ga0501038_0107487_646_1416 255
286 3300049580 Ga0501046_0001090 Ga0501046_0001090_6926_7696 255
287 3300049581 Ga0501047_0263862 Ga0501047_0263862_767_1537 255
288 3300049582 Ga0501048_0119226 Ga0501048_0119226_791_1561 255
289 3300049586 Ga0501070_0242281 Ga0501070_0242281_335_1105 255
290 3300049586 Ga0501070_0480011 Ga0501070_0480011_200_970 255
291 3300049742 Ga0501080_0075037 Ga0501080_0075037_1832_2602 255
292 3300049742 Ga0501080_0104419 Ga0501080_0104419_628_1398 255
293 3300049744 Ga0501083_0001769 Ga0501083_0001769_12841_13611 255
294 3300049822 Ga0501035_0010122 Ga0501035_0010122_7154_7924 255
295 3300049823 Ga0501044_0009583 Ga0501044_0009583_262_1032 255
296 3300049823 Ga0501044_0062551 Ga0501044_0062551_755_1525 255
297 3300049824 Ga0501045_0428436 Ga0501045_0428436_11_781 255
298 3300060353 Ga0501082_0240301 Ga0501082_0240301_791_1561 255
299 3300005985 Ga0081539_10005759 Ga0081539_100057593 256
300 3300031711 Ga0265314_10038674 Ga0265314_100386743 256
301 3300002155 JGI24033J26618_1001440 JGI24033J26618_10014403 257
302 3300005344 Ga0070661_100003563 Ga0070661_1000035636 257
303 3300005354 Ga0070675_100088524 Ga0070675_1000885242 257
304 3300005356 Ga0070674_100172030 Ga0070674_1001720302 257
305 3300005366 Ga0070659_100060654 Ga0070659_1000606542 257
306 3300013296 Ga0157374_10013126 Ga0157374_100131264 257
307 3300013297 Ga0157378_10002900 Ga0157378_1000290015 257
308 3300013308 Ga0157375_10226262 Ga0157375_102262622 257
309 3300025919 Ga0207657_10437710 Ga0207657_104377101 257
310 3300025920 Ga0207649_10000291 Ga0207649_1000029119 257
311 3300025926 Ga0207659_10104309 Ga0207659_101043092 257
312 3300025932 Ga0207690_10040681 Ga0207690_100406813 257
313 3300026121 Ga0207683_10016886 Ga0207683_100168864 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

33

279

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9747 4 251
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9738 3 253
7rmn-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from verrucomicrobium spinosum 0.9708 4 255
6bve-assembly1.cif.gz_B triosephosphate isomerase of synechocystis in complex with 2-phosphoglycolic acid 0.9697 4 252
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9676 4 254
ID Description Score Start End Superfamily
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.972 44 253 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9697 4 252 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 4 254 3.20.20.70
af_A0A1D6KAX1_115_218_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.965 163 243 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9638 4 254 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6GZS1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9988 82 257 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7S4TA46-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9986 125 250 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A645DQY7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9984 97 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-T2RDA1-F1-model_v4 deleted 0.9977 86 251
AF-K1SGB4-F1-model_v4 Triose-phosphate isomerase 0.9972 109 256 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Feature Viewer

pLDDT pTM Quality
92.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map