F402070

General Info

Members Datasets Scaffolds Average Seq Length
313 176 313 126

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100416595|Ga0070705_1004165952
Length 138
Sequence VTEPARNPIGLPNRSADAATAAPDMPPLELARRIVELAEDKKAADIVLLDLTGLTTVADYFVIASGGSERQLDAIADGIVSGMRDERVHAFGREGRAASHWVLVDFGSVIVHVFTPPERDYYQLERHWAEAKTILRVQ

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
119 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1015064 3300000545 Unclassified 558
2 rootH1_10165333 3300003323 Eukaryota 1106
3 Ga0065707_10407009 3300005295 Unclassified 846
4 Ga0070658_10039944 3300005327 Bacteria 3786
5 Ga0070683_100080422 3300005329 Bacteria 3050
6 Ga0070690_100024160 3300005330 Bacteria 3737
7 Ga0070670_100211758 3300005331 Bacteria 1685
8 Ga0070666_10266899 3300005335 Bacteria 1214
9 Ga0070660_100856755 3300005339 Unclassified 765
10 Ga0070689_100030328 3300005340 Bacteria 4104
11 Ga0070689_100034743 3300005340 Bacteria 3847
12 Ga0070689_100047064 3300005340 Bacteria 3325
13 Ga0070689_100112326 3300005340 Bacteria 2169
14 Ga0070689_100252202 3300005340 Unclassified 1456
15 Ga0070689_100460412 3300005340 Unclassified 1083
16 Ga0070691_10126090 3300005341 Unclassified 1293
17 Ga0070687_100684731 3300005343 Unclassified 714
18 Ga0070661_100326004 3300005344 Unclassified 1200
19 Ga0070692_10307846 3300005345 Bacteria 969
20 Ga0070669_101463190 3300005353 Unclassified 593
21 Ga0070675_100387488 3300005354 Unclassified 1245
22 Ga0070675_100484944 3300005354 Unclassified 1112
23 Ga0070673_101757864 3300005364 Unclassified 587
24 Ga0070688_100004790 3300005365 Bacteria 7074
25 Ga0070688_100095079 3300005365 Bacteria 1955
26 Ga0070688_100211907 3300005365 Bacteria 1361
27 Ga0070714_100319834 3300005435 Unclassified 1451
28 Ga0070714_100801266 3300005435 Unclassified 912
29 Ga0070701_10311455 3300005438 Bacteria 971
30 Ga0070705_100132479 3300005440 Bacteria 1628
31 Ga0070705_100416595 3300005440 Bacteria 999
32 Ga0070694_100004538 3300005444 Bacteria 8346
33 Ga0070694_101530450 3300005444 Bacteria 565
34 Ga0070708_100901159 3300005445 Unclassified 830
35 Ga0070678_102230023 3300005456 Unclassified 519
36 Ga0070681_11215074 3300005458 Unclassified 676
37 Ga0068867_100793138 3300005459 Bacteria 844
38 Ga0070685_10253338 3300005466 Bacteria 1167
39 Ga0070685_10295654 3300005466 Unclassified 1090
40 Ga0070685_10334803 3300005466 Bacteria 1030
41 Ga0070698_101788556 3300005471 Unclassified 567
42 Ga0070679_100454390 3300005530 Bacteria 1226
43 Ga0068853_100213203 3300005539 Unclassified 1761
44 Ga0068853_100437328 3300005539 Bacteria 1229
45 Ga0070686_100022577 3300005544 Bacteria 3749
46 Ga0070686_100109408 3300005544 Bacteria 1880
47 Ga0070686_100120262 3300005544 Bacteria 1802
48 Ga0070693_100695389 3300005547 Bacteria 744
49 Ga0070693_100998278 3300005547 Bacteria 633
50 Ga0070704_100395426 3300005549 Bacteria 1178
51 Ga0070704_100908367 3300005549 Unclassified 792
52 Ga0068855_100174867 3300005563 Unclassified 2430
53 Ga0068855_100551415 3300005563 Unclassified 1248
54 Ga0068855_100955525 3300005563 Unclassified 902
55 Ga0068855_101239593 3300005563 Unclassified 774
56 Ga0068857_100173030 3300005577 Bacteria 1963
57 Ga0068857_100223574 3300005577 Bacteria 1720
58 Ga0068856_100000561 3300005614 Bacteria 40801
59 Ga0068856_100063736 3300005614 Bacteria 3641
60 Ga0068856_100473370 3300005614 Bacteria 1273
61 Ga0070702_100336256 3300005615 Bacteria 1058
62 Ga0070702_100738685 3300005615 Unclassified 754
63 Ga0068852_101787875 3300005616 Unclassified 637
64 Ga0068859_100064078 3300005617 Bacteria 3707
65 Ga0068859_100097832 3300005617 Bacteria 2988
66 Ga0068859_100124472 3300005617 Bacteria 2646
67 Ga0068859_100158348 3300005617 Bacteria 2343
68 Ga0068859_100507281 3300005617 Unclassified 1301
69 Ga0068864_100961545 3300005618 Bacteria 846
70 Ga0068866_10170455 3300005718 Bacteria 1277
71 Ga0068870_11043471 3300005840 Unclassified 585
72 Ga0068863_100006428 3300005841 Bacteria 11523
73 Ga0068862_101114265 3300005844 Unclassified 785
74 Ga0068862_101250472 3300005844 Unclassified 742
75 Ga0070717_11657141 3300006028 Unclassified 579
76 Ga0070716_101560919 3300006173 Unclassified 541
77 Ga0097621_100199054 3300006237 Bacteria 1738
78 Ga0068871_100021119 3300006358 Bacteria 4999
79 Ga0075428_100011208 3300006844 Bacteria 9977
80 Ga0075431_100334284 3300006847 Bacteria 1525
81 Ga0075434_101996169 3300006871 Unclassified 585
82 Ga0075429_100179046 3300006880 Bacteria 1858
83 Ga0075436_100609034 3300006914 Unclassified 805
84 Ga0097620_100064079 3300006931 Bacteria 3707
85 Ga0097620_100097832 3300006931 Bacteria 2988
86 Ga0097620_100124468 3300006931 Bacteria 2646
87 Ga0097620_100158344 3300006931 Bacteria 2343
88 Ga0097620_100507260 3300006931 Unclassified 1301
89 Ga0097620_101916459 3300006931 Unclassified 654
90 Ga0075435_100944060 3300007076 Bacteria 753
91 Ga0105240_10133026 3300009093 Bacteria 2981
92 Ga0105240_10150521 3300009093 Bacteria 2772
93 Ga0105240_10161957 3300009093 Unclassified 2656
94 Ga0111539_10006153 3300009094 Bacteria 15495
95 Ga0111539_10345231 3300009094 Bacteria 1732
96 Ga0111539_10411553 3300009094 Bacteria 1575
97 Ga0111539_10596973 3300009094 Bacteria 1286
98 Ga0111539_10648137 3300009094 Bacteria 1230
99 Ga0111539_10767780 3300009094 Unclassified 1122
100 Ga0111539_10837190 3300009094 Bacteria 1070
101 Ga0105245_11016272 3300009098 Bacteria 874
102 Ga0105245_12982172 3300009098 Unclassified 525
103 Ga0114129_11582195 3300009147 Unclassified 803
104 Ga0105242_10824510 3300009176 Bacteria 920
105 Ga0105237_10128077 3300009545 Bacteria 2533
106 Ga0105238_10004479 3300009551 Bacteria 13848
107 Ga0105238_10052545 3300009551 Bacteria 4096
108 Ga0105238_10349221 3300009551 Unclassified 1468
109 Ga0105249_10137191 3300009553 Bacteria 2342
110 Ga0105249_10416508 3300009553 Bacteria 1376
111 Ga0105249_11138156 3300009553 Bacteria 851
112 Ga0099796_10073636 3300010159 Unclassified 1238
113 Ga0157374_10234139 3300013296 Unclassified 1805
114 Ga0157374_10733490 3300013296 Bacteria 1002
115 Ga0157374_11020254 3300013296 Unclassified 847
116 Ga0157378_10267725 3300013297 Bacteria 1642
117 Ga0157378_10308071 3300013297 Unclassified 1535
118 Ga0157378_12820921 3300013297 Unclassified 538
119 Ga0157372_10193003 3300013307 Unclassified 2359
120 Ga0157372_11807234 3300013307 Archaea 703
121 Ga0157375_10000172 3300013308 Bacteria 60073
122 Ga0157375_11177943 3300013308 Unclassified 898
123 Ga0157375_11854816 3300013308 Unclassified 715
124 Ga0163163_10045217 3300014325 Unclassified 4321
125 Ga0163163_11819514 3300014325 Bacteria 669
126 Ga0157379_10248381 3300014968 Bacteria 1615
127 Ga0157376_10944433 3300014969 Bacteria 882
128 Ga0207685_10428572 3300025905 Unclassified 683
129 Ga0207699_10561687 3300025906 Bacteria 828
130 Ga0207705_10047623 3300025909 Unclassified 3083
131 Ga0207705_10052279 3300025909 Bacteria 2941
132 Ga0207707_10973318 3300025912 Unclassified 698
133 Ga0207695_10376041 3300025913 Unclassified 1306
134 Ga0207695_10507357 3300025913 Bacteria 1088
135 Ga0207695_10785665 3300025913 Unclassified 832
136 Ga0207671_10854774 3300025914 Bacteria 720
137 Ga0207657_10622690 3300025919 Unclassified 841
138 Ga0207652_11465801 3300025921 Unclassified 586
139 Ga0207694_10040514 3300025924 Bacteria 3586
140 Ga0207650_10162909 3300025925 Bacteria 1768
141 Ga0207664_10914408 3300025929 Unclassified 788
142 Ga0207706_11204411 3300025933 Unclassified 629
143 Ga0207670_10009614 3300025936 Bacteria 5527
144 Ga0207670_10104629 3300025936 Bacteria 2028
145 Ga0207670_10209622 3300025936 Unclassified 1485
146 Ga0207667_10095859 3300025949 Bacteria 3062
147 Ga0207667_10191788 3300025949 Unclassified 2097
148 Ga0207667_10207189 3300025949 Unclassified 2010
149 Ga0207667_10593271 3300025949 Bacteria 1118
150 Ga0207667_10702800 3300025949 Bacteria 1013
151 Ga0207667_10709418 3300025949 Bacteria 1008
152 Ga0207703_11452730 3300026035 Bacteria 660
153 Ga0207639_10407436 3300026041 Bacteria 1226
154 Ga0207702_10001938 3300026078 Bacteria 20206
155 Ga0207702_10071833 3300026078 Bacteria 2981
156 Ga0207702_10120241 3300026078 Bacteria 2350
157 Ga0207702_11226621 3300026078 Bacteria 744
158 Ga0207702_11311318 3300026078 Bacteria 718
159 Ga0207641_10067877 3300026088 Bacteria 3056
160 Ga0207648_10280943 3300026089 Bacteria 1489
161 Ga0207648_10620033 3300026089 Unclassified 998
162 Ga0207676_10473814 3300026095 Bacteria 1184
163 Ga0207674_10323322 3300026116 Bacteria 1492
164 Ga0207428_10660205 3300027907 Bacteria 750
165 Ga0265337_1000017 3300028556 Bacteria 76887
166 Ga0265337_1002754 3300028556 Bacteria 7886
167 Ga0265337_1008261 3300028556 Bacteria 3802
168 Ga0265337_1008663 3300028556 Bacteria 3680
169 Ga0265337_1015498 3300028556 Unclassified 2493
170 Ga0265326_10017843 3300028558 Unclassified 2045
171 Ga0265326_10077216 3300028558 Bacteria 942
172 Ga0265319_1026599 3300028563 Unclassified 2059
173 Ga0265334_10179063 3300028573 Unclassified 741
174 Ga0265318_10181341 3300028577 Bacteria 771
175 Ga0265322_10230455 3300028654 Bacteria 531
176 Ga0265336_10000543 3300028666 Bacteria 21601
177 Ga0265336_10013725 3300028666 Bacteria 2696
178 Ga0265336_10091313 3300028666 Unclassified 907
179 Ga0265338_10000084 3300028800 Bacteria 175415
180 Ga0265338_10000395 3300028800 Bacteria 78200
181 Ga0265338_10007701 3300028800 Bacteria 13260
182 Ga0265338_10010753 3300028800 Bacteria 10679
183 Ga0265338_10012049 3300028800 Bacteria 9891
184 Ga0265338_10012058 3300028800 Bacteria 9885
185 Ga0265338_10018301 3300028800 Bacteria 7505
186 Ga0265338_10055842 3300028800 Bacteria 3509
187 Ga0265338_10089370 3300028800 Unclassified 2553
188 Ga0265338_10551862 3300028800 Unclassified 806
189 Ga0265338_10567508 3300028800 Bacteria 793
190 Ga0265324_10000058 3300029957 Bacteria 93345
191 Ga0265324_10032403 3300029957 Bacteria 1826
192 Ga0265324_10041262 3300029957 Unclassified 1597
193 Ga0265330_10258910 3300031235 Bacteria 733
194 Ga0265332_10013455 3300031238 Bacteria 3626
195 Ga0265332_10037757 3300031238 Bacteria 2094
196 Ga0265328_10139942 3300031239 Bacteria 908
197 Ga0265320_10008824 3300031240 Bacteria 6134
198 Ga0265320_10011494 3300031240 Bacteria 5205
199 Ga0265320_10111735 3300031240 Unclassified 1251
200 Ga0265320_10177036 3300031240 Bacteria 957
201 Ga0265325_10011036 3300031241 Bacteria 5200
202 Ga0265325_10183844 3300031241 Unclassified 972
203 Ga0265329_10004711 3300031242 Bacteria 5619
204 Ga0265340_10000162 3300031247 Bacteria 33635
205 Ga0265340_10007749 3300031247 Bacteria 5823
206 Ga0265340_10010082 3300031247 Bacteria 5060
207 Ga0265339_10277742 3300031249 Unclassified 804
208 Ga0265339_10458367 3300031249 Unclassified 591
209 Ga0265331_10404720 3300031250 Unclassified 612
210 Ga0265327_10004378 3300031251 Bacteria 12537
211 Ga0265327_10395161 3300031251 Unclassified 601
212 Ga0265316_10090474 3300031344 Bacteria 2335
213 Ga0265316_10213136 3300031344 Unclassified 1428
214 Ga0265316_10274188 3300031344 Bacteria 1234
215 Ga0265316_11077872 3300031344 Unclassified 558
216 Ga0265316_11212639 3300031344 Unclassified 522
217 Ga0265316_11309219 3300031344 Unclassified 500
218 Ga0265313_10251643 3300031595 Unclassified 720
219 Ga0307508_10653637 3300031616 Unclassified 657
220 Ga0265314_10000170 3300031711 Bacteria 96635
221 Ga0265314_10108728 3300031711 Unclassified 1766
222 Ga0265314_10254562 3300031711 Bacteria 1006
223 Ga0265342_10051295 3300031712 Bacteria 2462
224 Ga0265342_10283735 3300031712 Bacteria 876
225 Ga0373930_0001021 3300034816 Bacteria 4025
226 Ga0373950_0005248 3300034818 Unclassified 1928
227 Ga0373938_0007319 3300034957 Bacteria 1939
228 Ga0373928_0000018 3300035084 Bacteria 28140
229 Ga0373929_0001189 3300035085 Bacteria 5036
230 Ga0373944_0002659 3300035089 Unclassified 4552
231 Ga0373944_0288384 3300035089 Unclassified 614
232 Ga0373949_0002010 3300035090 Bacteria 5427
233 Ga0373951_0031709 3300035091 Bacteria 1247
234 Ga0373932_0000004 3300035112 Bacteria 412176
235 Ga0373941_0120706 3300035115 Unclassified 934
236 Ga0373954_0174152 3300035118 Bacteria 1054
237 Ga0373956_0416688 3300035119 Unclassified 641
238 Ga0373960_0216842 3300035121 Unclassified 683
239 Ga0373943_0193848 3300035170 Unclassified 1122
240 Ga0373946_0117747 3300035171 Bacteria 1210
241 Ga0373962_0000015 3300035242 Bacteria 48259
242 Ga0373931_0000009 3300035691 Bacteria 349854
243 Ga0373935_0035831 3300035692 Bacteria 3098
244 Ga0373927_0033029 3300035695 Unclassified 3369
245 Ga0373927_0045739 3300035695 Bacteria 2831
246 Ga0373927_0177705 3300035695 Bacteria 1396
247 Ga0373927_0730712 3300035695 Unclassified 654
248 Ga0373927_0798485 3300035695 Unclassified 623
249 Ga0373933_0175975 3300035724 Bacteria 1363
250 Ga0373933_0865695 3300035724 Unclassified 595
251 Ga0373947_0507901 3300035725 Bacteria 819
252 Ga0373925_0001059 3300037068 Bacteria 24840
253 Ga0373925_0005171 3300037068 Bacteria 9775
254 Ga0373925_0360405 3300037068 Bacteria 1182
255 Ga0373925_0523745 3300037068 Bacteria 974
256 Ga0439443_078453 3300042003 Bacteria 611
257 Ga0439435_0063259 3300042436 Unclassified 1082
258 Ga0451577_0003467 3300042876 Bacteria 17550
259 Ga0453684_0027362 3300044712 Bacteria 8181
260 Ga0453684_0153399 3300044712 Bacteria 2734
261 Ga0453684_0356691 3300044712 Unclassified 1647
262 Ga0466957_0429762 3300044842 Unclassified 907
263 Ga0451576_0079198 3300045051 Unclassified 3419
264 Ga0451576_0232515 3300045051 Unclassified 1925
265 Ga0451576_0384393 3300045051 Bacteria 1471
266 Ga0451576_0423569 3300045051 Bacteria 1397
267 Ga0451576_0857977 3300045051 Unclassified 953
268 Ga0451576_0885756 3300045051 Bacteria 937
269 Ga0451576_0978722 3300045051 Bacteria 887
270 Ga0451576_1046237 3300045051 Bacteria 855
271 Ga0451576_2042751 3300045051 Unclassified 590
272 Ga0495653_0791148 3300046463 Unclassified 571
273 Ga0495639_0402485 3300046475 Bacteria 691
274 Ga0495662_0035650 3300046476 Bacteria 2401
275 Ga0495662_0455125 3300046476 Bacteria 628
276 Ga0495630_0000153 3300046517 Bacteria 53609
277 Ga0495630_0798426 3300046517 Bacteria 721
278 Ga0495665_0209313 3300046531 Unclassified 1010
279 Ga0495586_0004497 3300046535 Bacteria 7447
280 Ga0495586_0100654 3300046535 Bacteria 1603
281 Ga0495667_0036988 3300046559 Bacteria 3255
282 Ga0495634_0243029 3300046642 Bacteria 1103
283 Ga0495634_0314851 3300046642 Bacteria 943
284 Ga0495658_0002996 3300046683 Bacteria 8449
285 Ga0495613_0001832 3300046689 Bacteria 16160
286 Ga0495613_0644433 3300046689 Bacteria 701
287 Ga0495624_0239271 3300046690 Bacteria 1099
288 Ga0495636_0160125 3300047318 Unclassified 1014
289 Ga0495674_0020654 3300047319 Bacteria 6097
290 Ga0495674_0430387 3300047319 Bacteria 1062
291 Ga0495676_0033762 3300047321 Bacteria 4302
292 Ga0495680_0007113 3300047322 Bacteria 10306
293 Ga0495675_0097101 3300047444 Bacteria 1847
294 Ga0496103_0144600 3300048906 Bacteria 1522
295 Ga0496115_0399179 3300048918 Unclassified 1116
296 Ga0501031_0000093 3300049568 Bacteria 47816
297 Ga0501032_0002367 3300049569 Bacteria 14733
298 Ga0501033_0004623 3300049570 Bacteria 11023
299 Ga0501038_1234036 3300049574 Bacteria 542
300 Ga0501080_0202457 3300049742 Bacteria 1822
301 Ga0501083_0071064 3300049744 Bacteria 2315
302 Ga0501083_0167189 3300049744 Bacteria 1438
303 Ga0501035_0005721 3300049822 Bacteria 11723
304 Ga0501044_0002830 3300049823 Bacteria 19743
305 Ga0501044_0372746 3300049823 Bacteria 1344
306 nmdc:mga08y16_165430_c1 3300050511 Unclassified 2298
307 nmdc:mga08y16_806726_c1 3300050511 Bacteria 931
308 nmdc:mga08y16_9685_c1 3300050511 Bacteria 10114
309 nmdc:mga0n895_865990_c1 3300050512 Bacteria 890
310 nmdc:mga0rr50_576138_c1 3300050513 Bacteria 959
311 nmdc:mga08x19_149162_c1 3300050514 Bacteria 1582
312 nmdc:mga08x19_486872_c1 3300050514 Unclassified 870
313 nmdc:mga0a205_564797_c1 3300050515 Bacteria 992

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11854816 Ga0157375_118548162 108
2 3300005440 Ga0070705_100416595 Ga0070705_1004165952 113
3 3300025949 Ga0207667_10593271 Ga0207667_105932711 113
4 3300026078 Ga0207702_11311318 Ga0207702_113113181 113
5 3300048906 Ga0496103_0144600 Ga0496103_0144600_1069_1485 113
6 3300005340 Ga0070689_100460412 Ga0070689_1004604121 119
7 3300005365 Ga0070688_100095079 Ga0070688_1000950795 119
8 3300005466 Ga0070685_10295654 Ga0070685_102956542 119
9 3300005549 Ga0070704_100908367 Ga0070704_1009083672 119
10 3300006914 Ga0075436_100609034 Ga0075436_1006090342 119
11 3300028556 Ga0265337_1000017 Ga0265337_100001745 119
12 3300028556 Ga0265337_1008261 Ga0265337_10082614 119
13 3300028558 Ga0265326_10077216 Ga0265326_100772162 119
14 3300028573 Ga0265334_10179063 Ga0265334_101790632 119
15 3300028577 Ga0265318_10181341 Ga0265318_101813412 119
16 3300028666 Ga0265336_10000543 Ga0265336_100005433 119
17 3300028800 Ga0265338_10000395 Ga0265338_1000039545 119
18 3300028800 Ga0265338_10018301 Ga0265338_100183012 119
19 3300031240 Ga0265320_10111735 Ga0265320_101117352 119
20 3300031249 Ga0265339_10277742 Ga0265339_102777422 119
21 3300031616 Ga0307508_10653637 Ga0307508_106536372 119
22 3300050514 nmdc:mga08x19_486872_c1 nmdc:mga08x19_486872_c1_381_755 119
23 3300005335 Ga0070666_10266899 Ga0070666_102668993 120
24 3300005343 Ga0070687_100684731 Ga0070687_1006847311 120
25 3300005444 Ga0070694_101530450 Ga0070694_1015304501 120
26 3300005459 Ga0068867_100793138 Ga0068867_1007931381 120
27 3300005544 Ga0070686_100120262 Ga0070686_1001202623 120
28 3300005577 Ga0068857_100223574 Ga0068857_1002235743 120
29 3300005617 Ga0068859_100064078 Ga0068859_1000640784 120
30 3300005618 Ga0068864_100961545 Ga0068864_1009615452 120
31 3300006931 Ga0097620_100064079 Ga0097620_1000640794 120
32 3300009094 Ga0111539_10596973 Ga0111539_105969732 120
33 3300009553 Ga0105249_10416508 Ga0105249_104165083 120
34 3300009553 Ga0105249_11138156 Ga0105249_111381562 120
35 3300013308 Ga0157375_10000172 Ga0157375_1000017210 120
36 3300014325 Ga0163163_10045217 Ga0163163_100452175 120
37 3300026035 Ga0207703_11452730 Ga0207703_114527302 120
38 3300026089 Ga0207648_10280943 Ga0207648_102809432 120
39 3300026095 Ga0207676_10473814 Ga0207676_104738143 120
40 3300026116 Ga0207674_10323322 Ga0207674_103233222 120
41 3300005340 Ga0070689_100034743 Ga0070689_1000347432 121
42 3300005344 Ga0070661_100326004 Ga0070661_1003260042 121
43 3300005345 Ga0070692_10307846 Ga0070692_103078461 121
44 3300005353 Ga0070669_101463190 Ga0070669_1014631901 121
45 3300005365 Ga0070688_100211907 Ga0070688_1002119072 121
46 3300005435 Ga0070714_100801266 Ga0070714_1008012662 121
47 3300005466 Ga0070685_10334803 Ga0070685_103348032 121
48 3300005547 Ga0070693_100695389 Ga0070693_1006953892 121
49 3300005615 Ga0070702_100336256 Ga0070702_1003362562 121
50 3300005617 Ga0068859_100158348 Ga0068859_1001583484 121
51 3300005718 Ga0068866_10170455 Ga0068866_101704552 121
52 3300005840 Ga0068870_11043471 Ga0068870_110434712 121
53 3300005841 Ga0068863_100006428 Ga0068863_1000064284 121
54 3300005844 Ga0068862_101114265 Ga0068862_1011142652 121
55 3300006028 Ga0070717_11657141 Ga0070717_116571411 121
56 3300006237 Ga0097621_100199054 Ga0097621_1001990542 121
57 3300006358 Ga0068871_100021119 Ga0068871_1000211193 121
58 3300006931 Ga0097620_100158344 Ga0097620_1001583442 121
59 3300006931 Ga0097620_101916459 Ga0097620_1019164592 121
60 3300009094 Ga0111539_10345231 Ga0111539_103452313 121
61 3300009094 Ga0111539_10648137 Ga0111539_106481371 121
62 3300009098 Ga0105245_11016272 Ga0105245_110162722 121
63 3300010159 Ga0099796_10073636 Ga0099796_100736362 121
64 3300013296 Ga0157374_10733490 Ga0157374_107334902 121
65 3300013296 Ga0157374_11020254 Ga0157374_110202542 121
66 3300013297 Ga0157378_10308071 Ga0157378_103080712 121
67 3300014968 Ga0157379_10248381 Ga0157379_102483811 121
68 3300025906 Ga0207699_10561687 Ga0207699_105616872 121
69 3300025929 Ga0207664_10914408 Ga0207664_109144081 121
70 3300025936 Ga0207670_10009614 Ga0207670_100096143 121
71 3300026088 Ga0207641_10067877 Ga0207641_100678772 121
72 3300027907 Ga0207428_10660205 Ga0207428_106602052 121
73 3300028654 Ga0265322_10230455 Ga0265322_102304551 121
74 3300028800 Ga0265338_10007701 Ga0265338_1000770110 121
75 3300028800 Ga0265338_10012058 Ga0265338_100120584 121
76 3300031235 Ga0265330_10258910 Ga0265330_102589102 121
77 3300031238 Ga0265332_10013455 Ga0265332_100134554 121
78 3300031239 Ga0265328_10139942 Ga0265328_101399421 121
79 3300031242 Ga0265329_10004711 Ga0265329_100047115 121
80 3300031247 Ga0265340_10007749 Ga0265340_100077496 121
81 3300031344 Ga0265316_10213136 Ga0265316_102131363 121
82 3300031344 Ga0265316_10274188 Ga0265316_102741882 121
83 3300031344 Ga0265316_11077872 Ga0265316_110778721 121
84 3300031711 Ga0265314_10000170 Ga0265314_1000017041 121
85 3300031711 Ga0265314_10108728 Ga0265314_101087281 121
86 3300031712 Ga0265342_10283735 Ga0265342_102837351 121
87 3300035695 Ga0373927_0798485 Ga0373927_0798485_91_462 121
88 3300037068 Ga0373925_0523745 Ga0373925_0523745_475_858 121
89 3300042876 Ga0451577_0003467 Ga0451577_0003467_9365_9742 121
90 3300045051 Ga0451576_0423569 Ga0451576_0423569_508_882 121
91 3300045051 Ga0451576_0978722 Ga0451576_0978722_460_834 121
92 3300045051 Ga0451576_1046237 Ga0451576_1046237_274_648 121
93 3300046475 Ga0495639_0402485 Ga0495639_0402485_184_567 121
94 3300046476 Ga0495662_0035650 Ga0495662_0035650_1724_2107 121
95 3300046517 Ga0495630_0000153 Ga0495630_0000153_22518_22901 121
96 3300046531 Ga0495665_0209313 Ga0495665_0209313_10_393 121
97 3300046535 Ga0495586_0004497 Ga0495586_0004497_926_1309 121
98 3300046642 Ga0495634_0243029 Ga0495634_0243029_349_732 121
99 3300046689 Ga0495613_0644433 Ga0495613_0644433_82_465 121
100 3300046690 Ga0495624_0239271 Ga0495624_0239271_639_1022 121
101 3300047319 Ga0495674_0020654 Ga0495674_0020654_1454_1837 121
102 3300047321 Ga0495676_0033762 Ga0495676_0033762_2515_2898 121
103 3300050511 nmdc:mga08y16_165430_c1 nmdc:mga08y16_165430_c1_304_678 121
104 3300050512 nmdc:mga0n895_865990_c1 nmdc:mga0n895_865990_c1_130_504 121
105 3300050515 nmdc:mga0a205_564797_c1 nmdc:mga0a205_564797_c1_561_935 121
106 3300000545 CNXas_1015064 CNXas_10150641 122
107 3300003323 rootH1_10165333 rootH1_101653331 122
108 3300005295 Ga0065707_10407009 Ga0065707_104070092 122
109 3300005327 Ga0070658_10039944 Ga0070658_100399444 122
110 3300005329 Ga0070683_100080422 Ga0070683_1000804221 122
111 3300005330 Ga0070690_100024160 Ga0070690_1000241602 122
112 3300005331 Ga0070670_100211758 Ga0070670_1002117583 122
113 3300005339 Ga0070660_100856755 Ga0070660_1008567552 122
114 3300005340 Ga0070689_100030328 Ga0070689_1000303287 122
115 3300005340 Ga0070689_100047064 Ga0070689_1000470644 122
116 3300005340 Ga0070689_100112326 Ga0070689_1001123264 122
117 3300005340 Ga0070689_100252202 Ga0070689_1002522022 122
118 3300005341 Ga0070691_10126090 Ga0070691_101260901 122
119 3300005354 Ga0070675_100387488 Ga0070675_1003874883 122
120 3300005354 Ga0070675_100484944 Ga0070675_1004849443 122
121 3300005364 Ga0070673_101757864 Ga0070673_1017578642 122
122 3300005365 Ga0070688_100004790 Ga0070688_1000047902 122
123 3300005435 Ga0070714_100319834 Ga0070714_1003198341 122
124 3300005438 Ga0070701_10311455 Ga0070701_103114551 122
125 3300005440 Ga0070705_100132479 Ga0070705_1001324792 122
126 3300005444 Ga0070694_100004538 Ga0070694_1000045381 122
127 3300005445 Ga0070708_100901159 Ga0070708_1009011592 122
128 3300005456 Ga0070678_102230023 Ga0070678_1022300231 122
129 3300005458 Ga0070681_11215074 Ga0070681_112150742 122
130 3300005466 Ga0070685_10253338 Ga0070685_102533382 122
131 3300005471 Ga0070698_101788556 Ga0070698_1017885561 122
132 3300005530 Ga0070679_100454390 Ga0070679_1004543902 122
133 3300005539 Ga0068853_100213203 Ga0068853_1002132033 122
134 3300005539 Ga0068853_100437328 Ga0068853_1004373282 122
135 3300005544 Ga0070686_100022577 Ga0070686_1000225773 122
136 3300005544 Ga0070686_100109408 Ga0070686_1001094083 122
137 3300005547 Ga0070693_100998278 Ga0070693_1009982781 122
138 3300005549 Ga0070704_100395426 Ga0070704_1003954262 122
139 3300005563 Ga0068855_100174867 Ga0068855_1001748673 122
140 3300005563 Ga0068855_100551415 Ga0068855_1005514152 122
141 3300005563 Ga0068855_100955525 Ga0068855_1009555252 122
142 3300005563 Ga0068855_101239593 Ga0068855_1012395931 122
143 3300005577 Ga0068857_100173030 Ga0068857_1001730302 122
144 3300005614 Ga0068856_100000561 Ga0068856_1000005613 122
145 3300005614 Ga0068856_100063736 Ga0068856_1000637363 122
146 3300005614 Ga0068856_100473370 Ga0068856_1004733701 122
147 3300005615 Ga0070702_100738685 Ga0070702_1007386851 122
148 3300005616 Ga0068852_101787875 Ga0068852_1017878751 122
149 3300005617 Ga0068859_100097832 Ga0068859_1000978323 122
150 3300005617 Ga0068859_100124472 Ga0068859_1001244723 122
151 3300005617 Ga0068859_100507281 Ga0068859_1005072813 122
152 3300005844 Ga0068862_101250472 Ga0068862_1012504721 122
153 3300006173 Ga0070716_101560919 Ga0070716_1015609191 122
154 3300006844 Ga0075428_100011208 Ga0075428_1000112088 122
155 3300006847 Ga0075431_100334284 Ga0075431_1003342843 122
156 3300006871 Ga0075434_101996169 Ga0075434_1019961692 122
157 3300006880 Ga0075429_100179046 Ga0075429_1001790462 122
158 3300006931 Ga0097620_100097832 Ga0097620_1000978323 122
159 3300006931 Ga0097620_100124468 Ga0097620_1001244683 122
160 3300006931 Ga0097620_100507260 Ga0097620_1005072603 122
161 3300007076 Ga0075435_100944060 Ga0075435_1009440602 122
162 3300009093 Ga0105240_10133026 Ga0105240_101330264 122
163 3300009093 Ga0105240_10150521 Ga0105240_101505213 122
164 3300009093 Ga0105240_10161957 Ga0105240_101619574 122
165 3300009094 Ga0111539_10006153 Ga0111539_100061532 122
166 3300009094 Ga0111539_10411553 Ga0111539_104115533 122
167 3300009094 Ga0111539_10767780 Ga0111539_107677801 122
168 3300009094 Ga0111539_10837190 Ga0111539_108371901 122
169 3300009098 Ga0105245_12982172 Ga0105245_129821721 122
170 3300009147 Ga0114129_11582195 Ga0114129_115821951 122
171 3300009176 Ga0105242_10824510 Ga0105242_108245101 122
172 3300009545 Ga0105237_10128077 Ga0105237_101280773 122
173 3300009551 Ga0105238_10004479 Ga0105238_100044799 122
174 3300009551 Ga0105238_10052545 Ga0105238_100525454 122
175 3300009551 Ga0105238_10349221 Ga0105238_103492212 122
176 3300009553 Ga0105249_10137191 Ga0105249_101371912 122
177 3300013296 Ga0157374_10234139 Ga0157374_102341392 122
178 3300013297 Ga0157378_10267725 Ga0157378_102677253 122
179 3300013297 Ga0157378_12820921 Ga0157378_128209211 122
180 3300013307 Ga0157372_10193003 Ga0157372_101930033 122
181 3300013307 Ga0157372_11807234 Ga0157372_118072342 122
182 3300013308 Ga0157375_11177943 Ga0157375_111779432 122
183 3300014325 Ga0163163_11819514 Ga0163163_118195142 122
184 3300014969 Ga0157376_10944433 Ga0157376_109444332 122
185 3300025905 Ga0207685_10428572 Ga0207685_104285721 122
186 3300025909 Ga0207705_10047623 Ga0207705_100476233 122
187 3300025909 Ga0207705_10052279 Ga0207705_100522793 122
188 3300025912 Ga0207707_10973318 Ga0207707_109733181 122
189 3300025913 Ga0207695_10376041 Ga0207695_103760412 122
190 3300025913 Ga0207695_10507357 Ga0207695_105073572 122
191 3300025913 Ga0207695_10785665 Ga0207695_107856652 122
192 3300025914 Ga0207671_10854774 Ga0207671_108547741 122
193 3300025919 Ga0207657_10622690 Ga0207657_106226902 122
194 3300025921 Ga0207652_11465801 Ga0207652_114658012 122
195 3300025924 Ga0207694_10040514 Ga0207694_100405142 122
196 3300025925 Ga0207650_10162909 Ga0207650_101629091 122
197 3300025933 Ga0207706_11204411 Ga0207706_112044111 122
198 3300025936 Ga0207670_10104629 Ga0207670_101046294 122
199 3300025936 Ga0207670_10209622 Ga0207670_102096222 122
200 3300025949 Ga0207667_10095859 Ga0207667_100958593 122
201 3300025949 Ga0207667_10191788 Ga0207667_101917883 122
202 3300025949 Ga0207667_10207189 Ga0207667_102071893 122
203 3300025949 Ga0207667_10702800 Ga0207667_107028002 122
204 3300025949 Ga0207667_10709418 Ga0207667_107094182 122
205 3300026041 Ga0207639_10407436 Ga0207639_104074362 122
206 3300026078 Ga0207702_10001938 Ga0207702_1000193816 122
207 3300026078 Ga0207702_10071833 Ga0207702_100718333 122
208 3300026078 Ga0207702_10120241 Ga0207702_101202413 122
209 3300026078 Ga0207702_11226621 Ga0207702_112266211 122
210 3300026089 Ga0207648_10620033 Ga0207648_106200332 122
211 3300028556 Ga0265337_1002754 Ga0265337_10027548 122
212 3300028556 Ga0265337_1008663 Ga0265337_10086632 122
213 3300028556 Ga0265337_1015498 Ga0265337_10154983 122
214 3300028558 Ga0265326_10017843 Ga0265326_100178434 122
215 3300028563 Ga0265319_1026599 Ga0265319_10265992 122
216 3300028666 Ga0265336_10013725 Ga0265336_100137251 122
217 3300028666 Ga0265336_10091313 Ga0265336_100913132 122
218 3300028800 Ga0265338_10000084 Ga0265338_10000084132 122
219 3300028800 Ga0265338_10010753 Ga0265338_100107533 122
220 3300028800 Ga0265338_10012049 Ga0265338_100120496 122
221 3300028800 Ga0265338_10055842 Ga0265338_100558422 122
222 3300028800 Ga0265338_10089370 Ga0265338_100893703 122
223 3300028800 Ga0265338_10551862 Ga0265338_105518621 122
224 3300028800 Ga0265338_10567508 Ga0265338_105675082 122
225 3300029957 Ga0265324_10000058 Ga0265324_1000005810 122
226 3300029957 Ga0265324_10032403 Ga0265324_100324034 122
227 3300029957 Ga0265324_10041262 Ga0265324_100412623 122
228 3300031238 Ga0265332_10037757 Ga0265332_100377572 122
229 3300031240 Ga0265320_10008824 Ga0265320_100088243 122
230 3300031240 Ga0265320_10011494 Ga0265320_100114943 122
231 3300031240 Ga0265320_10177036 Ga0265320_101770361 122
232 3300031241 Ga0265325_10011036 Ga0265325_100110367 122
233 3300031241 Ga0265325_10183844 Ga0265325_101838442 122
234 3300031247 Ga0265340_10000162 Ga0265340_1000016222 122
235 3300031247 Ga0265340_10010082 Ga0265340_100100822 122
236 3300031249 Ga0265339_10458367 Ga0265339_104583671 122
237 3300031250 Ga0265331_10404720 Ga0265331_104047201 122
238 3300031251 Ga0265327_10004378 Ga0265327_100043783 122
239 3300031251 Ga0265327_10395161 Ga0265327_103951611 122
240 3300031344 Ga0265316_10090474 Ga0265316_100904742 122
241 3300031344 Ga0265316_11212639 Ga0265316_112126391 122
242 3300031344 Ga0265316_11309219 Ga0265316_113092191 122
243 3300031595 Ga0265313_10251643 Ga0265313_102516432 122
244 3300031711 Ga0265314_10254562 Ga0265314_102545622 122
245 3300031712 Ga0265342_10051295 Ga0265342_100512953 122
246 3300034816 Ga0373930_0001021 Ga0373930_0001021_1412_1786 122
247 3300034818 Ga0373950_0005248 Ga0373950_0005248_540_914 122
248 3300034957 Ga0373938_0007319 Ga0373938_0007319_272_646 122
249 3300035084 Ga0373928_0000018 Ga0373928_0000018_5534_5908 122
250 3300035085 Ga0373929_0001189 Ga0373929_0001189_3643_4017 122
251 3300035089 Ga0373944_0002659 Ga0373944_0002659_134_508 122
252 3300035089 Ga0373944_0288384 Ga0373944_0288384_143_520 122
253 3300035090 Ga0373949_0002010 Ga0373949_0002010_3550_3924 122
254 3300035091 Ga0373951_0031709 Ga0373951_0031709_336_710 122
255 3300035112 Ga0373932_0000004 Ga0373932_0000004_275054_275428 122
256 3300035115 Ga0373941_0120706 Ga0373941_0120706_35_409 122
257 3300035118 Ga0373954_0174152 Ga0373954_0174152_242_613 122
258 3300035119 Ga0373956_0416688 Ga0373956_0416688_112_504 122
259 3300035121 Ga0373960_0216842 Ga0373960_0216842_134_508 122
260 3300035170 Ga0373943_0193848 Ga0373943_0193848_604_978 122
261 3300035171 Ga0373946_0117747 Ga0373946_0117747_802_1176 122
262 3300035242 Ga0373962_0000015 Ga0373962_0000015_43234_43608 122
263 3300035691 Ga0373931_0000009 Ga0373931_0000009_343744_344118 122
264 3300035692 Ga0373935_0035831 Ga0373935_0035831_38_412 122
265 3300035695 Ga0373927_0033029 Ga0373927_0033029_2606_2980 122
266 3300035695 Ga0373927_0045739 Ga0373927_0045739_939_1313 122
267 3300035695 Ga0373927_0177705 Ga0373927_0177705_875_1252 122
268 3300035695 Ga0373927_0730712 Ga0373927_0730712_191_565 122
269 3300035724 Ga0373933_0175975 Ga0373933_0175975_65_436 122
270 3300035724 Ga0373933_0865695 Ga0373933_0865695_95_487 122
271 3300035725 Ga0373947_0507901 Ga0373947_0507901_138_512 122
272 3300037068 Ga0373925_0001059 Ga0373925_0001059_213_587 122
273 3300037068 Ga0373925_0005171 Ga0373925_0005171_3979_4353 122
274 3300037068 Ga0373925_0360405 Ga0373925_0360405_151_528 122
275 3300042003 Ga0439443_078453 Ga0439443_078453_105_488 122
276 3300042436 Ga0439435_0063259 Ga0439435_0063259_386_772 122
277 3300044712 Ga0453684_0027362 Ga0453684_0027362_7066_7446 122
278 3300044712 Ga0453684_0153399 Ga0453684_0153399_234_608 122
279 3300044712 Ga0453684_0356691 Ga0453684_0356691_612_986 122
280 3300044842 Ga0466957_0429762 Ga0466957_0429762_484_858 122
281 3300045051 Ga0451576_0079198 Ga0451576_0079198_1110_1490 122
282 3300045051 Ga0451576_0232515 Ga0451576_0232515_1204_1641 122
283 3300045051 Ga0451576_0384393 Ga0451576_0384393_849_1220 122
284 3300045051 Ga0451576_0857977 Ga0451576_0857977_294_677 122
285 3300045051 Ga0451576_0885756 Ga0451576_0885756_348_728 122
286 3300045051 Ga0451576_2042751 Ga0451576_2042751_186_563 122
287 3300046463 Ga0495653_0791148 Ga0495653_0791148_115_528 122
288 3300046476 Ga0495662_0455125 Ga0495662_0455125_33_404 122
289 3300046517 Ga0495630_0798426 Ga0495630_0798426_97_471 122
290 3300046535 Ga0495586_0100654 Ga0495586_0100654_396_767 122
291 3300046559 Ga0495667_0036988 Ga0495667_0036988_1435_1806 122
292 3300046642 Ga0495634_0314851 Ga0495634_0314851_62_433 122
293 3300046683 Ga0495658_0002996 Ga0495658_0002996_2475_2849 122
294 3300046689 Ga0495613_0001832 Ga0495613_0001832_2111_2482 122
295 3300047318 Ga0495636_0160125 Ga0495636_0160125_567_947 122
296 3300047319 Ga0495674_0430387 Ga0495674_0430387_555_926 122
297 3300047322 Ga0495680_0007113 Ga0495680_0007113_1877_2248 122
298 3300047444 Ga0495675_0097101 Ga0495675_0097101_264_641 122
299 3300048918 Ga0496115_0399179 Ga0496115_0399179_628_1002 122
300 3300049568 Ga0501031_0000093 Ga0501031_0000093_9751_10128 122
301 3300049569 Ga0501032_0002367 Ga0501032_0002367_7245_7622 122
302 3300049570 Ga0501033_0004623 Ga0501033_0004623_6926_7303 122
303 3300049574 Ga0501038_1234036 Ga0501038_1234036_16_393 122
304 3300049742 Ga0501080_0202457 Ga0501080_0202457_342_719 122
305 3300049744 Ga0501083_0071064 Ga0501083_0071064_124_501 122
306 3300049744 Ga0501083_0167189 Ga0501083_0167189_525_908 122
307 3300049822 Ga0501035_0005721 Ga0501035_0005721_8066_8443 122
308 3300049823 Ga0501044_0002830 Ga0501044_0002830_9805_10182 122
309 3300049823 Ga0501044_0372746 Ga0501044_0372746_589_966 122
310 3300050511 nmdc:mga08y16_806726_c1 nmdc:mga08y16_806726_c1_50_421 122
311 3300050511 nmdc:mga08y16_9685_c1 nmdc:mga08y16_9685_c1_134_514 122
312 3300050513 nmdc:mga0rr50_576138_c1 nmdc:mga0rr50_576138_c1_372_743 122
313 3300050514 nmdc:mga08x19_149162_c1 nmdc:mga08x19_149162_c1_1192_1563 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

32

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9124 1 109
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9113 1 111
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.9044 4 113
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.9044 4 99
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.9016 1 110
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9526 4 105 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9375 2 106 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9339 2 115 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9289 2 106 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.926 2 115 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A2V5W1X4-F1-model_v4 Ribosome silencing factor 0.9839 1 92 GO:0017148
GO:0043023
GO:0090071
AF-A0A257X574-F1-model_v4 Ribosome silencing factor 0.9821 1 92 GO:0017148
GO:0043023
GO:0090071
AF-A0A838RF78-F1-model_v4 Ribosomal silencing factor RsfS 0.9729 2 112 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A257X574-F1-model_v4 Ribosome silencing factor 0.9717 1 92 GO:0017148
GO:0043023
GO:0090071
AF-A0A6P0Y1Y9-F1-model_v4 Ribosome silencing factor 0.9703 3 92 GO:0017148
GO:0043023
GO:0090071

Feature Viewer

pLDDT pTM Quality
78.14 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map