F402070
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 176 | 313 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100416595|Ga0070705_1004165952 |
| Length | 138 |
| Sequence | VTEPARNPIGLPNRSADAATAAPDMPPLELARRIVELAEDKKAADIVLLDLTGLTTVADYFVIASGGSERQLDAIADGIVSGMRDERVHAFGREGRAASHWVLVDFGSVIVHVFTPPERDYYQLERHWAEAKTILRVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 119 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 120 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 121 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 123 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 137 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 141 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 98.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1015064 | 3300000545 | Unclassified | 558 |
| 2 | rootH1_10165333 | 3300003323 | Eukaryota | 1106 |
| 3 | Ga0065707_10407009 | 3300005295 | Unclassified | 846 |
| 4 | Ga0070658_10039944 | 3300005327 | Bacteria | 3786 |
| 5 | Ga0070683_100080422 | 3300005329 | Bacteria | 3050 |
| 6 | Ga0070690_100024160 | 3300005330 | Bacteria | 3737 |
| 7 | Ga0070670_100211758 | 3300005331 | Bacteria | 1685 |
| 8 | Ga0070666_10266899 | 3300005335 | Bacteria | 1214 |
| 9 | Ga0070660_100856755 | 3300005339 | Unclassified | 765 |
| 10 | Ga0070689_100030328 | 3300005340 | Bacteria | 4104 |
| 11 | Ga0070689_100034743 | 3300005340 | Bacteria | 3847 |
| 12 | Ga0070689_100047064 | 3300005340 | Bacteria | 3325 |
| 13 | Ga0070689_100112326 | 3300005340 | Bacteria | 2169 |
| 14 | Ga0070689_100252202 | 3300005340 | Unclassified | 1456 |
| 15 | Ga0070689_100460412 | 3300005340 | Unclassified | 1083 |
| 16 | Ga0070691_10126090 | 3300005341 | Unclassified | 1293 |
| 17 | Ga0070687_100684731 | 3300005343 | Unclassified | 714 |
| 18 | Ga0070661_100326004 | 3300005344 | Unclassified | 1200 |
| 19 | Ga0070692_10307846 | 3300005345 | Bacteria | 969 |
| 20 | Ga0070669_101463190 | 3300005353 | Unclassified | 593 |
| 21 | Ga0070675_100387488 | 3300005354 | Unclassified | 1245 |
| 22 | Ga0070675_100484944 | 3300005354 | Unclassified | 1112 |
| 23 | Ga0070673_101757864 | 3300005364 | Unclassified | 587 |
| 24 | Ga0070688_100004790 | 3300005365 | Bacteria | 7074 |
| 25 | Ga0070688_100095079 | 3300005365 | Bacteria | 1955 |
| 26 | Ga0070688_100211907 | 3300005365 | Bacteria | 1361 |
| 27 | Ga0070714_100319834 | 3300005435 | Unclassified | 1451 |
| 28 | Ga0070714_100801266 | 3300005435 | Unclassified | 912 |
| 29 | Ga0070701_10311455 | 3300005438 | Bacteria | 971 |
| 30 | Ga0070705_100132479 | 3300005440 | Bacteria | 1628 |
| 31 | Ga0070705_100416595 | 3300005440 | Bacteria | 999 |
| 32 | Ga0070694_100004538 | 3300005444 | Bacteria | 8346 |
| 33 | Ga0070694_101530450 | 3300005444 | Bacteria | 565 |
| 34 | Ga0070708_100901159 | 3300005445 | Unclassified | 830 |
| 35 | Ga0070678_102230023 | 3300005456 | Unclassified | 519 |
| 36 | Ga0070681_11215074 | 3300005458 | Unclassified | 676 |
| 37 | Ga0068867_100793138 | 3300005459 | Bacteria | 844 |
| 38 | Ga0070685_10253338 | 3300005466 | Bacteria | 1167 |
| 39 | Ga0070685_10295654 | 3300005466 | Unclassified | 1090 |
| 40 | Ga0070685_10334803 | 3300005466 | Bacteria | 1030 |
| 41 | Ga0070698_101788556 | 3300005471 | Unclassified | 567 |
| 42 | Ga0070679_100454390 | 3300005530 | Bacteria | 1226 |
| 43 | Ga0068853_100213203 | 3300005539 | Unclassified | 1761 |
| 44 | Ga0068853_100437328 | 3300005539 | Bacteria | 1229 |
| 45 | Ga0070686_100022577 | 3300005544 | Bacteria | 3749 |
| 46 | Ga0070686_100109408 | 3300005544 | Bacteria | 1880 |
| 47 | Ga0070686_100120262 | 3300005544 | Bacteria | 1802 |
| 48 | Ga0070693_100695389 | 3300005547 | Bacteria | 744 |
| 49 | Ga0070693_100998278 | 3300005547 | Bacteria | 633 |
| 50 | Ga0070704_100395426 | 3300005549 | Bacteria | 1178 |
| 51 | Ga0070704_100908367 | 3300005549 | Unclassified | 792 |
| 52 | Ga0068855_100174867 | 3300005563 | Unclassified | 2430 |
| 53 | Ga0068855_100551415 | 3300005563 | Unclassified | 1248 |
| 54 | Ga0068855_100955525 | 3300005563 | Unclassified | 902 |
| 55 | Ga0068855_101239593 | 3300005563 | Unclassified | 774 |
| 56 | Ga0068857_100173030 | 3300005577 | Bacteria | 1963 |
| 57 | Ga0068857_100223574 | 3300005577 | Bacteria | 1720 |
| 58 | Ga0068856_100000561 | 3300005614 | Bacteria | 40801 |
| 59 | Ga0068856_100063736 | 3300005614 | Bacteria | 3641 |
| 60 | Ga0068856_100473370 | 3300005614 | Bacteria | 1273 |
| 61 | Ga0070702_100336256 | 3300005615 | Bacteria | 1058 |
| 62 | Ga0070702_100738685 | 3300005615 | Unclassified | 754 |
| 63 | Ga0068852_101787875 | 3300005616 | Unclassified | 637 |
| 64 | Ga0068859_100064078 | 3300005617 | Bacteria | 3707 |
| 65 | Ga0068859_100097832 | 3300005617 | Bacteria | 2988 |
| 66 | Ga0068859_100124472 | 3300005617 | Bacteria | 2646 |
| 67 | Ga0068859_100158348 | 3300005617 | Bacteria | 2343 |
| 68 | Ga0068859_100507281 | 3300005617 | Unclassified | 1301 |
| 69 | Ga0068864_100961545 | 3300005618 | Bacteria | 846 |
| 70 | Ga0068866_10170455 | 3300005718 | Bacteria | 1277 |
| 71 | Ga0068870_11043471 | 3300005840 | Unclassified | 585 |
| 72 | Ga0068863_100006428 | 3300005841 | Bacteria | 11523 |
| 73 | Ga0068862_101114265 | 3300005844 | Unclassified | 785 |
| 74 | Ga0068862_101250472 | 3300005844 | Unclassified | 742 |
| 75 | Ga0070717_11657141 | 3300006028 | Unclassified | 579 |
| 76 | Ga0070716_101560919 | 3300006173 | Unclassified | 541 |
| 77 | Ga0097621_100199054 | 3300006237 | Bacteria | 1738 |
| 78 | Ga0068871_100021119 | 3300006358 | Bacteria | 4999 |
| 79 | Ga0075428_100011208 | 3300006844 | Bacteria | 9977 |
| 80 | Ga0075431_100334284 | 3300006847 | Bacteria | 1525 |
| 81 | Ga0075434_101996169 | 3300006871 | Unclassified | 585 |
| 82 | Ga0075429_100179046 | 3300006880 | Bacteria | 1858 |
| 83 | Ga0075436_100609034 | 3300006914 | Unclassified | 805 |
| 84 | Ga0097620_100064079 | 3300006931 | Bacteria | 3707 |
| 85 | Ga0097620_100097832 | 3300006931 | Bacteria | 2988 |
| 86 | Ga0097620_100124468 | 3300006931 | Bacteria | 2646 |
| 87 | Ga0097620_100158344 | 3300006931 | Bacteria | 2343 |
| 88 | Ga0097620_100507260 | 3300006931 | Unclassified | 1301 |
| 89 | Ga0097620_101916459 | 3300006931 | Unclassified | 654 |
| 90 | Ga0075435_100944060 | 3300007076 | Bacteria | 753 |
| 91 | Ga0105240_10133026 | 3300009093 | Bacteria | 2981 |
| 92 | Ga0105240_10150521 | 3300009093 | Bacteria | 2772 |
| 93 | Ga0105240_10161957 | 3300009093 | Unclassified | 2656 |
| 94 | Ga0111539_10006153 | 3300009094 | Bacteria | 15495 |
| 95 | Ga0111539_10345231 | 3300009094 | Bacteria | 1732 |
| 96 | Ga0111539_10411553 | 3300009094 | Bacteria | 1575 |
| 97 | Ga0111539_10596973 | 3300009094 | Bacteria | 1286 |
| 98 | Ga0111539_10648137 | 3300009094 | Bacteria | 1230 |
| 99 | Ga0111539_10767780 | 3300009094 | Unclassified | 1122 |
| 100 | Ga0111539_10837190 | 3300009094 | Bacteria | 1070 |
| 101 | Ga0105245_11016272 | 3300009098 | Bacteria | 874 |
| 102 | Ga0105245_12982172 | 3300009098 | Unclassified | 525 |
| 103 | Ga0114129_11582195 | 3300009147 | Unclassified | 803 |
| 104 | Ga0105242_10824510 | 3300009176 | Bacteria | 920 |
| 105 | Ga0105237_10128077 | 3300009545 | Bacteria | 2533 |
| 106 | Ga0105238_10004479 | 3300009551 | Bacteria | 13848 |
| 107 | Ga0105238_10052545 | 3300009551 | Bacteria | 4096 |
| 108 | Ga0105238_10349221 | 3300009551 | Unclassified | 1468 |
| 109 | Ga0105249_10137191 | 3300009553 | Bacteria | 2342 |
| 110 | Ga0105249_10416508 | 3300009553 | Bacteria | 1376 |
| 111 | Ga0105249_11138156 | 3300009553 | Bacteria | 851 |
| 112 | Ga0099796_10073636 | 3300010159 | Unclassified | 1238 |
| 113 | Ga0157374_10234139 | 3300013296 | Unclassified | 1805 |
| 114 | Ga0157374_10733490 | 3300013296 | Bacteria | 1002 |
| 115 | Ga0157374_11020254 | 3300013296 | Unclassified | 847 |
| 116 | Ga0157378_10267725 | 3300013297 | Bacteria | 1642 |
| 117 | Ga0157378_10308071 | 3300013297 | Unclassified | 1535 |
| 118 | Ga0157378_12820921 | 3300013297 | Unclassified | 538 |
| 119 | Ga0157372_10193003 | 3300013307 | Unclassified | 2359 |
| 120 | Ga0157372_11807234 | 3300013307 | Archaea | 703 |
| 121 | Ga0157375_10000172 | 3300013308 | Bacteria | 60073 |
| 122 | Ga0157375_11177943 | 3300013308 | Unclassified | 898 |
| 123 | Ga0157375_11854816 | 3300013308 | Unclassified | 715 |
| 124 | Ga0163163_10045217 | 3300014325 | Unclassified | 4321 |
| 125 | Ga0163163_11819514 | 3300014325 | Bacteria | 669 |
| 126 | Ga0157379_10248381 | 3300014968 | Bacteria | 1615 |
| 127 | Ga0157376_10944433 | 3300014969 | Bacteria | 882 |
| 128 | Ga0207685_10428572 | 3300025905 | Unclassified | 683 |
| 129 | Ga0207699_10561687 | 3300025906 | Bacteria | 828 |
| 130 | Ga0207705_10047623 | 3300025909 | Unclassified | 3083 |
| 131 | Ga0207705_10052279 | 3300025909 | Bacteria | 2941 |
| 132 | Ga0207707_10973318 | 3300025912 | Unclassified | 698 |
| 133 | Ga0207695_10376041 | 3300025913 | Unclassified | 1306 |
| 134 | Ga0207695_10507357 | 3300025913 | Bacteria | 1088 |
| 135 | Ga0207695_10785665 | 3300025913 | Unclassified | 832 |
| 136 | Ga0207671_10854774 | 3300025914 | Bacteria | 720 |
| 137 | Ga0207657_10622690 | 3300025919 | Unclassified | 841 |
| 138 | Ga0207652_11465801 | 3300025921 | Unclassified | 586 |
| 139 | Ga0207694_10040514 | 3300025924 | Bacteria | 3586 |
| 140 | Ga0207650_10162909 | 3300025925 | Bacteria | 1768 |
| 141 | Ga0207664_10914408 | 3300025929 | Unclassified | 788 |
| 142 | Ga0207706_11204411 | 3300025933 | Unclassified | 629 |
| 143 | Ga0207670_10009614 | 3300025936 | Bacteria | 5527 |
| 144 | Ga0207670_10104629 | 3300025936 | Bacteria | 2028 |
| 145 | Ga0207670_10209622 | 3300025936 | Unclassified | 1485 |
| 146 | Ga0207667_10095859 | 3300025949 | Bacteria | 3062 |
| 147 | Ga0207667_10191788 | 3300025949 | Unclassified | 2097 |
| 148 | Ga0207667_10207189 | 3300025949 | Unclassified | 2010 |
| 149 | Ga0207667_10593271 | 3300025949 | Bacteria | 1118 |
| 150 | Ga0207667_10702800 | 3300025949 | Bacteria | 1013 |
| 151 | Ga0207667_10709418 | 3300025949 | Bacteria | 1008 |
| 152 | Ga0207703_11452730 | 3300026035 | Bacteria | 660 |
| 153 | Ga0207639_10407436 | 3300026041 | Bacteria | 1226 |
| 154 | Ga0207702_10001938 | 3300026078 | Bacteria | 20206 |
| 155 | Ga0207702_10071833 | 3300026078 | Bacteria | 2981 |
| 156 | Ga0207702_10120241 | 3300026078 | Bacteria | 2350 |
| 157 | Ga0207702_11226621 | 3300026078 | Bacteria | 744 |
| 158 | Ga0207702_11311318 | 3300026078 | Bacteria | 718 |
| 159 | Ga0207641_10067877 | 3300026088 | Bacteria | 3056 |
| 160 | Ga0207648_10280943 | 3300026089 | Bacteria | 1489 |
| 161 | Ga0207648_10620033 | 3300026089 | Unclassified | 998 |
| 162 | Ga0207676_10473814 | 3300026095 | Bacteria | 1184 |
| 163 | Ga0207674_10323322 | 3300026116 | Bacteria | 1492 |
| 164 | Ga0207428_10660205 | 3300027907 | Bacteria | 750 |
| 165 | Ga0265337_1000017 | 3300028556 | Bacteria | 76887 |
| 166 | Ga0265337_1002754 | 3300028556 | Bacteria | 7886 |
| 167 | Ga0265337_1008261 | 3300028556 | Bacteria | 3802 |
| 168 | Ga0265337_1008663 | 3300028556 | Bacteria | 3680 |
| 169 | Ga0265337_1015498 | 3300028556 | Unclassified | 2493 |
| 170 | Ga0265326_10017843 | 3300028558 | Unclassified | 2045 |
| 171 | Ga0265326_10077216 | 3300028558 | Bacteria | 942 |
| 172 | Ga0265319_1026599 | 3300028563 | Unclassified | 2059 |
| 173 | Ga0265334_10179063 | 3300028573 | Unclassified | 741 |
| 174 | Ga0265318_10181341 | 3300028577 | Bacteria | 771 |
| 175 | Ga0265322_10230455 | 3300028654 | Bacteria | 531 |
| 176 | Ga0265336_10000543 | 3300028666 | Bacteria | 21601 |
| 177 | Ga0265336_10013725 | 3300028666 | Bacteria | 2696 |
| 178 | Ga0265336_10091313 | 3300028666 | Unclassified | 907 |
| 179 | Ga0265338_10000084 | 3300028800 | Bacteria | 175415 |
| 180 | Ga0265338_10000395 | 3300028800 | Bacteria | 78200 |
| 181 | Ga0265338_10007701 | 3300028800 | Bacteria | 13260 |
| 182 | Ga0265338_10010753 | 3300028800 | Bacteria | 10679 |
| 183 | Ga0265338_10012049 | 3300028800 | Bacteria | 9891 |
| 184 | Ga0265338_10012058 | 3300028800 | Bacteria | 9885 |
| 185 | Ga0265338_10018301 | 3300028800 | Bacteria | 7505 |
| 186 | Ga0265338_10055842 | 3300028800 | Bacteria | 3509 |
| 187 | Ga0265338_10089370 | 3300028800 | Unclassified | 2553 |
| 188 | Ga0265338_10551862 | 3300028800 | Unclassified | 806 |
| 189 | Ga0265338_10567508 | 3300028800 | Bacteria | 793 |
| 190 | Ga0265324_10000058 | 3300029957 | Bacteria | 93345 |
| 191 | Ga0265324_10032403 | 3300029957 | Bacteria | 1826 |
| 192 | Ga0265324_10041262 | 3300029957 | Unclassified | 1597 |
| 193 | Ga0265330_10258910 | 3300031235 | Bacteria | 733 |
| 194 | Ga0265332_10013455 | 3300031238 | Bacteria | 3626 |
| 195 | Ga0265332_10037757 | 3300031238 | Bacteria | 2094 |
| 196 | Ga0265328_10139942 | 3300031239 | Bacteria | 908 |
| 197 | Ga0265320_10008824 | 3300031240 | Bacteria | 6134 |
| 198 | Ga0265320_10011494 | 3300031240 | Bacteria | 5205 |
| 199 | Ga0265320_10111735 | 3300031240 | Unclassified | 1251 |
| 200 | Ga0265320_10177036 | 3300031240 | Bacteria | 957 |
| 201 | Ga0265325_10011036 | 3300031241 | Bacteria | 5200 |
| 202 | Ga0265325_10183844 | 3300031241 | Unclassified | 972 |
| 203 | Ga0265329_10004711 | 3300031242 | Bacteria | 5619 |
| 204 | Ga0265340_10000162 | 3300031247 | Bacteria | 33635 |
| 205 | Ga0265340_10007749 | 3300031247 | Bacteria | 5823 |
| 206 | Ga0265340_10010082 | 3300031247 | Bacteria | 5060 |
| 207 | Ga0265339_10277742 | 3300031249 | Unclassified | 804 |
| 208 | Ga0265339_10458367 | 3300031249 | Unclassified | 591 |
| 209 | Ga0265331_10404720 | 3300031250 | Unclassified | 612 |
| 210 | Ga0265327_10004378 | 3300031251 | Bacteria | 12537 |
| 211 | Ga0265327_10395161 | 3300031251 | Unclassified | 601 |
| 212 | Ga0265316_10090474 | 3300031344 | Bacteria | 2335 |
| 213 | Ga0265316_10213136 | 3300031344 | Unclassified | 1428 |
| 214 | Ga0265316_10274188 | 3300031344 | Bacteria | 1234 |
| 215 | Ga0265316_11077872 | 3300031344 | Unclassified | 558 |
| 216 | Ga0265316_11212639 | 3300031344 | Unclassified | 522 |
| 217 | Ga0265316_11309219 | 3300031344 | Unclassified | 500 |
| 218 | Ga0265313_10251643 | 3300031595 | Unclassified | 720 |
| 219 | Ga0307508_10653637 | 3300031616 | Unclassified | 657 |
| 220 | Ga0265314_10000170 | 3300031711 | Bacteria | 96635 |
| 221 | Ga0265314_10108728 | 3300031711 | Unclassified | 1766 |
| 222 | Ga0265314_10254562 | 3300031711 | Bacteria | 1006 |
| 223 | Ga0265342_10051295 | 3300031712 | Bacteria | 2462 |
| 224 | Ga0265342_10283735 | 3300031712 | Bacteria | 876 |
| 225 | Ga0373930_0001021 | 3300034816 | Bacteria | 4025 |
| 226 | Ga0373950_0005248 | 3300034818 | Unclassified | 1928 |
| 227 | Ga0373938_0007319 | 3300034957 | Bacteria | 1939 |
| 228 | Ga0373928_0000018 | 3300035084 | Bacteria | 28140 |
| 229 | Ga0373929_0001189 | 3300035085 | Bacteria | 5036 |
| 230 | Ga0373944_0002659 | 3300035089 | Unclassified | 4552 |
| 231 | Ga0373944_0288384 | 3300035089 | Unclassified | 614 |
| 232 | Ga0373949_0002010 | 3300035090 | Bacteria | 5427 |
| 233 | Ga0373951_0031709 | 3300035091 | Bacteria | 1247 |
| 234 | Ga0373932_0000004 | 3300035112 | Bacteria | 412176 |
| 235 | Ga0373941_0120706 | 3300035115 | Unclassified | 934 |
| 236 | Ga0373954_0174152 | 3300035118 | Bacteria | 1054 |
| 237 | Ga0373956_0416688 | 3300035119 | Unclassified | 641 |
| 238 | Ga0373960_0216842 | 3300035121 | Unclassified | 683 |
| 239 | Ga0373943_0193848 | 3300035170 | Unclassified | 1122 |
| 240 | Ga0373946_0117747 | 3300035171 | Bacteria | 1210 |
| 241 | Ga0373962_0000015 | 3300035242 | Bacteria | 48259 |
| 242 | Ga0373931_0000009 | 3300035691 | Bacteria | 349854 |
| 243 | Ga0373935_0035831 | 3300035692 | Bacteria | 3098 |
| 244 | Ga0373927_0033029 | 3300035695 | Unclassified | 3369 |
| 245 | Ga0373927_0045739 | 3300035695 | Bacteria | 2831 |
| 246 | Ga0373927_0177705 | 3300035695 | Bacteria | 1396 |
| 247 | Ga0373927_0730712 | 3300035695 | Unclassified | 654 |
| 248 | Ga0373927_0798485 | 3300035695 | Unclassified | 623 |
| 249 | Ga0373933_0175975 | 3300035724 | Bacteria | 1363 |
| 250 | Ga0373933_0865695 | 3300035724 | Unclassified | 595 |
| 251 | Ga0373947_0507901 | 3300035725 | Bacteria | 819 |
| 252 | Ga0373925_0001059 | 3300037068 | Bacteria | 24840 |
| 253 | Ga0373925_0005171 | 3300037068 | Bacteria | 9775 |
| 254 | Ga0373925_0360405 | 3300037068 | Bacteria | 1182 |
| 255 | Ga0373925_0523745 | 3300037068 | Bacteria | 974 |
| 256 | Ga0439443_078453 | 3300042003 | Bacteria | 611 |
| 257 | Ga0439435_0063259 | 3300042436 | Unclassified | 1082 |
| 258 | Ga0451577_0003467 | 3300042876 | Bacteria | 17550 |
| 259 | Ga0453684_0027362 | 3300044712 | Bacteria | 8181 |
| 260 | Ga0453684_0153399 | 3300044712 | Bacteria | 2734 |
| 261 | Ga0453684_0356691 | 3300044712 | Unclassified | 1647 |
| 262 | Ga0466957_0429762 | 3300044842 | Unclassified | 907 |
| 263 | Ga0451576_0079198 | 3300045051 | Unclassified | 3419 |
| 264 | Ga0451576_0232515 | 3300045051 | Unclassified | 1925 |
| 265 | Ga0451576_0384393 | 3300045051 | Bacteria | 1471 |
| 266 | Ga0451576_0423569 | 3300045051 | Bacteria | 1397 |
| 267 | Ga0451576_0857977 | 3300045051 | Unclassified | 953 |
| 268 | Ga0451576_0885756 | 3300045051 | Bacteria | 937 |
| 269 | Ga0451576_0978722 | 3300045051 | Bacteria | 887 |
| 270 | Ga0451576_1046237 | 3300045051 | Bacteria | 855 |
| 271 | Ga0451576_2042751 | 3300045051 | Unclassified | 590 |
| 272 | Ga0495653_0791148 | 3300046463 | Unclassified | 571 |
| 273 | Ga0495639_0402485 | 3300046475 | Bacteria | 691 |
| 274 | Ga0495662_0035650 | 3300046476 | Bacteria | 2401 |
| 275 | Ga0495662_0455125 | 3300046476 | Bacteria | 628 |
| 276 | Ga0495630_0000153 | 3300046517 | Bacteria | 53609 |
| 277 | Ga0495630_0798426 | 3300046517 | Bacteria | 721 |
| 278 | Ga0495665_0209313 | 3300046531 | Unclassified | 1010 |
| 279 | Ga0495586_0004497 | 3300046535 | Bacteria | 7447 |
| 280 | Ga0495586_0100654 | 3300046535 | Bacteria | 1603 |
| 281 | Ga0495667_0036988 | 3300046559 | Bacteria | 3255 |
| 282 | Ga0495634_0243029 | 3300046642 | Bacteria | 1103 |
| 283 | Ga0495634_0314851 | 3300046642 | Bacteria | 943 |
| 284 | Ga0495658_0002996 | 3300046683 | Bacteria | 8449 |
| 285 | Ga0495613_0001832 | 3300046689 | Bacteria | 16160 |
| 286 | Ga0495613_0644433 | 3300046689 | Bacteria | 701 |
| 287 | Ga0495624_0239271 | 3300046690 | Bacteria | 1099 |
| 288 | Ga0495636_0160125 | 3300047318 | Unclassified | 1014 |
| 289 | Ga0495674_0020654 | 3300047319 | Bacteria | 6097 |
| 290 | Ga0495674_0430387 | 3300047319 | Bacteria | 1062 |
| 291 | Ga0495676_0033762 | 3300047321 | Bacteria | 4302 |
| 292 | Ga0495680_0007113 | 3300047322 | Bacteria | 10306 |
| 293 | Ga0495675_0097101 | 3300047444 | Bacteria | 1847 |
| 294 | Ga0496103_0144600 | 3300048906 | Bacteria | 1522 |
| 295 | Ga0496115_0399179 | 3300048918 | Unclassified | 1116 |
| 296 | Ga0501031_0000093 | 3300049568 | Bacteria | 47816 |
| 297 | Ga0501032_0002367 | 3300049569 | Bacteria | 14733 |
| 298 | Ga0501033_0004623 | 3300049570 | Bacteria | 11023 |
| 299 | Ga0501038_1234036 | 3300049574 | Bacteria | 542 |
| 300 | Ga0501080_0202457 | 3300049742 | Bacteria | 1822 |
| 301 | Ga0501083_0071064 | 3300049744 | Bacteria | 2315 |
| 302 | Ga0501083_0167189 | 3300049744 | Bacteria | 1438 |
| 303 | Ga0501035_0005721 | 3300049822 | Bacteria | 11723 |
| 304 | Ga0501044_0002830 | 3300049823 | Bacteria | 19743 |
| 305 | Ga0501044_0372746 | 3300049823 | Bacteria | 1344 |
| 306 | nmdc:mga08y16_165430_c1 | 3300050511 | Unclassified | 2298 |
| 307 | nmdc:mga08y16_806726_c1 | 3300050511 | Bacteria | 931 |
| 308 | nmdc:mga08y16_9685_c1 | 3300050511 | Bacteria | 10114 |
| 309 | nmdc:mga0n895_865990_c1 | 3300050512 | Bacteria | 890 |
| 310 | nmdc:mga0rr50_576138_c1 | 3300050513 | Bacteria | 959 |
| 311 | nmdc:mga08x19_149162_c1 | 3300050514 | Bacteria | 1582 |
| 312 | nmdc:mga08x19_486872_c1 | 3300050514 | Unclassified | 870 |
| 313 | nmdc:mga0a205_564797_c1 | 3300050515 | Bacteria | 992 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_11854816 | Ga0157375_118548162 | 108 |
| 2 | 3300005440 | Ga0070705_100416595 | Ga0070705_1004165952 | 113 |
| 3 | 3300025949 | Ga0207667_10593271 | Ga0207667_105932711 | 113 |
| 4 | 3300026078 | Ga0207702_11311318 | Ga0207702_113113181 | 113 |
| 5 | 3300048906 | Ga0496103_0144600 | Ga0496103_0144600_1069_1485 | 113 |
| 6 | 3300005340 | Ga0070689_100460412 | Ga0070689_1004604121 | 119 |
| 7 | 3300005365 | Ga0070688_100095079 | Ga0070688_1000950795 | 119 |
| 8 | 3300005466 | Ga0070685_10295654 | Ga0070685_102956542 | 119 |
| 9 | 3300005549 | Ga0070704_100908367 | Ga0070704_1009083672 | 119 |
| 10 | 3300006914 | Ga0075436_100609034 | Ga0075436_1006090342 | 119 |
| 11 | 3300028556 | Ga0265337_1000017 | Ga0265337_100001745 | 119 |
| 12 | 3300028556 | Ga0265337_1008261 | Ga0265337_10082614 | 119 |
| 13 | 3300028558 | Ga0265326_10077216 | Ga0265326_100772162 | 119 |
| 14 | 3300028573 | Ga0265334_10179063 | Ga0265334_101790632 | 119 |
| 15 | 3300028577 | Ga0265318_10181341 | Ga0265318_101813412 | 119 |
| 16 | 3300028666 | Ga0265336_10000543 | Ga0265336_100005433 | 119 |
| 17 | 3300028800 | Ga0265338_10000395 | Ga0265338_1000039545 | 119 |
| 18 | 3300028800 | Ga0265338_10018301 | Ga0265338_100183012 | 119 |
| 19 | 3300031240 | Ga0265320_10111735 | Ga0265320_101117352 | 119 |
| 20 | 3300031249 | Ga0265339_10277742 | Ga0265339_102777422 | 119 |
| 21 | 3300031616 | Ga0307508_10653637 | Ga0307508_106536372 | 119 |
| 22 | 3300050514 | nmdc:mga08x19_486872_c1 | nmdc:mga08x19_486872_c1_381_755 | 119 |
| 23 | 3300005335 | Ga0070666_10266899 | Ga0070666_102668993 | 120 |
| 24 | 3300005343 | Ga0070687_100684731 | Ga0070687_1006847311 | 120 |
| 25 | 3300005444 | Ga0070694_101530450 | Ga0070694_1015304501 | 120 |
| 26 | 3300005459 | Ga0068867_100793138 | Ga0068867_1007931381 | 120 |
| 27 | 3300005544 | Ga0070686_100120262 | Ga0070686_1001202623 | 120 |
| 28 | 3300005577 | Ga0068857_100223574 | Ga0068857_1002235743 | 120 |
| 29 | 3300005617 | Ga0068859_100064078 | Ga0068859_1000640784 | 120 |
| 30 | 3300005618 | Ga0068864_100961545 | Ga0068864_1009615452 | 120 |
| 31 | 3300006931 | Ga0097620_100064079 | Ga0097620_1000640794 | 120 |
| 32 | 3300009094 | Ga0111539_10596973 | Ga0111539_105969732 | 120 |
| 33 | 3300009553 | Ga0105249_10416508 | Ga0105249_104165083 | 120 |
| 34 | 3300009553 | Ga0105249_11138156 | Ga0105249_111381562 | 120 |
| 35 | 3300013308 | Ga0157375_10000172 | Ga0157375_1000017210 | 120 |
| 36 | 3300014325 | Ga0163163_10045217 | Ga0163163_100452175 | 120 |
| 37 | 3300026035 | Ga0207703_11452730 | Ga0207703_114527302 | 120 |
| 38 | 3300026089 | Ga0207648_10280943 | Ga0207648_102809432 | 120 |
| 39 | 3300026095 | Ga0207676_10473814 | Ga0207676_104738143 | 120 |
| 40 | 3300026116 | Ga0207674_10323322 | Ga0207674_103233222 | 120 |
| 41 | 3300005340 | Ga0070689_100034743 | Ga0070689_1000347432 | 121 |
| 42 | 3300005344 | Ga0070661_100326004 | Ga0070661_1003260042 | 121 |
| 43 | 3300005345 | Ga0070692_10307846 | Ga0070692_103078461 | 121 |
| 44 | 3300005353 | Ga0070669_101463190 | Ga0070669_1014631901 | 121 |
| 45 | 3300005365 | Ga0070688_100211907 | Ga0070688_1002119072 | 121 |
| 46 | 3300005435 | Ga0070714_100801266 | Ga0070714_1008012662 | 121 |
| 47 | 3300005466 | Ga0070685_10334803 | Ga0070685_103348032 | 121 |
| 48 | 3300005547 | Ga0070693_100695389 | Ga0070693_1006953892 | 121 |
| 49 | 3300005615 | Ga0070702_100336256 | Ga0070702_1003362562 | 121 |
| 50 | 3300005617 | Ga0068859_100158348 | Ga0068859_1001583484 | 121 |
| 51 | 3300005718 | Ga0068866_10170455 | Ga0068866_101704552 | 121 |
| 52 | 3300005840 | Ga0068870_11043471 | Ga0068870_110434712 | 121 |
| 53 | 3300005841 | Ga0068863_100006428 | Ga0068863_1000064284 | 121 |
| 54 | 3300005844 | Ga0068862_101114265 | Ga0068862_1011142652 | 121 |
| 55 | 3300006028 | Ga0070717_11657141 | Ga0070717_116571411 | 121 |
| 56 | 3300006237 | Ga0097621_100199054 | Ga0097621_1001990542 | 121 |
| 57 | 3300006358 | Ga0068871_100021119 | Ga0068871_1000211193 | 121 |
| 58 | 3300006931 | Ga0097620_100158344 | Ga0097620_1001583442 | 121 |
| 59 | 3300006931 | Ga0097620_101916459 | Ga0097620_1019164592 | 121 |
| 60 | 3300009094 | Ga0111539_10345231 | Ga0111539_103452313 | 121 |
| 61 | 3300009094 | Ga0111539_10648137 | Ga0111539_106481371 | 121 |
| 62 | 3300009098 | Ga0105245_11016272 | Ga0105245_110162722 | 121 |
| 63 | 3300010159 | Ga0099796_10073636 | Ga0099796_100736362 | 121 |
| 64 | 3300013296 | Ga0157374_10733490 | Ga0157374_107334902 | 121 |
| 65 | 3300013296 | Ga0157374_11020254 | Ga0157374_110202542 | 121 |
| 66 | 3300013297 | Ga0157378_10308071 | Ga0157378_103080712 | 121 |
| 67 | 3300014968 | Ga0157379_10248381 | Ga0157379_102483811 | 121 |
| 68 | 3300025906 | Ga0207699_10561687 | Ga0207699_105616872 | 121 |
| 69 | 3300025929 | Ga0207664_10914408 | Ga0207664_109144081 | 121 |
| 70 | 3300025936 | Ga0207670_10009614 | Ga0207670_100096143 | 121 |
| 71 | 3300026088 | Ga0207641_10067877 | Ga0207641_100678772 | 121 |
| 72 | 3300027907 | Ga0207428_10660205 | Ga0207428_106602052 | 121 |
| 73 | 3300028654 | Ga0265322_10230455 | Ga0265322_102304551 | 121 |
| 74 | 3300028800 | Ga0265338_10007701 | Ga0265338_1000770110 | 121 |
| 75 | 3300028800 | Ga0265338_10012058 | Ga0265338_100120584 | 121 |
| 76 | 3300031235 | Ga0265330_10258910 | Ga0265330_102589102 | 121 |
| 77 | 3300031238 | Ga0265332_10013455 | Ga0265332_100134554 | 121 |
| 78 | 3300031239 | Ga0265328_10139942 | Ga0265328_101399421 | 121 |
| 79 | 3300031242 | Ga0265329_10004711 | Ga0265329_100047115 | 121 |
| 80 | 3300031247 | Ga0265340_10007749 | Ga0265340_100077496 | 121 |
| 81 | 3300031344 | Ga0265316_10213136 | Ga0265316_102131363 | 121 |
| 82 | 3300031344 | Ga0265316_10274188 | Ga0265316_102741882 | 121 |
| 83 | 3300031344 | Ga0265316_11077872 | Ga0265316_110778721 | 121 |
| 84 | 3300031711 | Ga0265314_10000170 | Ga0265314_1000017041 | 121 |
| 85 | 3300031711 | Ga0265314_10108728 | Ga0265314_101087281 | 121 |
| 86 | 3300031712 | Ga0265342_10283735 | Ga0265342_102837351 | 121 |
| 87 | 3300035695 | Ga0373927_0798485 | Ga0373927_0798485_91_462 | 121 |
| 88 | 3300037068 | Ga0373925_0523745 | Ga0373925_0523745_475_858 | 121 |
| 89 | 3300042876 | Ga0451577_0003467 | Ga0451577_0003467_9365_9742 | 121 |
| 90 | 3300045051 | Ga0451576_0423569 | Ga0451576_0423569_508_882 | 121 |
| 91 | 3300045051 | Ga0451576_0978722 | Ga0451576_0978722_460_834 | 121 |
| 92 | 3300045051 | Ga0451576_1046237 | Ga0451576_1046237_274_648 | 121 |
| 93 | 3300046475 | Ga0495639_0402485 | Ga0495639_0402485_184_567 | 121 |
| 94 | 3300046476 | Ga0495662_0035650 | Ga0495662_0035650_1724_2107 | 121 |
| 95 | 3300046517 | Ga0495630_0000153 | Ga0495630_0000153_22518_22901 | 121 |
| 96 | 3300046531 | Ga0495665_0209313 | Ga0495665_0209313_10_393 | 121 |
| 97 | 3300046535 | Ga0495586_0004497 | Ga0495586_0004497_926_1309 | 121 |
| 98 | 3300046642 | Ga0495634_0243029 | Ga0495634_0243029_349_732 | 121 |
| 99 | 3300046689 | Ga0495613_0644433 | Ga0495613_0644433_82_465 | 121 |
| 100 | 3300046690 | Ga0495624_0239271 | Ga0495624_0239271_639_1022 | 121 |
| 101 | 3300047319 | Ga0495674_0020654 | Ga0495674_0020654_1454_1837 | 121 |
| 102 | 3300047321 | Ga0495676_0033762 | Ga0495676_0033762_2515_2898 | 121 |
| 103 | 3300050511 | nmdc:mga08y16_165430_c1 | nmdc:mga08y16_165430_c1_304_678 | 121 |
| 104 | 3300050512 | nmdc:mga0n895_865990_c1 | nmdc:mga0n895_865990_c1_130_504 | 121 |
| 105 | 3300050515 | nmdc:mga0a205_564797_c1 | nmdc:mga0a205_564797_c1_561_935 | 121 |
| 106 | 3300000545 | CNXas_1015064 | CNXas_10150641 | 122 |
| 107 | 3300003323 | rootH1_10165333 | rootH1_101653331 | 122 |
| 108 | 3300005295 | Ga0065707_10407009 | Ga0065707_104070092 | 122 |
| 109 | 3300005327 | Ga0070658_10039944 | Ga0070658_100399444 | 122 |
| 110 | 3300005329 | Ga0070683_100080422 | Ga0070683_1000804221 | 122 |
| 111 | 3300005330 | Ga0070690_100024160 | Ga0070690_1000241602 | 122 |
| 112 | 3300005331 | Ga0070670_100211758 | Ga0070670_1002117583 | 122 |
| 113 | 3300005339 | Ga0070660_100856755 | Ga0070660_1008567552 | 122 |
| 114 | 3300005340 | Ga0070689_100030328 | Ga0070689_1000303287 | 122 |
| 115 | 3300005340 | Ga0070689_100047064 | Ga0070689_1000470644 | 122 |
| 116 | 3300005340 | Ga0070689_100112326 | Ga0070689_1001123264 | 122 |
| 117 | 3300005340 | Ga0070689_100252202 | Ga0070689_1002522022 | 122 |
| 118 | 3300005341 | Ga0070691_10126090 | Ga0070691_101260901 | 122 |
| 119 | 3300005354 | Ga0070675_100387488 | Ga0070675_1003874883 | 122 |
| 120 | 3300005354 | Ga0070675_100484944 | Ga0070675_1004849443 | 122 |
| 121 | 3300005364 | Ga0070673_101757864 | Ga0070673_1017578642 | 122 |
| 122 | 3300005365 | Ga0070688_100004790 | Ga0070688_1000047902 | 122 |
| 123 | 3300005435 | Ga0070714_100319834 | Ga0070714_1003198341 | 122 |
| 124 | 3300005438 | Ga0070701_10311455 | Ga0070701_103114551 | 122 |
| 125 | 3300005440 | Ga0070705_100132479 | Ga0070705_1001324792 | 122 |
| 126 | 3300005444 | Ga0070694_100004538 | Ga0070694_1000045381 | 122 |
| 127 | 3300005445 | Ga0070708_100901159 | Ga0070708_1009011592 | 122 |
| 128 | 3300005456 | Ga0070678_102230023 | Ga0070678_1022300231 | 122 |
| 129 | 3300005458 | Ga0070681_11215074 | Ga0070681_112150742 | 122 |
| 130 | 3300005466 | Ga0070685_10253338 | Ga0070685_102533382 | 122 |
| 131 | 3300005471 | Ga0070698_101788556 | Ga0070698_1017885561 | 122 |
| 132 | 3300005530 | Ga0070679_100454390 | Ga0070679_1004543902 | 122 |
| 133 | 3300005539 | Ga0068853_100213203 | Ga0068853_1002132033 | 122 |
| 134 | 3300005539 | Ga0068853_100437328 | Ga0068853_1004373282 | 122 |
| 135 | 3300005544 | Ga0070686_100022577 | Ga0070686_1000225773 | 122 |
| 136 | 3300005544 | Ga0070686_100109408 | Ga0070686_1001094083 | 122 |
| 137 | 3300005547 | Ga0070693_100998278 | Ga0070693_1009982781 | 122 |
| 138 | 3300005549 | Ga0070704_100395426 | Ga0070704_1003954262 | 122 |
| 139 | 3300005563 | Ga0068855_100174867 | Ga0068855_1001748673 | 122 |
| 140 | 3300005563 | Ga0068855_100551415 | Ga0068855_1005514152 | 122 |
| 141 | 3300005563 | Ga0068855_100955525 | Ga0068855_1009555252 | 122 |
| 142 | 3300005563 | Ga0068855_101239593 | Ga0068855_1012395931 | 122 |
| 143 | 3300005577 | Ga0068857_100173030 | Ga0068857_1001730302 | 122 |
| 144 | 3300005614 | Ga0068856_100000561 | Ga0068856_1000005613 | 122 |
| 145 | 3300005614 | Ga0068856_100063736 | Ga0068856_1000637363 | 122 |
| 146 | 3300005614 | Ga0068856_100473370 | Ga0068856_1004733701 | 122 |
| 147 | 3300005615 | Ga0070702_100738685 | Ga0070702_1007386851 | 122 |
| 148 | 3300005616 | Ga0068852_101787875 | Ga0068852_1017878751 | 122 |
| 149 | 3300005617 | Ga0068859_100097832 | Ga0068859_1000978323 | 122 |
| 150 | 3300005617 | Ga0068859_100124472 | Ga0068859_1001244723 | 122 |
| 151 | 3300005617 | Ga0068859_100507281 | Ga0068859_1005072813 | 122 |
| 152 | 3300005844 | Ga0068862_101250472 | Ga0068862_1012504721 | 122 |
| 153 | 3300006173 | Ga0070716_101560919 | Ga0070716_1015609191 | 122 |
| 154 | 3300006844 | Ga0075428_100011208 | Ga0075428_1000112088 | 122 |
| 155 | 3300006847 | Ga0075431_100334284 | Ga0075431_1003342843 | 122 |
| 156 | 3300006871 | Ga0075434_101996169 | Ga0075434_1019961692 | 122 |
| 157 | 3300006880 | Ga0075429_100179046 | Ga0075429_1001790462 | 122 |
| 158 | 3300006931 | Ga0097620_100097832 | Ga0097620_1000978323 | 122 |
| 159 | 3300006931 | Ga0097620_100124468 | Ga0097620_1001244683 | 122 |
| 160 | 3300006931 | Ga0097620_100507260 | Ga0097620_1005072603 | 122 |
| 161 | 3300007076 | Ga0075435_100944060 | Ga0075435_1009440602 | 122 |
| 162 | 3300009093 | Ga0105240_10133026 | Ga0105240_101330264 | 122 |
| 163 | 3300009093 | Ga0105240_10150521 | Ga0105240_101505213 | 122 |
| 164 | 3300009093 | Ga0105240_10161957 | Ga0105240_101619574 | 122 |
| 165 | 3300009094 | Ga0111539_10006153 | Ga0111539_100061532 | 122 |
| 166 | 3300009094 | Ga0111539_10411553 | Ga0111539_104115533 | 122 |
| 167 | 3300009094 | Ga0111539_10767780 | Ga0111539_107677801 | 122 |
| 168 | 3300009094 | Ga0111539_10837190 | Ga0111539_108371901 | 122 |
| 169 | 3300009098 | Ga0105245_12982172 | Ga0105245_129821721 | 122 |
| 170 | 3300009147 | Ga0114129_11582195 | Ga0114129_115821951 | 122 |
| 171 | 3300009176 | Ga0105242_10824510 | Ga0105242_108245101 | 122 |
| 172 | 3300009545 | Ga0105237_10128077 | Ga0105237_101280773 | 122 |
| 173 | 3300009551 | Ga0105238_10004479 | Ga0105238_100044799 | 122 |
| 174 | 3300009551 | Ga0105238_10052545 | Ga0105238_100525454 | 122 |
| 175 | 3300009551 | Ga0105238_10349221 | Ga0105238_103492212 | 122 |
| 176 | 3300009553 | Ga0105249_10137191 | Ga0105249_101371912 | 122 |
| 177 | 3300013296 | Ga0157374_10234139 | Ga0157374_102341392 | 122 |
| 178 | 3300013297 | Ga0157378_10267725 | Ga0157378_102677253 | 122 |
| 179 | 3300013297 | Ga0157378_12820921 | Ga0157378_128209211 | 122 |
| 180 | 3300013307 | Ga0157372_10193003 | Ga0157372_101930033 | 122 |
| 181 | 3300013307 | Ga0157372_11807234 | Ga0157372_118072342 | 122 |
| 182 | 3300013308 | Ga0157375_11177943 | Ga0157375_111779432 | 122 |
| 183 | 3300014325 | Ga0163163_11819514 | Ga0163163_118195142 | 122 |
| 184 | 3300014969 | Ga0157376_10944433 | Ga0157376_109444332 | 122 |
| 185 | 3300025905 | Ga0207685_10428572 | Ga0207685_104285721 | 122 |
| 186 | 3300025909 | Ga0207705_10047623 | Ga0207705_100476233 | 122 |
| 187 | 3300025909 | Ga0207705_10052279 | Ga0207705_100522793 | 122 |
| 188 | 3300025912 | Ga0207707_10973318 | Ga0207707_109733181 | 122 |
| 189 | 3300025913 | Ga0207695_10376041 | Ga0207695_103760412 | 122 |
| 190 | 3300025913 | Ga0207695_10507357 | Ga0207695_105073572 | 122 |
| 191 | 3300025913 | Ga0207695_10785665 | Ga0207695_107856652 | 122 |
| 192 | 3300025914 | Ga0207671_10854774 | Ga0207671_108547741 | 122 |
| 193 | 3300025919 | Ga0207657_10622690 | Ga0207657_106226902 | 122 |
| 194 | 3300025921 | Ga0207652_11465801 | Ga0207652_114658012 | 122 |
| 195 | 3300025924 | Ga0207694_10040514 | Ga0207694_100405142 | 122 |
| 196 | 3300025925 | Ga0207650_10162909 | Ga0207650_101629091 | 122 |
| 197 | 3300025933 | Ga0207706_11204411 | Ga0207706_112044111 | 122 |
| 198 | 3300025936 | Ga0207670_10104629 | Ga0207670_101046294 | 122 |
| 199 | 3300025936 | Ga0207670_10209622 | Ga0207670_102096222 | 122 |
| 200 | 3300025949 | Ga0207667_10095859 | Ga0207667_100958593 | 122 |
| 201 | 3300025949 | Ga0207667_10191788 | Ga0207667_101917883 | 122 |
| 202 | 3300025949 | Ga0207667_10207189 | Ga0207667_102071893 | 122 |
| 203 | 3300025949 | Ga0207667_10702800 | Ga0207667_107028002 | 122 |
| 204 | 3300025949 | Ga0207667_10709418 | Ga0207667_107094182 | 122 |
| 205 | 3300026041 | Ga0207639_10407436 | Ga0207639_104074362 | 122 |
| 206 | 3300026078 | Ga0207702_10001938 | Ga0207702_1000193816 | 122 |
| 207 | 3300026078 | Ga0207702_10071833 | Ga0207702_100718333 | 122 |
| 208 | 3300026078 | Ga0207702_10120241 | Ga0207702_101202413 | 122 |
| 209 | 3300026078 | Ga0207702_11226621 | Ga0207702_112266211 | 122 |
| 210 | 3300026089 | Ga0207648_10620033 | Ga0207648_106200332 | 122 |
| 211 | 3300028556 | Ga0265337_1002754 | Ga0265337_10027548 | 122 |
| 212 | 3300028556 | Ga0265337_1008663 | Ga0265337_10086632 | 122 |
| 213 | 3300028556 | Ga0265337_1015498 | Ga0265337_10154983 | 122 |
| 214 | 3300028558 | Ga0265326_10017843 | Ga0265326_100178434 | 122 |
| 215 | 3300028563 | Ga0265319_1026599 | Ga0265319_10265992 | 122 |
| 216 | 3300028666 | Ga0265336_10013725 | Ga0265336_100137251 | 122 |
| 217 | 3300028666 | Ga0265336_10091313 | Ga0265336_100913132 | 122 |
| 218 | 3300028800 | Ga0265338_10000084 | Ga0265338_10000084132 | 122 |
| 219 | 3300028800 | Ga0265338_10010753 | Ga0265338_100107533 | 122 |
| 220 | 3300028800 | Ga0265338_10012049 | Ga0265338_100120496 | 122 |
| 221 | 3300028800 | Ga0265338_10055842 | Ga0265338_100558422 | 122 |
| 222 | 3300028800 | Ga0265338_10089370 | Ga0265338_100893703 | 122 |
| 223 | 3300028800 | Ga0265338_10551862 | Ga0265338_105518621 | 122 |
| 224 | 3300028800 | Ga0265338_10567508 | Ga0265338_105675082 | 122 |
| 225 | 3300029957 | Ga0265324_10000058 | Ga0265324_1000005810 | 122 |
| 226 | 3300029957 | Ga0265324_10032403 | Ga0265324_100324034 | 122 |
| 227 | 3300029957 | Ga0265324_10041262 | Ga0265324_100412623 | 122 |
| 228 | 3300031238 | Ga0265332_10037757 | Ga0265332_100377572 | 122 |
| 229 | 3300031240 | Ga0265320_10008824 | Ga0265320_100088243 | 122 |
| 230 | 3300031240 | Ga0265320_10011494 | Ga0265320_100114943 | 122 |
| 231 | 3300031240 | Ga0265320_10177036 | Ga0265320_101770361 | 122 |
| 232 | 3300031241 | Ga0265325_10011036 | Ga0265325_100110367 | 122 |
| 233 | 3300031241 | Ga0265325_10183844 | Ga0265325_101838442 | 122 |
| 234 | 3300031247 | Ga0265340_10000162 | Ga0265340_1000016222 | 122 |
| 235 | 3300031247 | Ga0265340_10010082 | Ga0265340_100100822 | 122 |
| 236 | 3300031249 | Ga0265339_10458367 | Ga0265339_104583671 | 122 |
| 237 | 3300031250 | Ga0265331_10404720 | Ga0265331_104047201 | 122 |
| 238 | 3300031251 | Ga0265327_10004378 | Ga0265327_100043783 | 122 |
| 239 | 3300031251 | Ga0265327_10395161 | Ga0265327_103951611 | 122 |
| 240 | 3300031344 | Ga0265316_10090474 | Ga0265316_100904742 | 122 |
| 241 | 3300031344 | Ga0265316_11212639 | Ga0265316_112126391 | 122 |
| 242 | 3300031344 | Ga0265316_11309219 | Ga0265316_113092191 | 122 |
| 243 | 3300031595 | Ga0265313_10251643 | Ga0265313_102516432 | 122 |
| 244 | 3300031711 | Ga0265314_10254562 | Ga0265314_102545622 | 122 |
| 245 | 3300031712 | Ga0265342_10051295 | Ga0265342_100512953 | 122 |
| 246 | 3300034816 | Ga0373930_0001021 | Ga0373930_0001021_1412_1786 | 122 |
| 247 | 3300034818 | Ga0373950_0005248 | Ga0373950_0005248_540_914 | 122 |
| 248 | 3300034957 | Ga0373938_0007319 | Ga0373938_0007319_272_646 | 122 |
| 249 | 3300035084 | Ga0373928_0000018 | Ga0373928_0000018_5534_5908 | 122 |
| 250 | 3300035085 | Ga0373929_0001189 | Ga0373929_0001189_3643_4017 | 122 |
| 251 | 3300035089 | Ga0373944_0002659 | Ga0373944_0002659_134_508 | 122 |
| 252 | 3300035089 | Ga0373944_0288384 | Ga0373944_0288384_143_520 | 122 |
| 253 | 3300035090 | Ga0373949_0002010 | Ga0373949_0002010_3550_3924 | 122 |
| 254 | 3300035091 | Ga0373951_0031709 | Ga0373951_0031709_336_710 | 122 |
| 255 | 3300035112 | Ga0373932_0000004 | Ga0373932_0000004_275054_275428 | 122 |
| 256 | 3300035115 | Ga0373941_0120706 | Ga0373941_0120706_35_409 | 122 |
| 257 | 3300035118 | Ga0373954_0174152 | Ga0373954_0174152_242_613 | 122 |
| 258 | 3300035119 | Ga0373956_0416688 | Ga0373956_0416688_112_504 | 122 |
| 259 | 3300035121 | Ga0373960_0216842 | Ga0373960_0216842_134_508 | 122 |
| 260 | 3300035170 | Ga0373943_0193848 | Ga0373943_0193848_604_978 | 122 |
| 261 | 3300035171 | Ga0373946_0117747 | Ga0373946_0117747_802_1176 | 122 |
| 262 | 3300035242 | Ga0373962_0000015 | Ga0373962_0000015_43234_43608 | 122 |
| 263 | 3300035691 | Ga0373931_0000009 | Ga0373931_0000009_343744_344118 | 122 |
| 264 | 3300035692 | Ga0373935_0035831 | Ga0373935_0035831_38_412 | 122 |
| 265 | 3300035695 | Ga0373927_0033029 | Ga0373927_0033029_2606_2980 | 122 |
| 266 | 3300035695 | Ga0373927_0045739 | Ga0373927_0045739_939_1313 | 122 |
| 267 | 3300035695 | Ga0373927_0177705 | Ga0373927_0177705_875_1252 | 122 |
| 268 | 3300035695 | Ga0373927_0730712 | Ga0373927_0730712_191_565 | 122 |
| 269 | 3300035724 | Ga0373933_0175975 | Ga0373933_0175975_65_436 | 122 |
| 270 | 3300035724 | Ga0373933_0865695 | Ga0373933_0865695_95_487 | 122 |
| 271 | 3300035725 | Ga0373947_0507901 | Ga0373947_0507901_138_512 | 122 |
| 272 | 3300037068 | Ga0373925_0001059 | Ga0373925_0001059_213_587 | 122 |
| 273 | 3300037068 | Ga0373925_0005171 | Ga0373925_0005171_3979_4353 | 122 |
| 274 | 3300037068 | Ga0373925_0360405 | Ga0373925_0360405_151_528 | 122 |
| 275 | 3300042003 | Ga0439443_078453 | Ga0439443_078453_105_488 | 122 |
| 276 | 3300042436 | Ga0439435_0063259 | Ga0439435_0063259_386_772 | 122 |
| 277 | 3300044712 | Ga0453684_0027362 | Ga0453684_0027362_7066_7446 | 122 |
| 278 | 3300044712 | Ga0453684_0153399 | Ga0453684_0153399_234_608 | 122 |
| 279 | 3300044712 | Ga0453684_0356691 | Ga0453684_0356691_612_986 | 122 |
| 280 | 3300044842 | Ga0466957_0429762 | Ga0466957_0429762_484_858 | 122 |
| 281 | 3300045051 | Ga0451576_0079198 | Ga0451576_0079198_1110_1490 | 122 |
| 282 | 3300045051 | Ga0451576_0232515 | Ga0451576_0232515_1204_1641 | 122 |
| 283 | 3300045051 | Ga0451576_0384393 | Ga0451576_0384393_849_1220 | 122 |
| 284 | 3300045051 | Ga0451576_0857977 | Ga0451576_0857977_294_677 | 122 |
| 285 | 3300045051 | Ga0451576_0885756 | Ga0451576_0885756_348_728 | 122 |
| 286 | 3300045051 | Ga0451576_2042751 | Ga0451576_2042751_186_563 | 122 |
| 287 | 3300046463 | Ga0495653_0791148 | Ga0495653_0791148_115_528 | 122 |
| 288 | 3300046476 | Ga0495662_0455125 | Ga0495662_0455125_33_404 | 122 |
| 289 | 3300046517 | Ga0495630_0798426 | Ga0495630_0798426_97_471 | 122 |
| 290 | 3300046535 | Ga0495586_0100654 | Ga0495586_0100654_396_767 | 122 |
| 291 | 3300046559 | Ga0495667_0036988 | Ga0495667_0036988_1435_1806 | 122 |
| 292 | 3300046642 | Ga0495634_0314851 | Ga0495634_0314851_62_433 | 122 |
| 293 | 3300046683 | Ga0495658_0002996 | Ga0495658_0002996_2475_2849 | 122 |
| 294 | 3300046689 | Ga0495613_0001832 | Ga0495613_0001832_2111_2482 | 122 |
| 295 | 3300047318 | Ga0495636_0160125 | Ga0495636_0160125_567_947 | 122 |
| 296 | 3300047319 | Ga0495674_0430387 | Ga0495674_0430387_555_926 | 122 |
| 297 | 3300047322 | Ga0495680_0007113 | Ga0495680_0007113_1877_2248 | 122 |
| 298 | 3300047444 | Ga0495675_0097101 | Ga0495675_0097101_264_641 | 122 |
| 299 | 3300048918 | Ga0496115_0399179 | Ga0496115_0399179_628_1002 | 122 |
| 300 | 3300049568 | Ga0501031_0000093 | Ga0501031_0000093_9751_10128 | 122 |
| 301 | 3300049569 | Ga0501032_0002367 | Ga0501032_0002367_7245_7622 | 122 |
| 302 | 3300049570 | Ga0501033_0004623 | Ga0501033_0004623_6926_7303 | 122 |
| 303 | 3300049574 | Ga0501038_1234036 | Ga0501038_1234036_16_393 | 122 |
| 304 | 3300049742 | Ga0501080_0202457 | Ga0501080_0202457_342_719 | 122 |
| 305 | 3300049744 | Ga0501083_0071064 | Ga0501083_0071064_124_501 | 122 |
| 306 | 3300049744 | Ga0501083_0167189 | Ga0501083_0167189_525_908 | 122 |
| 307 | 3300049822 | Ga0501035_0005721 | Ga0501035_0005721_8066_8443 | 122 |
| 308 | 3300049823 | Ga0501044_0002830 | Ga0501044_0002830_9805_10182 | 122 |
| 309 | 3300049823 | Ga0501044_0372746 | Ga0501044_0372746_589_966 | 122 |
| 310 | 3300050511 | nmdc:mga08y16_806726_c1 | nmdc:mga08y16_806726_c1_50_421 | 122 |
| 311 | 3300050511 | nmdc:mga08y16_9685_c1 | nmdc:mga08y16_9685_c1_134_514 | 122 |
| 312 | 3300050513 | nmdc:mga0rr50_576138_c1 | nmdc:mga0rr50_576138_c1_372_743 | 122 |
| 313 | 3300050514 | nmdc:mga08x19_149162_c1 | nmdc:mga08x19_149162_c1_1192_1563 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wcw-assembly1.cif.gz_B | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9124 | 1 | 109 |
| 4wcw-assembly2.cif.gz_C | ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis | 0.9113 | 1 | 111 |
| 2o5a-assembly1.cif.gz_B | crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 | 0.9044 | 4 | 113 |
| 7bl5-assembly1.cif.gz_6 | pre-50s-obge particle | 0.9044 | 4 | 99 |
| 6sj6-assembly1.cif.gz_9 | cryo-em structure of 50s-rsfs complex from staphylococcus aureus | 0.9016 | 1 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAT6_2_105_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9526 | 4 | 105 | 3.30.460.10 |
| 2id1B01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9375 | 2 | 106 | 3.30.460.10 |
| af_A0A0R0INC8_150_261_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9339 | 2 | 115 | 3.30.460.10 |
| 2id1B01 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.9289 | 2 | 106 | 3.30.460.10 |
| af_A0A0R0INC8_150_261_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.926 | 2 | 115 | 3.30.460.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5W1X4-F1-model_v4 | Ribosome silencing factor | 0.9839 | 1 | 92 |
GO:0017148
GO:0043023 GO:0090071 |
| AF-A0A257X574-F1-model_v4 | Ribosome silencing factor | 0.9821 | 1 | 92 |
GO:0017148
GO:0043023 GO:0090071 |
| AF-A0A838RF78-F1-model_v4 | Ribosomal silencing factor RsfS | 0.9729 | 2 | 112 |
GO:0005737
GO:0017148 GO:0042256 GO:0043023 GO:0090071 |
| AF-A0A257X574-F1-model_v4 | Ribosome silencing factor | 0.9717 | 1 | 92 |
GO:0017148
GO:0043023 GO:0090071 |
| AF-A0A6P0Y1Y9-F1-model_v4 | Ribosome silencing factor | 0.9703 | 3 | 92 |
GO:0017148
GO:0043023 GO:0090071 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar