F402121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 189 | 310 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100200118|Ga0068871_1002001182 |
| Length | 283 |
| Sequence | MMLATPPRAPAVFLLATHYSLLTTFPNMSIRKKLIAGNWKMNKTSADAVALVQELVSEIGKQTDVEVVVAPPFTSIESVGKVLDGSVIKLGAQNVHPEASGAYTGEISVGMLRSIFTNYVILGHSERRTYFKETDAFINQKVLASLKGQLKPILCVGETLAEREGNQTLKVVQTQLEAGLEGVSKDLATSVVIAYEPVWAIGTGKVATTEQAQEVHAFIRSLLVKLFGDATAQKVRILYGGSMKPSNAPELLTQKDIDGGLIGGASLESRSFVDLIKAAAAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 2 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 3 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 186 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 187 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.4 |
| Metatranscriptomes | 0.64 |
| Isolates | 0.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 93.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1001440 | 3300002155 | Bacteria | 2359 |
| 2 | rootH2_10014581 | 3300003320 | Bacteria | 7004 |
| 3 | rootH2_10018539 | 3300003320 | Bacteria | 22550 |
| 4 | rootL2_10038826 | 3300003322 | Bacteria | 2343 |
| 5 | rootH1_10052629 | 3300003323 | Bacteria | 8510 |
| 6 | Ga0070658_10012826 | 3300005327 | Bacteria | 6725 |
| 7 | Ga0070676_10003308 | 3300005328 | Bacteria | 8378 |
| 8 | Ga0070683_100000678 | 3300005329 | Bacteria | 24650 |
| 9 | Ga0070683_100168274 | 3300005329 | Bacteria | 2080 |
| 10 | Ga0070690_100000961 | 3300005330 | Bacteria | 14652 |
| 11 | Ga0070670_100592285 | 3300005331 | Bacteria | 992 |
| 12 | Ga0068869_100002769 | 3300005334 | Bacteria | 10617 |
| 13 | Ga0070666_10024786 | 3300005335 | Bacteria | 3910 |
| 14 | Ga0070680_100339016 | 3300005336 | Bacteria | 1277 |
| 15 | Ga0068868_100012435 | 3300005338 | Bacteria | 6222 |
| 16 | Ga0068868_100057754 | 3300005338 | Bacteria | 3066 |
| 17 | Ga0068868_100188617 | 3300005338 | Bacteria | 1714 |
| 18 | Ga0068868_100266815 | 3300005338 | Bacteria | 1445 |
| 19 | Ga0070660_100047966 | 3300005339 | Bacteria | 3279 |
| 20 | Ga0070689_100000034 | 3300005340 | Bacteria | 91533 |
| 21 | Ga0070689_100036470 | 3300005340 | Bacteria | 3761 |
| 22 | Ga0070687_100003383 | 3300005343 | Bacteria | 6189 |
| 23 | Ga0070661_100003563 | 3300005344 | Bacteria | 10720 |
| 24 | Ga0070668_100012036 | 3300005347 | Bacteria | 6443 |
| 25 | Ga0070669_100010670 | 3300005353 | Bacteria | 6519 |
| 26 | Ga0070669_100211952 | 3300005353 | Bacteria | 1529 |
| 27 | Ga0070675_100025623 | 3300005354 | Bacteria | 4728 |
| 28 | Ga0070675_100088524 | 3300005354 | Bacteria | 2591 |
| 29 | Ga0070671_100001696 | 3300005355 | Bacteria | 16716 |
| 30 | Ga0070671_100030423 | 3300005355 | Bacteria | 4455 |
| 31 | Ga0070671_100589721 | 3300005355 | Bacteria | 960 |
| 32 | Ga0070674_100021101 | 3300005356 | Bacteria | 4176 |
| 33 | Ga0070674_100077671 | 3300005356 | Bacteria | 2364 |
| 34 | Ga0070674_100172030 | 3300005356 | Bacteria | 1652 |
| 35 | Ga0070673_100085101 | 3300005364 | Bacteria | 2573 |
| 36 | Ga0070673_100384914 | 3300005364 | Bacteria | 1251 |
| 37 | Ga0070688_100001523 | 3300005365 | Bacteria | 11571 |
| 38 | Ga0070659_100060654 | 3300005366 | Bacteria | 2988 |
| 39 | Ga0070667_100008641 | 3300005367 | Bacteria | 8441 |
| 40 | Ga0070667_100019801 | 3300005367 | Bacteria | 5583 |
| 41 | Ga0070667_100651278 | 3300005367 | Bacteria | 973 |
| 42 | Ga0070710_10031738 | 3300005437 | Bacteria | 2855 |
| 43 | Ga0070701_10000354 | 3300005438 | Bacteria | 15249 |
| 44 | Ga0070700_100001338 | 3300005441 | Bacteria | 12254 |
| 45 | Ga0070678_100027103 | 3300005456 | Bacteria | 3886 |
| 46 | Ga0070678_100032667 | 3300005456 | Bacteria | 3604 |
| 47 | Ga0070678_100155992 | 3300005456 | Bacteria | 1844 |
| 48 | Ga0068867_100000837 | 3300005459 | Bacteria | 20701 |
| 49 | Ga0068867_100001590 | 3300005459 | Bacteria | 15778 |
| 50 | Ga0068867_100032706 | 3300005459 | Bacteria | 3763 |
| 51 | Ga0070685_10000278 | 3300005466 | Bacteria | 32947 |
| 52 | Ga0070699_100350983 | 3300005518 | Bacteria | 1329 |
| 53 | Ga0070679_100117285 | 3300005530 | Bacteria | 2647 |
| 54 | Ga0070672_100018454 | 3300005543 | Bacteria | 5044 |
| 55 | Ga0070672_100042393 | 3300005543 | Bacteria | 3504 |
| 56 | Ga0070686_100000053 | 3300005544 | Bacteria | 95565 |
| 57 | Ga0070665_100018595 | 3300005548 | Bacteria | 6964 |
| 58 | Ga0070665_100136672 | 3300005548 | Bacteria | 2454 |
| 59 | Ga0070665_100206681 | 3300005548 | Bacteria | 1964 |
| 60 | Ga0070664_100038634 | 3300005564 | Bacteria | 4019 |
| 61 | Ga0068857_100037001 | 3300005577 | Bacteria | 4323 |
| 62 | Ga0068856_100000326 | 3300005614 | Bacteria | 52440 |
| 63 | Ga0068856_100006226 | 3300005614 | Bacteria | 11709 |
| 64 | Ga0068856_100410002 | 3300005614 | Bacteria | 1375 |
| 65 | Ga0068859_100001151 | 3300005617 | Bacteria | 26989 |
| 66 | Ga0068861_100120476 | 3300005719 | Bacteria | 2116 |
| 67 | Ga0068858_100390618 | 3300005842 | Bacteria | 1336 |
| 68 | Ga0068860_100030343 | 3300005843 | Bacteria | 5200 |
| 69 | Ga0081539_10005759 | 3300005985 | Bacteria | 12366 |
| 70 | Ga0070717_10000016 | 3300006028 | Bacteria | 205932 |
| 71 | Ga0097621_100188320 | 3300006237 | Bacteria | 1786 |
| 72 | Ga0068871_100093115 | 3300006358 | Bacteria | 2513 |
| 73 | Ga0068871_100200118 | 3300006358 | Bacteria | 1724 |
| 74 | Ga0068871_100538031 | 3300006358 | Bacteria | 1057 |
| 75 | Ga0068865_100040221 | 3300006881 | Bacteria | 3175 |
| 76 | Ga0068865_100158911 | 3300006881 | Bacteria | 1722 |
| 77 | Ga0097620_100001151 | 3300006931 | Bacteria | 26989 |
| 78 | Ga0105240_10466353 | 3300009093 | Bacteria | 1410 |
| 79 | Ga0105240_11000263 | 3300009093 | Bacteria | 894 |
| 80 | Ga0105245_10446331 | 3300009098 | Bacteria | 1301 |
| 81 | Ga0114129_10237872 | 3300009147 | Bacteria | 2449 |
| 82 | Ga0105242_10011055 | 3300009176 | Bacteria | 6935 |
| 83 | Ga0105248_10000116 | 3300009177 | Bacteria | 90171 |
| 84 | Ga0105239_10574394 | 3300010375 | Bacteria | 1285 |
| 85 | Ga0157374_10013126 | 3300013296 | Bacteria | 7226 |
| 86 | Ga0157374_10035317 | 3300013296 | Bacteria | 4573 |
| 87 | Ga0157378_10002900 | 3300013297 | Bacteria | 15262 |
| 88 | Ga0157378_10289076 | 3300013297 | Bacteria | 1583 |
| 89 | Ga0157378_10299360 | 3300013297 | Bacteria | 1556 |
| 90 | Ga0163162_10035394 | 3300013306 | Bacteria | 4974 |
| 91 | Ga0163162_10304339 | 3300013306 | Bacteria | 1726 |
| 92 | Ga0163162_10370465 | 3300013306 | Bacteria | 1565 |
| 93 | Ga0157372_10296637 | 3300013307 | Bacteria | 1880 |
| 94 | Ga0157375_10016995 | 3300013308 | Bacteria | 6554 |
| 95 | Ga0157375_10226262 | 3300013308 | Bacteria | 2029 |
| 96 | Ga0163163_10036535 | 3300014325 | Bacteria | 4773 |
| 97 | Ga0163163_10158756 | 3300014325 | Bacteria | 2306 |
| 98 | Ga0157376_10005528 | 3300014969 | Bacteria | 8832 |
| 99 | Ga0157376_10054447 | 3300014969 | Bacteria | 3335 |
| 100 | Ga0163161_10115401 | 3300017792 | Bacteria | 2012 |
| 101 | Ga0213876_10010457 | 3300021384 | Bacteria | 4977 |
| 102 | Ga0213876_10185478 | 3300021384 | Bacteria | 1106 |
| 103 | Ga0207673_1006491 | 3300025290 | Bacteria | 1449 |
| 104 | Ga0209050_1000236 | 3300025298 | Bacteria | 120719 |
| 105 | Ga0207697_10000163 | 3300025315 | Bacteria | 33514 |
| 106 | Ga0207697_10002689 | 3300025315 | Bacteria | 9085 |
| 107 | Ga0207682_10195565 | 3300025893 | Bacteria | 928 |
| 108 | Ga0207688_10010661 | 3300025901 | Bacteria | 4999 |
| 109 | Ga0207688_10083416 | 3300025901 | Bacteria | 1828 |
| 110 | Ga0207680_10011058 | 3300025903 | Bacteria | 4545 |
| 111 | Ga0207645_10005348 | 3300025907 | Bacteria | 9333 |
| 112 | Ga0207645_10005672 | 3300025907 | Bacteria | 9016 |
| 113 | Ga0207705_10002538 | 3300025909 | Bacteria | 14060 |
| 114 | Ga0207705_10035323 | 3300025909 | Bacteria | 3576 |
| 115 | Ga0207695_10411804 | 3300025913 | Bacteria | 1236 |
| 116 | Ga0207663_10194891 | 3300025916 | Bacteria | 1457 |
| 117 | Ga0207657_10374248 | 3300025919 | Bacteria | 1122 |
| 118 | Ga0207657_10437710 | 3300025919 | Bacteria | 1026 |
| 119 | Ga0207649_10000291 | 3300025920 | Bacteria | 38912 |
| 120 | Ga0207681_10014723 | 3300025923 | Bacteria | 4869 |
| 121 | Ga0207681_10086233 | 3300025923 | Bacteria | 2230 |
| 122 | Ga0207650_10407931 | 3300025925 | Bacteria | 1126 |
| 123 | Ga0207659_10023276 | 3300025926 | Bacteria | 4132 |
| 124 | Ga0207659_10104309 | 3300025926 | Bacteria | 2144 |
| 125 | Ga0207644_10018760 | 3300025931 | Bacteria | 4684 |
| 126 | Ga0207644_10028154 | 3300025931 | Bacteria | 3887 |
| 127 | Ga0207690_10040681 | 3300025932 | Bacteria | 3041 |
| 128 | Ga0207670_10000024 | 3300025936 | Bacteria | 143058 |
| 129 | Ga0207669_10053266 | 3300025937 | Bacteria | 2436 |
| 130 | Ga0207669_10180151 | 3300025937 | Bacteria | 1514 |
| 131 | Ga0207691_10001207 | 3300025940 | Bacteria | 25737 |
| 132 | Ga0207689_10006104 | 3300025942 | Bacteria | 10657 |
| 133 | Ga0207661_10006991 | 3300025944 | Bacteria | 8003 |
| 134 | Ga0207679_10046292 | 3300025945 | Bacteria | 3152 |
| 135 | Ga0207651_10028421 | 3300025960 | Bacteria | 3527 |
| 136 | Ga0207668_10016671 | 3300025972 | Bacteria | 4589 |
| 137 | Ga0207658_10010967 | 3300025986 | Bacteria | 6170 |
| 138 | Ga0207677_10004942 | 3300026023 | Bacteria | 7201 |
| 139 | Ga0207677_10052253 | 3300026023 | Bacteria | 2775 |
| 140 | Ga0207703_10006408 | 3300026035 | Bacteria | 9405 |
| 141 | Ga0207703_10329059 | 3300026035 | Bacteria | 1401 |
| 142 | Ga0207708_10001757 | 3300026075 | Bacteria | 16003 |
| 143 | Ga0207702_10000672 | 3300026078 | Bacteria | 37239 |
| 144 | Ga0207702_10001609 | 3300026078 | Bacteria | 22347 |
| 145 | Ga0207648_10000502 | 3300026089 | Bacteria | 43633 |
| 146 | Ga0207648_10006026 | 3300026089 | Bacteria | 12089 |
| 147 | Ga0207648_10041697 | 3300026089 | Bacteria | 4031 |
| 148 | Ga0207674_10037711 | 3300026116 | Bacteria | 5023 |
| 149 | Ga0207683_10012877 | 3300026121 | Bacteria | 7139 |
| 150 | Ga0207683_10016886 | 3300026121 | Bacteria | 6211 |
| 151 | Ga0268266_10281669 | 3300028379 | Bacteria | 1546 |
| 152 | Ga0268264_10387295 | 3300028381 | Bacteria | 1340 |
| 153 | Ga0265319_1000130 | 3300028563 | Bacteria | 55833 |
| 154 | Ga0265319_1002742 | 3300028563 | Bacteria | 9455 |
| 155 | Ga0265319_1006336 | 3300028563 | Bacteria | 5495 |
| 156 | Ga0265319_1008936 | 3300028563 | Bacteria | 4330 |
| 157 | Ga0265319_1018051 | 3300028563 | Bacteria | 2669 |
| 158 | Ga0265319_1034134 | 3300028563 | Bacteria | 1753 |
| 159 | Ga0265334_10016148 | 3300028573 | Bacteria | 3089 |
| 160 | Ga0265318_10000190 | 3300028577 | Bacteria | 54275 |
| 161 | Ga0265318_10000434 | 3300028577 | Bacteria | 31774 |
| 162 | Ga0265318_10001069 | 3300028577 | Bacteria | 17274 |
| 163 | Ga0265318_10003913 | 3300028577 | Bacteria | 7338 |
| 164 | Ga0265318_10124037 | 3300028577 | Bacteria | 950 |
| 165 | Ga0265323_10000080 | 3300028653 | Bacteria | 54790 |
| 166 | Ga0265323_10008972 | 3300028653 | Bacteria | 4105 |
| 167 | Ga0265323_10019478 | 3300028653 | Bacteria | 2616 |
| 168 | Ga0265323_10030610 | 3300028653 | Bacteria | 2004 |
| 169 | Ga0265322_10000087 | 3300028654 | Bacteria | 43593 |
| 170 | Ga0265322_10026957 | 3300028654 | Bacteria | 1642 |
| 171 | Ga0265322_10031861 | 3300028654 | Bacteria | 1504 |
| 172 | Ga0265330_10129043 | 3300031235 | Bacteria | 1076 |
| 173 | Ga0265320_10000205 | 3300031240 | Bacteria | 47959 |
| 174 | Ga0265320_10000412 | 3300031240 | Bacteria | 34014 |
| 175 | Ga0265320_10008391 | 3300031240 | Bacteria | 6325 |
| 176 | Ga0265320_10076817 | 3300031240 | Bacteria | 1564 |
| 177 | Ga0265320_10167028 | 3300031240 | Bacteria | 989 |
| 178 | Ga0265325_10109344 | 3300031241 | Bacteria | 1345 |
| 179 | Ga0265339_10127749 | 3300031249 | Bacteria | 1302 |
| 180 | Ga0265327_10015094 | 3300031251 | Bacteria | 5009 |
| 181 | Ga0265327_10032181 | 3300031251 | Bacteria | 2937 |
| 182 | Ga0265327_10110433 | 3300031251 | Bacteria | 1315 |
| 183 | Ga0265327_10218343 | 3300031251 | Bacteria | 858 |
| 184 | Ga0265316_10002448 | 3300031344 | Bacteria | 19259 |
| 185 | Ga0265316_10016479 | 3300031344 | Bacteria | 6407 |
| 186 | Ga0265316_10077020 | 3300031344 | Bacteria | 2561 |
| 187 | Ga0265316_10081196 | 3300031344 | Bacteria | 2486 |
| 188 | Ga0265316_10095417 | 3300031344 | Bacteria | 2265 |
| 189 | Ga0265316_10195405 | 3300031344 | Bacteria | 1502 |
| 190 | Ga0307509_10376601 | 3300031507 | Bacteria | 1134 |
| 191 | Ga0307408_100000003 | 3300031548 | Bacteria | 618438 |
| 192 | Ga0265313_10003592 | 3300031595 | Bacteria | 12461 |
| 193 | Ga0265313_10005982 | 3300031595 | Bacteria | 8790 |
| 194 | Ga0265313_10019740 | 3300031595 | Bacteria | 3740 |
| 195 | Ga0265314_10008930 | 3300031711 | Bacteria | 8537 |
| 196 | Ga0265314_10011865 | 3300031711 | Bacteria | 7158 |
| 197 | Ga0265314_10038674 | 3300031711 | Bacteria | 3444 |
| 198 | Ga0265314_10148265 | 3300031711 | Bacteria | 1442 |
| 199 | Ga0265342_10014564 | 3300031712 | Bacteria | 5216 |
| 200 | Ga0265342_10019832 | 3300031712 | Bacteria | 4325 |
| 201 | Ga0265342_10040906 | 3300031712 | Bacteria | 2809 |
| 202 | Ga0265342_10120158 | 3300031712 | Bacteria | 1480 |
| 203 | Ga0307405_10069898 | 3300031731 | Bacteria | 2253 |
| 204 | Ga0307410_10000002 | 3300031852 | Bacteria | 145309 |
| 205 | Ga0307407_10032914 | 3300031903 | Bacteria | 2823 |
| 206 | Ga0307412_10116173 | 3300031911 | Bacteria | 1919 |
| 207 | Ga0307409_100006527 | 3300031995 | Bacteria | 6867 |
| 208 | Ga0307416_100000057 | 3300032002 | Bacteria | 105624 |
| 209 | Ga0307414_10020785 | 3300032004 | Bacteria | 4100 |
| 210 | Ga0307414_10743171 | 3300032004 | Bacteria | 891 |
| 211 | Ga0373953_0099625 | 3300035117 | Bacteria | 1222 |
| 212 | Ga0373956_0067614 | 3300035119 | Bacteria | 1627 |
| 213 | Ga0373924_0011635 | 3300035410 | Bacteria | 3272 |
| 214 | Ga0373937_0037149 | 3300036401 | Bacteria | 4439 |
| 215 | Ga0373937_0053673 | 3300036401 | Bacteria | 3697 |
| 216 | Ga0395899_0000349 | 3300037312 | Bacteria | 56957 |
| 217 | Ga0395898_0000026 | 3300037466 | Bacteria | 374440 |
| 218 | Ga0395905_0000119 | 3300037471 | Bacteria | 131498 |
| 219 | Ga0436365_0395979 | 3300039437 | Bacteria | 10769 |
| 220 | Ga0436365_0809833 | 3300039437 | Bacteria | 4967 |
| 221 | Ga0436363_1651109 | 3300039450 | Unclassified | 2128 |
| 222 | Ga0451853_0171139 | 3300041512 | Bacteria | 1291 |
| 223 | Ga0451577_0053670 | 3300042876 | Bacteria | 3598 |
| 224 | Ga0453683_0000264 | 3300044673 | Bacteria | 68669 |
| 225 | Ga0453683_0285282 | 3300044673 | Bacteria | 1055 |
| 226 | Ga0466965_0059428 | 3300044683 | Bacteria | 1908 |
| 227 | Ga0466964_0030857 | 3300044706 | Bacteria | 2123 |
| 228 | Ga0453684_0000045 | 3300044712 | Bacteria | 582917 |
| 229 | Ga0453684_0145170 | 3300044712 | Unclassified | 2828 |
| 230 | Ga0466971_0000020 | 3300044719 | Bacteria | 78865 |
| 231 | Ga0466971_0215970 | 3300044719 | Bacteria | 908 |
| 232 | Ga0466957_0010671 | 3300044842 | Bacteria | 5280 |
| 233 | Ga0451576_0002620 | 3300045051 | Bacteria | 26319 |
| 234 | Ga0451576_0038620 | 3300045051 | Bacteria | 5053 |
| 235 | Ga0451576_0177137 | 3300045051 | Bacteria | 2226 |
| 236 | Ga0451576_0557467 | 3300045051 | Bacteria | 1204 |
| 237 | Ga0466967_0033254 | 3300045976 | Bacteria | 4363 |
| 238 | Ga0466967_0158652 | 3300045976 | Bacteria | 2122 |
| 239 | Ga0495627_009609 | 3300046453 | Bacteria | 3551 |
| 240 | Ga0495580_0129200 | 3300046472 | Bacteria | 1753 |
| 241 | Ga0495594_0240296 | 3300046499 | Bacteria | 1032 |
| 242 | Ga0495607_0010818 | 3300046501 | Bacteria | 6105 |
| 243 | Ga0495606_0366092 | 3300046507 | Bacteria | 760 |
| 244 | Ga0495616_0030534 | 3300046513 | Bacteria | 2831 |
| 245 | Ga0495643_0001055 | 3300046522 | Bacteria | 27762 |
| 246 | Ga0495625_0010644 | 3300046660 | Bacteria | 7581 |
| 247 | Ga0495588_0027351 | 3300046674 | Bacteria | 2851 |
| 248 | Ga0495658_0007689 | 3300046683 | Bacteria | 5341 |
| 249 | Ga0495581_0019021 | 3300047315 | Bacteria | 3986 |
| 250 | Ga0495676_0115055 | 3300047321 | Bacteria | 1967 |
| 251 | Ga0496109_0191362 | 3300048912 | Bacteria | 1923 |
| 252 | Ga0496115_0017679 | 3300048918 | Bacteria | 5458 |
| 253 | Ga0496125_0001048 | 3300048928 | Bacteria | 42722 |
| 254 | Ga0496126_0009112 | 3300048929 | Bacteria | 10596 |
| 255 | Ga0501305_002501 | 3300049161 | Bacteria | 1993 |
| 256 | Ga0501312_006646 | 3300049528 | Bacteria | 1451 |
| 257 | Ga0501031_0000288 | 3300049568 | Bacteria | 28555 |
| 258 | Ga0501031_0305684 | 3300049568 | Bacteria | 1030 |
| 259 | Ga0501032_0001389 | 3300049569 | Bacteria | 19217 |
| 260 | Ga0501032_0001412 | 3300049569 | Bacteria | 19072 |
| 261 | Ga0501032_0008221 | 3300049569 | Bacteria | 7603 |
| 262 | Ga0501032_0042438 | 3300049569 | Bacteria | 3085 |
| 263 | Ga0501033_0000021 | 3300049570 | Bacteria | 192208 |
| 264 | Ga0501033_0000074 | 3300049570 | Bacteria | 94345 |
| 265 | Ga0501033_0000882 | 3300049570 | Bacteria | 27415 |
| 266 | Ga0501033_0001315 | 3300049570 | Bacteria | 22076 |
| 267 | Ga0501034_0147822 | 3300049571 | Bacteria | 2326 |
| 268 | Ga0501036_0075486 | 3300049572 | Bacteria | 2850 |
| 269 | Ga0501036_0097728 | 3300049572 | Bacteria | 2482 |
| 270 | Ga0501036_0110916 | 3300049572 | Bacteria | 2318 |
| 271 | Ga0501037_0000145 | 3300049573 | Bacteria | 66010 |
| 272 | Ga0501037_0014516 | 3300049573 | Bacteria | 5794 |
| 273 | Ga0501037_0019969 | 3300049573 | Bacteria | 4945 |
| 274 | Ga0501038_0000559 | 3300049574 | Bacteria | 32919 |
| 275 | Ga0501038_0046028 | 3300049574 | Bacteria | 3784 |
| 276 | Ga0501038_0107487 | 3300049574 | Bacteria | 2314 |
| 277 | Ga0501039_0010884 | 3300049575 | Bacteria | 6933 |
| 278 | Ga0501043_0002411 | 3300049579 | Bacteria | 15826 |
| 279 | Ga0501043_0020306 | 3300049579 | Bacteria | 5211 |
| 280 | Ga0501046_0001090 | 3300049580 | Bacteria | 26582 |
| 281 | Ga0501046_0160611 | 3300049580 | Bacteria | 1690 |
| 282 | Ga0501047_0005079 | 3300049581 | Bacteria | 12352 |
| 283 | Ga0501047_0263862 | 3300049581 | Bacteria | 1569 |
| 284 | Ga0501048_0119226 | 3300049582 | Bacteria | 1864 |
| 285 | Ga0501048_0127026 | 3300049582 | Bacteria | 1803 |
| 286 | Ga0501070_0007074 | 3300049586 | Bacteria | 9544 |
| 287 | Ga0501070_0037843 | 3300049586 | Bacteria | 4027 |
| 288 | Ga0501070_0192680 | 3300049586 | Bacteria | 1675 |
| 289 | Ga0501070_0242281 | 3300049586 | Bacteria | 1476 |
| 290 | Ga0501070_0480011 | 3300049586 | Bacteria | 1000 |
| 291 | Ga0501243_030354 | 3300049675 | Bacteria | 920 |
| 292 | Ga0501080_0075037 | 3300049742 | Bacteria | 3146 |
| 293 | Ga0501080_0104419 | 3300049742 | Bacteria | 2628 |
| 294 | Ga0501080_0344787 | 3300049742 | Bacteria | 1346 |
| 295 | Ga0501083_0001769 | 3300049744 | Bacteria | 14763 |
| 296 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 297 | Ga0501035_0009323 | 3300049822 | Bacteria | 9121 |
| 298 | Ga0501035_0010122 | 3300049822 | Bacteria | 8752 |
| 299 | Ga0501044_0009583 | 3300049823 | Bacteria | 10541 |
| 300 | Ga0501044_0011740 | 3300049823 | Bacteria | 9488 |
| 301 | Ga0501044_0062551 | 3300049823 | Bacteria | 3804 |
| 302 | Ga0501044_0133610 | 3300049823 | Bacteria | 2474 |
| 303 | Ga0501045_0428436 | 3300049824 | Bacteria | 984 |
| 304 | nmdc:mga05p37_242539_c1 | 3300050507 | Bacteria | 2166 |
| 305 | nmdc:mga08y16_221484_c1 | 3300050511 | Bacteria | 1958 |
| 306 | Ga0500646_0028422 | 3300053090 | Bacteria | 1526 |
| 307 | Ga0500641_0000092 | 3300053096 | Bacteria | 34933 |
| 308 | Ga0500642_0028868 | 3300053130 | Bacteria | 2293 |
| 309 | Ga0501082_0240301 | 3300060353 | Bacteria | 1576 |
| 310 | Ga0466962_0000046 | 3300061719 | Bacteria | 52219 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028577 | Ga0265318_10124037 | Ga0265318_101240371 | 239 |
| 2 | 3300046507 | Ga0495606_0366092 | Ga0495606_0366092_28_747 | 239 |
| 3 | 3300005328 | Ga0070676_10003308 | Ga0070676_100033082 | 241 |
| 4 | 3300005347 | Ga0070668_100012036 | Ga0070668_1000120362 | 241 |
| 5 | 3300005353 | Ga0070669_100010670 | Ga0070669_1000106702 | 241 |
| 6 | 3300005356 | Ga0070674_100077671 | Ga0070674_1000776712 | 241 |
| 7 | 3300005548 | Ga0070665_100136672 | Ga0070665_1001366722 | 241 |
| 8 | 3300025290 | Ga0207673_1006491 | Ga0207673_10064911 | 241 |
| 9 | 3300025298 | Ga0209050_1000236 | Ga0209050_100023632 | 241 |
| 10 | 3300025315 | Ga0207697_10000163 | Ga0207697_100001632 | 241 |
| 11 | 3300025940 | Ga0207691_10001207 | Ga0207691_100012072 | 241 |
| 12 | iso_pu_bacteria | 2881247448 | 2881248429 | 246 |
| 13 | 3300032004 | Ga0307414_10020785 | Ga0307414_100207853 | 250 |
| 14 | 3300032004 | Ga0307414_10743171 | Ga0307414_107431712 | 250 |
| 15 | 3300046513 | Ga0495616_0030534 | Ga0495616_0030534_1142_1894 | 250 |
| 16 | 3300046522 | Ga0495643_0001055 | Ga0495643_0001055_25568_26320 | 250 |
| 17 | 3300046660 | Ga0495625_0010644 | Ga0495625_0010644_1154_1906 | 250 |
| 18 | 3300048918 | Ga0496115_0017679 | Ga0496115_0017679_4410_5162 | 250 |
| 19 | 3300048928 | Ga0496125_0001048 | Ga0496125_0001048_39070_39822 | 250 |
| 20 | 3300048929 | Ga0496126_0009112 | Ga0496126_0009112_2802_3554 | 250 |
| 21 | 3300053090 | Ga0500646_0028422 | Ga0500646_0028422_692_1444 | 250 |
| 22 | 3300053096 | Ga0500641_0000092 | Ga0500641_0000092_13810_14562 | 250 |
| 23 | iso_pu_bacteria | 2786546548 | 2787509096 | 250 |
| 24 | iso_pu_bacteria | 2786546940 | 2788435644 | 250 |
| 25 | 3300005329 | Ga0070683_100168274 | Ga0070683_1001682743 | 251 |
| 26 | 3300013307 | Ga0157372_10296637 | Ga0157372_102966372 | 251 |
| 27 | 3300017792 | Ga0163161_10115401 | Ga0163161_101154012 | 251 |
| 28 | 3300046453 | Ga0495627_009609 | Ga0495627_009609_1792_2547 | 251 |
| 29 | 3300005518 | Ga0070699_100350983 | Ga0070699_1003509832 | 252 |
| 30 | 3300041512 | Ga0451853_0171139 | Ga0451853_0171139_381_1139 | 252 |
| 31 | 3300046472 | Ga0495580_0129200 | Ga0495580_0129200_257_1024 | 252 |
| 32 | 3300046499 | Ga0495594_0240296 | Ga0495594_0240296_253_1020 | 252 |
| 33 | 3300046674 | Ga0495588_0027351 | Ga0495588_0027351_726_1493 | 252 |
| 34 | 3300047321 | Ga0495676_0115055 | Ga0495676_0115055_524_1291 | 252 |
| 35 | 3300044712 | Ga0453684_0000045 | Ga0453684_0000045_462161_462928 | 253 |
| 36 | 3300046501 | Ga0495607_0010818 | Ga0495607_0010818_1814_2575 | 253 |
| 37 | 3300003320 | rootH2_10014581 | rootH2_100145812 | 254 |
| 38 | 3300003320 | rootH2_10018539 | rootH2_1001853923 | 254 |
| 39 | 3300003322 | rootL2_10038826 | rootL2_100388262 | 254 |
| 40 | 3300003323 | rootH1_10052629 | rootH1_100526292 | 254 |
| 41 | 3300005327 | Ga0070658_10012826 | Ga0070658_100128263 | 254 |
| 42 | 3300005330 | Ga0070690_100000961 | Ga0070690_10000096113 | 254 |
| 43 | 3300005331 | Ga0070670_100592285 | Ga0070670_1005922851 | 254 |
| 44 | 3300005335 | Ga0070666_10024786 | Ga0070666_100247862 | 254 |
| 45 | 3300005336 | Ga0070680_100339016 | Ga0070680_1003390161 | 254 |
| 46 | 3300005338 | Ga0068868_100057754 | Ga0068868_1000577543 | 254 |
| 47 | 3300005338 | Ga0068868_100188617 | Ga0068868_1001886172 | 254 |
| 48 | 3300005339 | Ga0070660_100047966 | Ga0070660_1000479662 | 254 |
| 49 | 3300005340 | Ga0070689_100000034 | Ga0070689_10000003486 | 254 |
| 50 | 3300005340 | Ga0070689_100036470 | Ga0070689_1000364704 | 254 |
| 51 | 3300005343 | Ga0070687_100003383 | Ga0070687_1000033835 | 254 |
| 52 | 3300005353 | Ga0070669_100211952 | Ga0070669_1002119522 | 254 |
| 53 | 3300005354 | Ga0070675_100025623 | Ga0070675_1000256235 | 254 |
| 54 | 3300005355 | Ga0070671_100001696 | Ga0070671_10000169615 | 254 |
| 55 | 3300005355 | Ga0070671_100030423 | Ga0070671_1000304234 | 254 |
| 56 | 3300005355 | Ga0070671_100589721 | Ga0070671_1005897212 | 254 |
| 57 | 3300005356 | Ga0070674_100021101 | Ga0070674_1000211014 | 254 |
| 58 | 3300005364 | Ga0070673_100085101 | Ga0070673_1000851012 | 254 |
| 59 | 3300005364 | Ga0070673_100384914 | Ga0070673_1003849141 | 254 |
| 60 | 3300005365 | Ga0070688_100001523 | Ga0070688_10000152310 | 254 |
| 61 | 3300005367 | Ga0070667_100008641 | Ga0070667_1000086413 | 254 |
| 62 | 3300005367 | Ga0070667_100019801 | Ga0070667_1000198014 | 254 |
| 63 | 3300005367 | Ga0070667_100651278 | Ga0070667_1006512782 | 254 |
| 64 | 3300005437 | Ga0070710_10031738 | Ga0070710_100317383 | 254 |
| 65 | 3300005438 | Ga0070701_10000354 | Ga0070701_100003547 | 254 |
| 66 | 3300005441 | Ga0070700_100001338 | Ga0070700_1000013385 | 254 |
| 67 | 3300005456 | Ga0070678_100027103 | Ga0070678_1000271034 | 254 |
| 68 | 3300005456 | Ga0070678_100032667 | Ga0070678_1000326673 | 254 |
| 69 | 3300005459 | Ga0068867_100000837 | Ga0068867_1000008374 | 254 |
| 70 | 3300005459 | Ga0068867_100032706 | Ga0068867_1000327064 | 254 |
| 71 | 3300005466 | Ga0070685_10000278 | Ga0070685_1000027812 | 254 |
| 72 | 3300005543 | Ga0070672_100018454 | Ga0070672_1000184545 | 254 |
| 73 | 3300005543 | Ga0070672_100042393 | Ga0070672_1000423932 | 254 |
| 74 | 3300005544 | Ga0070686_100000053 | Ga0070686_10000005389 | 254 |
| 75 | 3300005548 | Ga0070665_100018595 | Ga0070665_1000185955 | 254 |
| 76 | 3300005548 | Ga0070665_100206681 | Ga0070665_1002066812 | 254 |
| 77 | 3300005564 | Ga0070664_100038634 | Ga0070664_1000386344 | 254 |
| 78 | 3300005577 | Ga0068857_100037001 | Ga0068857_1000370013 | 254 |
| 79 | 3300005614 | Ga0068856_100000326 | Ga0068856_10000032625 | 254 |
| 80 | 3300005614 | Ga0068856_100006226 | Ga0068856_1000062265 | 254 |
| 81 | 3300005617 | Ga0068859_100001151 | Ga0068859_10000115112 | 254 |
| 82 | 3300005719 | Ga0068861_100120476 | Ga0068861_1001204762 | 254 |
| 83 | 3300005842 | Ga0068858_100390618 | Ga0068858_1003906182 | 254 |
| 84 | 3300005843 | Ga0068860_100030343 | Ga0068860_1000303434 | 254 |
| 85 | 3300006028 | Ga0070717_10000016 | Ga0070717_100000167 | 254 |
| 86 | 3300006358 | Ga0068871_100093115 | Ga0068871_1000931152 | 254 |
| 87 | 3300006358 | Ga0068871_100538031 | Ga0068871_1005380311 | 254 |
| 88 | 3300006881 | Ga0068865_100040221 | Ga0068865_1000402212 | 254 |
| 89 | 3300006881 | Ga0068865_100158911 | Ga0068865_1001589112 | 254 |
| 90 | 3300006931 | Ga0097620_100001151 | Ga0097620_10000115112 | 254 |
| 91 | 3300009093 | Ga0105240_11000263 | Ga0105240_110002631 | 254 |
| 92 | 3300009098 | Ga0105245_10446331 | Ga0105245_104463312 | 254 |
| 93 | 3300009147 | Ga0114129_10237872 | Ga0114129_102378722 | 254 |
| 94 | 3300009176 | Ga0105242_10011055 | Ga0105242_100110556 | 254 |
| 95 | 3300009177 | Ga0105248_10000116 | Ga0105248_1000011688 | 254 |
| 96 | 3300010375 | Ga0105239_10574394 | Ga0105239_105743942 | 254 |
| 97 | 3300013296 | Ga0157374_10035317 | Ga0157374_100353173 | 254 |
| 98 | 3300013297 | Ga0157378_10289076 | Ga0157378_102890762 | 254 |
| 99 | 3300013297 | Ga0157378_10299360 | Ga0157378_102993601 | 254 |
| 100 | 3300013306 | Ga0163162_10035394 | Ga0163162_100353942 | 254 |
| 101 | 3300013306 | Ga0163162_10304339 | Ga0163162_103043392 | 254 |
| 102 | 3300013306 | Ga0163162_10370465 | Ga0163162_103704652 | 254 |
| 103 | 3300013308 | Ga0157375_10016995 | Ga0157375_100169956 | 254 |
| 104 | 3300014325 | Ga0163163_10158756 | Ga0163163_101587562 | 254 |
| 105 | 3300014969 | Ga0157376_10005528 | Ga0157376_100055288 | 254 |
| 106 | 3300014969 | Ga0157376_10054447 | Ga0157376_100544472 | 254 |
| 107 | 3300021384 | Ga0213876_10010457 | Ga0213876_100104574 | 254 |
| 108 | 3300021384 | Ga0213876_10185478 | Ga0213876_101854782 | 254 |
| 109 | 3300025315 | Ga0207697_10002689 | Ga0207697_100026894 | 254 |
| 110 | 3300025893 | Ga0207682_10195565 | Ga0207682_101955652 | 254 |
| 111 | 3300025901 | Ga0207688_10010661 | Ga0207688_100106612 | 254 |
| 112 | 3300025901 | Ga0207688_10083416 | Ga0207688_100834162 | 254 |
| 113 | 3300025903 | Ga0207680_10011058 | Ga0207680_100110582 | 254 |
| 114 | 3300025907 | Ga0207645_10005348 | Ga0207645_100053487 | 254 |
| 115 | 3300025907 | Ga0207645_10005672 | Ga0207645_100056727 | 254 |
| 116 | 3300025909 | Ga0207705_10002538 | Ga0207705_100025383 | 254 |
| 117 | 3300025916 | Ga0207663_10194891 | Ga0207663_101948912 | 254 |
| 118 | 3300025919 | Ga0207657_10374248 | Ga0207657_103742482 | 254 |
| 119 | 3300025923 | Ga0207681_10014723 | Ga0207681_100147235 | 254 |
| 120 | 3300025923 | Ga0207681_10086233 | Ga0207681_100862332 | 254 |
| 121 | 3300025925 | Ga0207650_10407931 | Ga0207650_104079312 | 254 |
| 122 | 3300025926 | Ga0207659_10023276 | Ga0207659_100232762 | 254 |
| 123 | 3300025931 | Ga0207644_10018760 | Ga0207644_100187602 | 254 |
| 124 | 3300025931 | Ga0207644_10028154 | Ga0207644_100281542 | 254 |
| 125 | 3300025936 | Ga0207670_10000024 | Ga0207670_1000002413 | 254 |
| 126 | 3300025937 | Ga0207669_10053266 | Ga0207669_100532662 | 254 |
| 127 | 3300025945 | Ga0207679_10046292 | Ga0207679_100462922 | 254 |
| 128 | 3300025960 | Ga0207651_10028421 | Ga0207651_100284212 | 254 |
| 129 | 3300025972 | Ga0207668_10016671 | Ga0207668_100166711 | 254 |
| 130 | 3300025986 | Ga0207658_10010967 | Ga0207658_100109675 | 254 |
| 131 | 3300026023 | Ga0207677_10052253 | Ga0207677_100522532 | 254 |
| 132 | 3300026035 | Ga0207703_10006408 | Ga0207703_100064085 | 254 |
| 133 | 3300026035 | Ga0207703_10329059 | Ga0207703_103290592 | 254 |
| 134 | 3300026075 | Ga0207708_10001757 | Ga0207708_100017576 | 254 |
| 135 | 3300026078 | Ga0207702_10000672 | Ga0207702_1000067215 | 254 |
| 136 | 3300026078 | Ga0207702_10001609 | Ga0207702_100016094 | 254 |
| 137 | 3300026089 | Ga0207648_10000502 | Ga0207648_100005024 | 254 |
| 138 | 3300026089 | Ga0207648_10041697 | Ga0207648_100416972 | 254 |
| 139 | 3300026116 | Ga0207674_10037711 | Ga0207674_100377114 | 254 |
| 140 | 3300026121 | Ga0207683_10012877 | Ga0207683_100128775 | 254 |
| 141 | 3300028379 | Ga0268266_10281669 | Ga0268266_102816692 | 254 |
| 142 | 3300028381 | Ga0268264_10387295 | Ga0268264_103872952 | 254 |
| 143 | 3300028563 | Ga0265319_1000130 | Ga0265319_100013017 | 254 |
| 144 | 3300028563 | Ga0265319_1006336 | Ga0265319_10063364 | 254 |
| 145 | 3300028563 | Ga0265319_1008936 | Ga0265319_10089366 | 254 |
| 146 | 3300028563 | Ga0265319_1018051 | Ga0265319_10180513 | 254 |
| 147 | 3300028577 | Ga0265318_10000190 | Ga0265318_100001907 | 254 |
| 148 | 3300028577 | Ga0265318_10000434 | Ga0265318_100004344 | 254 |
| 149 | 3300028577 | Ga0265318_10001069 | Ga0265318_100010694 | 254 |
| 150 | 3300028577 | Ga0265318_10003913 | Ga0265318_100039135 | 254 |
| 151 | 3300028653 | Ga0265323_10008972 | Ga0265323_100089723 | 254 |
| 152 | 3300028654 | Ga0265322_10026957 | Ga0265322_100269572 | 254 |
| 153 | 3300031235 | Ga0265330_10129043 | Ga0265330_101290431 | 254 |
| 154 | 3300031240 | Ga0265320_10000205 | Ga0265320_100002054 | 254 |
| 155 | 3300031240 | Ga0265320_10000412 | Ga0265320_100004122 | 254 |
| 156 | 3300031240 | Ga0265320_10008391 | Ga0265320_100083912 | 254 |
| 157 | 3300031240 | Ga0265320_10076817 | Ga0265320_100768172 | 254 |
| 158 | 3300031240 | Ga0265320_10167028 | Ga0265320_101670281 | 254 |
| 159 | 3300031241 | Ga0265325_10109344 | Ga0265325_101093441 | 254 |
| 160 | 3300031251 | Ga0265327_10015094 | Ga0265327_100150944 | 254 |
| 161 | 3300031251 | Ga0265327_10032181 | Ga0265327_100321814 | 254 |
| 162 | 3300031251 | Ga0265327_10218343 | Ga0265327_102183431 | 254 |
| 163 | 3300031344 | Ga0265316_10077020 | Ga0265316_100770202 | 254 |
| 164 | 3300031344 | Ga0265316_10081196 | Ga0265316_100811961 | 254 |
| 165 | 3300031344 | Ga0265316_10095417 | Ga0265316_100954172 | 254 |
| 166 | 3300031507 | Ga0307509_10376601 | Ga0307509_103766011 | 254 |
| 167 | 3300031595 | Ga0265313_10003592 | Ga0265313_100035929 | 254 |
| 168 | 3300031595 | Ga0265313_10019740 | Ga0265313_100197403 | 254 |
| 169 | 3300031711 | Ga0265314_10008930 | Ga0265314_100089304 | 254 |
| 170 | 3300031711 | Ga0265314_10148265 | Ga0265314_101482652 | 254 |
| 171 | 3300031712 | Ga0265342_10014564 | Ga0265342_100145644 | 254 |
| 172 | 3300031712 | Ga0265342_10040906 | Ga0265342_100409063 | 254 |
| 173 | 3300035117 | Ga0373953_0099625 | Ga0373953_0099625_67_837 | 254 |
| 174 | 3300035119 | Ga0373956_0067614 | Ga0373956_0067614_630_1400 | 254 |
| 175 | 3300035410 | Ga0373924_0011635 | Ga0373924_0011635_1288_2058 | 254 |
| 176 | 3300036401 | Ga0373937_0037149 | Ga0373937_0037149_3249_4022 | 254 |
| 177 | 3300036401 | Ga0373937_0053673 | Ga0373937_0053673_1851_2621 | 254 |
| 178 | 3300037312 | Ga0395899_0000349 | Ga0395899_0000349_36162_36926 | 254 |
| 179 | 3300037466 | Ga0395898_0000026 | Ga0395898_0000026_54975_55739 | 254 |
| 180 | 3300037471 | Ga0395905_0000119 | Ga0395905_0000119_56086_56853 | 254 |
| 181 | 3300039437 | Ga0436365_0395979 | Ga0436365_0395979_3856_4629 | 254 |
| 182 | 3300039437 | Ga0436365_0809833 | Ga0436365_0809833_3951_4715 | 254 |
| 183 | 3300039450 | Ga0436363_1651109 | Ga0436363_1651109_562_1335 | 254 |
| 184 | 3300044683 | Ga0466965_0059428 | Ga0466965_0059428_1102_1866 | 254 |
| 185 | 3300044706 | Ga0466964_0030857 | Ga0466964_0030857_380_1144 | 254 |
| 186 | 3300044712 | Ga0453684_0145170 | Ga0453684_0145170_814_1581 | 254 |
| 187 | 3300044719 | Ga0466971_0000020 | Ga0466971_0000020_66403_67167 | 254 |
| 188 | 3300044719 | Ga0466971_0215970 | Ga0466971_0215970_17_784 | 254 |
| 189 | 3300044842 | Ga0466957_0010671 | Ga0466957_0010671_4221_4985 | 254 |
| 190 | 3300045051 | Ga0451576_0002620 | Ga0451576_0002620_9236_10003 | 254 |
| 191 | 3300045976 | Ga0466967_0033254 | Ga0466967_0033254_931_1698 | 254 |
| 192 | 3300045976 | Ga0466967_0158652 | Ga0466967_0158652_786_1550 | 254 |
| 193 | 3300046683 | Ga0495658_0007689 | Ga0495658_0007689_915_1691 | 254 |
| 194 | 3300047315 | Ga0495581_0019021 | Ga0495581_0019021_3164_3934 | 254 |
| 195 | 3300048912 | Ga0496109_0191362 | Ga0496109_0191362_241_1014 | 254 |
| 196 | 3300049568 | Ga0501031_0000288 | Ga0501031_0000288_7722_8486 | 254 |
| 197 | 3300049569 | Ga0501032_0001389 | Ga0501032_0001389_6930_7697 | 254 |
| 198 | 3300049569 | Ga0501032_0008221 | Ga0501032_0008221_4436_5200 | 254 |
| 199 | 3300049570 | Ga0501033_0000021 | Ga0501033_0000021_153799_154563 | 254 |
| 200 | 3300049570 | Ga0501033_0000074 | Ga0501033_0000074_64922_65686 | 254 |
| 201 | 3300049572 | Ga0501036_0097728 | Ga0501036_0097728_1073_1840 | 254 |
| 202 | 3300049572 | Ga0501036_0110916 | Ga0501036_0110916_289_1053 | 254 |
| 203 | 3300049573 | Ga0501037_0000145 | Ga0501037_0000145_11871_12635 | 254 |
| 204 | 3300049574 | Ga0501038_0000559 | Ga0501038_0000559_29755_30519 | 254 |
| 205 | 3300049574 | Ga0501038_0046028 | Ga0501038_0046028_1622_2386 | 254 |
| 206 | 3300049575 | Ga0501039_0010884 | Ga0501039_0010884_3210_3974 | 254 |
| 207 | 3300049579 | Ga0501043_0002411 | Ga0501043_0002411_3120_3884 | 254 |
| 208 | 3300049579 | Ga0501043_0020306 | Ga0501043_0020306_3232_3996 | 254 |
| 209 | 3300049580 | Ga0501046_0160611 | Ga0501046_0160611_582_1349 | 254 |
| 210 | 3300049581 | Ga0501047_0005079 | Ga0501047_0005079_758_1522 | 254 |
| 211 | 3300049582 | Ga0501048_0127026 | Ga0501048_0127026_566_1333 | 254 |
| 212 | 3300049586 | Ga0501070_0007074 | Ga0501070_0007074_18_782 | 254 |
| 213 | 3300049586 | Ga0501070_0037843 | Ga0501070_0037843_2568_3332 | 254 |
| 214 | 3300049586 | Ga0501070_0192680 | Ga0501070_0192680_894_1658 | 254 |
| 215 | 3300049675 | Ga0501243_030354 | Ga0501243_030354_32_799 | 254 |
| 216 | 3300049742 | Ga0501080_0344787 | Ga0501080_0344787_117_881 | 254 |
| 217 | 3300049822 | Ga0501035_0000002 | Ga0501035_0000002_467537_468301 | 254 |
| 218 | 3300049822 | Ga0501035_0009323 | Ga0501035_0009323_1445_2212 | 254 |
| 219 | 3300049823 | Ga0501044_0011740 | Ga0501044_0011740_169_936 | 254 |
| 220 | 3300049823 | Ga0501044_0133610 | Ga0501044_0133610_364_1128 | 254 |
| 221 | 3300050507 | nmdc:mga05p37_242539_c1 | nmdc:mga05p37_242539_c1_1139_1912 | 254 |
| 222 | 3300050511 | nmdc:mga08y16_221484_c1 | nmdc:mga08y16_221484_c1_208_975 | 254 |
| 223 | 3300053130 | Ga0500642_0028868 | Ga0500642_0028868_1345_2109 | 254 |
| 224 | 3300061719 | Ga0466962_0000046 | Ga0466962_0000046_29975_30739 | 254 |
| 225 | 3300005329 | Ga0070683_100000678 | Ga0070683_1000006787 | 255 |
| 226 | 3300005334 | Ga0068869_100002769 | Ga0068869_1000027692 | 255 |
| 227 | 3300005338 | Ga0068868_100012435 | Ga0068868_1000124355 | 255 |
| 228 | 3300005338 | Ga0068868_100266815 | Ga0068868_1002668152 | 255 |
| 229 | 3300005456 | Ga0070678_100155992 | Ga0070678_1001559922 | 255 |
| 230 | 3300005459 | Ga0068867_100001590 | Ga0068867_1000015906 | 255 |
| 231 | 3300005530 | Ga0070679_100117285 | Ga0070679_1001172852 | 255 |
| 232 | 3300005614 | Ga0068856_100410002 | Ga0068856_1004100022 | 255 |
| 233 | 3300006237 | Ga0097621_100188320 | Ga0097621_1001883202 | 255 |
| 234 | 3300006358 | Ga0068871_100200118 | Ga0068871_1002001182 | 255 |
| 235 | 3300009093 | Ga0105240_10466353 | Ga0105240_104663531 | 255 |
| 236 | 3300014325 | Ga0163163_10036535 | Ga0163163_100365352 | 255 |
| 237 | 3300025909 | Ga0207705_10035323 | Ga0207705_100353232 | 255 |
| 238 | 3300025913 | Ga0207695_10411804 | Ga0207695_104118041 | 255 |
| 239 | 3300025937 | Ga0207669_10180151 | Ga0207669_101801512 | 255 |
| 240 | 3300025942 | Ga0207689_10006104 | Ga0207689_100061047 | 255 |
| 241 | 3300025944 | Ga0207661_10006991 | Ga0207661_100069915 | 255 |
| 242 | 3300026023 | Ga0207677_10004942 | Ga0207677_100049424 | 255 |
| 243 | 3300026089 | Ga0207648_10006026 | Ga0207648_100060265 | 255 |
| 244 | 3300028563 | Ga0265319_1002742 | Ga0265319_10027421 | 255 |
| 245 | 3300028563 | Ga0265319_1034134 | Ga0265319_10341342 | 255 |
| 246 | 3300028573 | Ga0265334_10016148 | Ga0265334_100161482 | 255 |
| 247 | 3300028653 | Ga0265323_10000080 | Ga0265323_1000008017 | 255 |
| 248 | 3300028653 | Ga0265323_10019478 | Ga0265323_100194782 | 255 |
| 249 | 3300028653 | Ga0265323_10030610 | Ga0265323_100306102 | 255 |
| 250 | 3300028654 | Ga0265322_10000087 | Ga0265322_1000008718 | 255 |
| 251 | 3300028654 | Ga0265322_10031861 | Ga0265322_100318611 | 255 |
| 252 | 3300031249 | Ga0265339_10127749 | Ga0265339_101277492 | 255 |
| 253 | 3300031251 | Ga0265327_10110433 | Ga0265327_101104332 | 255 |
| 254 | 3300031344 | Ga0265316_10002448 | Ga0265316_1000244813 | 255 |
| 255 | 3300031344 | Ga0265316_10016479 | Ga0265316_100164792 | 255 |
| 256 | 3300031344 | Ga0265316_10195405 | Ga0265316_101954052 | 255 |
| 257 | 3300031548 | Ga0307408_100000003 | Ga0307408_100000003171 | 255 |
| 258 | 3300031595 | Ga0265313_10005982 | Ga0265313_100059826 | 255 |
| 259 | 3300031711 | Ga0265314_10011865 | Ga0265314_100118652 | 255 |
| 260 | 3300031712 | Ga0265342_10019832 | Ga0265342_100198323 | 255 |
| 261 | 3300031712 | Ga0265342_10120158 | Ga0265342_101201582 | 255 |
| 262 | 3300031731 | Ga0307405_10069898 | Ga0307405_100698981 | 255 |
| 263 | 3300031852 | Ga0307410_10000002 | Ga0307410_10000002136 | 255 |
| 264 | 3300031903 | Ga0307407_10032914 | Ga0307407_100329142 | 255 |
| 265 | 3300031911 | Ga0307412_10116173 | Ga0307412_101161732 | 255 |
| 266 | 3300031995 | Ga0307409_100006527 | Ga0307409_1000065276 | 255 |
| 267 | 3300032002 | Ga0307416_100000057 | Ga0307416_10000005790 | 255 |
| 268 | 3300042876 | Ga0451577_0053670 | Ga0451577_0053670_201_971 | 255 |
| 269 | 3300044673 | Ga0453683_0000264 | Ga0453683_0000264_34718_35488 | 255 |
| 270 | 3300044673 | Ga0453683_0285282 | Ga0453683_0285282_246_1016 | 255 |
| 271 | 3300045051 | Ga0451576_0038620 | Ga0451576_0038620_4134_4904 | 255 |
| 272 | 3300045051 | Ga0451576_0177137 | Ga0451576_0177137_270_1040 | 255 |
| 273 | 3300045051 | Ga0451576_0557467 | Ga0451576_0557467_314_1084 | 255 |
| 274 | 3300049161 | Ga0501305_002501 | Ga0501305_002501_1080_1850 | 255 |
| 275 | 3300049528 | Ga0501312_006646 | Ga0501312_006646_670_1440 | 255 |
| 276 | 3300049568 | Ga0501031_0305684 | Ga0501031_0305684_213_983 | 255 |
| 277 | 3300049569 | Ga0501032_0001412 | Ga0501032_0001412_11149_11919 | 255 |
| 278 | 3300049569 | Ga0501032_0042438 | Ga0501032_0042438_255_1025 | 255 |
| 279 | 3300049570 | Ga0501033_0000882 | Ga0501033_0000882_20512_21282 | 255 |
| 280 | 3300049570 | Ga0501033_0001315 | Ga0501033_0001315_489_1259 | 255 |
| 281 | 3300049571 | Ga0501034_0147822 | Ga0501034_0147822_411_1181 | 255 |
| 282 | 3300049572 | Ga0501036_0075486 | Ga0501036_0075486_1300_2070 | 255 |
| 283 | 3300049573 | Ga0501037_0014516 | Ga0501037_0014516_1012_1782 | 255 |
| 284 | 3300049573 | Ga0501037_0019969 | Ga0501037_0019969_1174_1944 | 255 |
| 285 | 3300049574 | Ga0501038_0107487 | Ga0501038_0107487_646_1416 | 255 |
| 286 | 3300049580 | Ga0501046_0001090 | Ga0501046_0001090_6926_7696 | 255 |
| 287 | 3300049581 | Ga0501047_0263862 | Ga0501047_0263862_767_1537 | 255 |
| 288 | 3300049582 | Ga0501048_0119226 | Ga0501048_0119226_791_1561 | 255 |
| 289 | 3300049586 | Ga0501070_0242281 | Ga0501070_0242281_335_1105 | 255 |
| 290 | 3300049586 | Ga0501070_0480011 | Ga0501070_0480011_200_970 | 255 |
| 291 | 3300049742 | Ga0501080_0075037 | Ga0501080_0075037_1832_2602 | 255 |
| 292 | 3300049742 | Ga0501080_0104419 | Ga0501080_0104419_628_1398 | 255 |
| 293 | 3300049744 | Ga0501083_0001769 | Ga0501083_0001769_12841_13611 | 255 |
| 294 | 3300049822 | Ga0501035_0010122 | Ga0501035_0010122_7154_7924 | 255 |
| 295 | 3300049823 | Ga0501044_0009583 | Ga0501044_0009583_262_1032 | 255 |
| 296 | 3300049823 | Ga0501044_0062551 | Ga0501044_0062551_755_1525 | 255 |
| 297 | 3300049824 | Ga0501045_0428436 | Ga0501045_0428436_11_781 | 255 |
| 298 | 3300060353 | Ga0501082_0240301 | Ga0501082_0240301_791_1561 | 255 |
| 299 | 3300005985 | Ga0081539_10005759 | Ga0081539_100057593 | 256 |
| 300 | 3300031711 | Ga0265314_10038674 | Ga0265314_100386743 | 256 |
| 301 | 3300002155 | JGI24033J26618_1001440 | JGI24033J26618_10014403 | 257 |
| 302 | 3300005344 | Ga0070661_100003563 | Ga0070661_1000035636 | 257 |
| 303 | 3300005354 | Ga0070675_100088524 | Ga0070675_1000885242 | 257 |
| 304 | 3300005356 | Ga0070674_100172030 | Ga0070674_1001720302 | 257 |
| 305 | 3300005366 | Ga0070659_100060654 | Ga0070659_1000606542 | 257 |
| 306 | 3300013296 | Ga0157374_10013126 | Ga0157374_100131264 | 257 |
| 307 | 3300013297 | Ga0157378_10002900 | Ga0157378_1000290015 | 257 |
| 308 | 3300013308 | Ga0157375_10226262 | Ga0157375_102262622 | 257 |
| 309 | 3300025919 | Ga0207657_10437710 | Ga0207657_104377101 | 257 |
| 310 | 3300025920 | Ga0207649_10000291 | Ga0207649_1000029119 | 257 |
| 311 | 3300025926 | Ga0207659_10104309 | Ga0207659_101043092 | 257 |
| 312 | 3300025932 | Ga0207690_10040681 | Ga0207690_100406813 | 257 |
| 313 | 3300026121 | Ga0207683_10016886 | Ga0207683_100168864 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y8f-assembly1.cif.gz_A-2 | crystal structure of triosephosphate isomerase from clostridium perfringens | 0.9747 | 4 | 251 |
| 1b9b-assembly1.cif.gz_B | triosephosphate isomerase of thermotoga maritima | 0.9738 | 3 | 253 |
| 7rmn-assembly1.cif.gz_B | crystal structure of triosephosphate isomerase from verrucomicrobium spinosum | 0.9708 | 4 | 255 |
| 6bve-assembly1.cif.gz_B | triosephosphate isomerase of synechocystis in complex with 2-phosphoglycolic acid | 0.9697 | 4 | 252 |
| 4y96-assembly1.cif.gz_A | crystal structure of triosephosphate isomerase from gemmata obscuriglobus | 0.9676 | 4 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17751_41_299_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.972 | 44 | 253 | 3.20.20.70 |
| 6bveB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9697 | 4 | 252 | 3.20.20.70 |
| 4y96A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9676 | 4 | 254 | 3.20.20.70 |
| af_A0A1D6KAX1_115_218_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.965 | 163 | 243 | 3.20.20.70 |
| af_P0A858_1_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9638 | 4 | 254 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6GZS1-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9988 | 82 | 257 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7S4TA46-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9986 | 125 | 250 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A645DQY7-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9984 | 97 | 254 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-T2RDA1-F1-model_v4 | deleted | 0.9977 | 86 | 251 |
|
| AF-K1SGB4-F1-model_v4 | Triose-phosphate isomerase | 0.9972 | 109 | 256 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar