F402048

General Info

Members Datasets Scaffolds Average Seq Length
313 161 313 150

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100089874|Ga0070675_1000898742
Length 176
Sequence VGASPALIKKFRGRDAHDTAGETPALHMTETCEKAEKFLGELVTDLGLDLSVSSETTDEGCLLNLSGNDTGLALAENGEMLDAFETLLFQVMGRELDREHRIICDADGFRQTRKSELHAMARFAADQVRKNGRPFTFGVLNSTERRIIHLTLQKDEDLDTESVGAGRDRRLQVRLK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8520897 2162886011 Unclassified 915
2 MBSR1b_contig_1638386 2162886012 Bacteria 1142
3 MBSR1b_contig_6988234 2162886012 Bacteria 994
4 rootL2_10161442 3300003322 Bacteria 2521
5 Ga0065714_10254546 3300005288 Unclassified 768
6 Ga0065712_10090045 3300005290 Unclassified 2428
7 Ga0065712_10594408 3300005290 Unclassified 550
8 Ga0065715_10134959 3300005293 Bacteria 1928
9 Ga0065715_10261341 3300005293 Bacteria 1137
10 Ga0065707_10092241 3300005295 Unclassified 3800
11 Ga0070690_100001956 3300005330 Bacteria 10959
12 Ga0070670_100015402 3300005331 Bacteria 6567
13 Ga0070670_100146568 3300005331 Bacteria 2042
14 Ga0070670_100572515 3300005331 Unclassified 1009
15 Ga0068869_100001190 3300005334 Bacteria 15269
16 Ga0068869_100126260 3300005334 Unclassified 1962
17 Ga0068869_100169615 3300005334 Bacteria 1704
18 Ga0068869_100418386 3300005334 Bacteria 1105
19 Ga0068869_101383517 3300005334 Unclassified 622
20 Ga0070666_10238475 3300005335 Bacteria 1285
21 Ga0070682_100165637 3300005337 Bacteria 1531
22 Ga0070682_100357870 3300005337 Bacteria 1090
23 Ga0068868_100123282 3300005338 Bacteria 2115
24 Ga0070689_100015406 3300005340 Bacteria 5574
25 Ga0070689_100135745 3300005340 Bacteria 1975
26 Ga0070689_100299050 3300005340 Bacteria 1339
27 Ga0070687_100199948 3300005343 Bacteria 1210
28 Ga0070661_100016280 3300005344 Bacteria 5256
29 Ga0070661_100445848 3300005344 Bacteria 1029
30 Ga0070668_100803331 3300005347 Unclassified 836
31 Ga0070668_100961418 3300005347 Unclassified 766
32 Ga0070669_101691484 3300005353 Bacteria 551
33 Ga0070675_100089874 3300005354 Bacteria 2572
34 Ga0070675_100096238 3300005354 Bacteria 2487
35 Ga0070675_100209224 3300005354 Bacteria 1695
36 Ga0070675_100291268 3300005354 Bacteria 1437
37 Ga0070671_100042668 3300005355 Bacteria 3770
38 Ga0070671_100135012 3300005355 Bacteria 2080
39 Ga0070671_100469485 3300005355 Bacteria 1080
40 Ga0070671_100753474 3300005355 Bacteria 846
41 Ga0070674_100345039 3300005356 Bacteria 1201
42 Ga0070673_100591891 3300005364 Bacteria 1011
43 Ga0070673_101505122 3300005364 Bacteria 635
44 Ga0070688_100070606 3300005365 Bacteria 2234
45 Ga0070667_100010345 3300005367 Bacteria 7703
46 Ga0070667_101061653 3300005367 Bacteria 757
47 Ga0070705_100123270 3300005440 Bacteria 1677
48 Ga0070705_100863057 3300005440 Bacteria 725
49 Ga0070663_100033601 3300005455 Bacteria 3545
50 Ga0070678_100471272 3300005456 Bacteria 1103
51 Ga0070678_100711076 3300005456 Unclassified 906
52 Ga0070678_100774326 3300005456 Unclassified 869
53 Ga0070662_100022720 3300005457 Unclassified 4297
54 Ga0070662_100374346 3300005457 Bacteria 1171
55 Ga0068867_100186777 3300005459 Bacteria 1651
56 Ga0068867_100364319 3300005459 Unclassified 1210
57 Ga0068867_100380324 3300005459 Bacteria 1186
58 Ga0070685_10023032 3300005466 Bacteria 3404
59 Ga0070685_10087722 3300005466 Bacteria 1878
60 Ga0070706_100049738 3300005467 Bacteria 3867
61 Ga0070698_101073502 3300005471 Bacteria 753
62 Ga0068853_100004786 3300005539 Bacteria 10528
63 Ga0068853_100452803 3300005539 Bacteria 1207
64 Ga0070672_100066942 3300005543 Bacteria 2845
65 Ga0070672_100607370 3300005543 Unclassified 953
66 Ga0070672_100752304 3300005543 Bacteria 855
67 Ga0070672_101618922 3300005543 Unclassified 581
68 Ga0070686_100116052 3300005544 Bacteria 1832
69 Ga0070686_101848340 3300005544 Unclassified 515
70 Ga0070695_100282899 3300005545 Bacteria 1219
71 Ga0070696_101251848 3300005546 Bacteria 628
72 Ga0070693_100328821 3300005547 Bacteria 1040
73 Ga0070693_100768603 3300005547 Unclassified 711
74 Ga0070665_100212942 3300005548 Bacteria 1933
75 Ga0068855_100020237 3300005563 Bacteria 7988
76 Ga0068855_102330407 3300005563 Unclassified 535
77 Ga0070664_100021267 3300005564 Bacteria 5345
78 Ga0070664_100141709 3300005564 Bacteria 2117
79 Ga0068857_100006362 3300005577 Bacteria 10114
80 Ga0068857_100599450 3300005577 Bacteria 1041
81 Ga0068856_100589661 3300005614 Unclassified 1133
82 Ga0070702_100026488 3300005615 Bacteria 3116
83 Ga0068852_100041506 3300005616 Bacteria 3888
84 Ga0068852_100147712 3300005616 Bacteria 2182
85 Ga0068852_100225807 3300005616 Bacteria 1783
86 Ga0068859_100008959 3300005617 Bacteria 10105
87 Ga0068859_100014118 3300005617 Bacteria 8012
88 Ga0068859_100049994 3300005617 Bacteria 4199
89 Ga0068859_100806024 3300005617 Unclassified 1026
90 Ga0068864_100055498 3300005618 Bacteria 3421
91 Ga0068864_100057430 3300005618 Bacteria 3362
92 Ga0068864_100737838 3300005618 Unclassified 964
93 Ga0068861_100387999 3300005719 Bacteria 1236
94 Ga0068861_100522349 3300005719 Bacteria 1077
95 Ga0068861_100591538 3300005719 Bacteria 1017
96 Ga0068870_10028585 3300005840 Unclassified 2801
97 Ga0068870_10173527 3300005840 Unclassified 1288
98 Ga0068863_100084428 3300005841 Bacteria 3009
99 Ga0068863_100155578 3300005841 Unclassified 2189
100 Ga0068863_100155973 3300005841 Bacteria 2186
101 Ga0068863_100325813 3300005841 Unclassified 1493
102 Ga0068863_101176796 3300005841 Bacteria 772
103 Ga0068858_100144670 3300005842 Bacteria 2232
104 Ga0068858_100183860 3300005842 Bacteria 1974
105 Ga0068858_100690083 3300005842 Unclassified 993
106 Ga0068860_100020159 3300005843 Bacteria 6462
107 Ga0068860_100331702 3300005843 Unclassified 1494
108 Ga0068862_100053192 3300005844 Bacteria 3465
109 Ga0068862_100076521 3300005844 Bacteria 2896
110 Ga0068862_100092902 3300005844 Bacteria 2630
111 Ga0068862_100213855 3300005844 Unclassified 1743
112 Ga0068862_100282812 3300005844 Bacteria 1521
113 Ga0068862_100379061 3300005844 Bacteria 1319
114 Ga0070715_10177870 3300006163 Unclassified 1065
115 Ga0097621_100124619 3300006237 Unclassified 2187
116 Ga0097621_100308880 3300006237 Bacteria 1398
117 Ga0068871_100123511 3300006358 Bacteria 2189
118 Ga0068865_100191854 3300006881 Bacteria 1581
119 Ga0097620_100008960 3300006931 Bacteria 10105
120 Ga0097620_100014118 3300006931 Bacteria 8012
121 Ga0097620_100049994 3300006931 Bacteria 4199
122 Ga0097620_100806018 3300006931 Unclassified 1026
123 Ga0105250_10051159 3300009092 Bacteria 1657
124 Ga0105240_10092051 3300009093 Bacteria 3703
125 Ga0111539_10741246 3300009094 Bacteria 1144
126 Ga0111539_11928053 3300009094 Unclassified 685
127 Ga0105245_10216095 3300009098 Bacteria 1847
128 Ga0105247_10002021 3300009101 Bacteria 14051
129 Ga0105247_10023150 3300009101 Bacteria 3742
130 Ga0114129_11885108 3300009147 Bacteria 725
131 Ga0105243_10402737 3300009148 Bacteria 1272
132 Ga0105243_11303979 3300009148 Unclassified 743
133 Ga0105241_10158004 3300009174 Bacteria 1861
134 Ga0105241_10267710 3300009174 Unclassified 1454
135 Ga0105242_10106901 3300009176 Bacteria 2379
136 Ga0105248_10277372 3300009177 Bacteria 1887
137 Ga0105248_10936597 3300009177 Bacteria 978
138 Ga0105249_10023338 3300009553 Bacteria 5550
139 Ga0105249_10027231 3300009553 Bacteria 5158
140 Ga0105249_10061461 3300009553 Unclassified 3447
141 Ga0105249_10090089 3300009553 Bacteria 2867
142 Ga0105249_11038543 3300009553 Bacteria 889
143 Ga0105239_10528735 3300010375 Bacteria 1342
144 Ga0157373_10006480 3300013100 Bacteria 8734
145 Ga0157371_10657939 3300013102 Unclassified 782
146 Ga0157370_11045608 3300013104 Unclassified 738
147 Ga0157369_10033592 3300013105 Bacteria 5636
148 Ga0157378_10148313 3300013297 Bacteria 2184
149 Ga0157378_10366376 3300013297 Bacteria 1411
150 Ga0163162_10181240 3300013306 Bacteria 2232
151 Ga0163162_10263070 3300013306 Bacteria 1857
152 Ga0163162_10288380 3300013306 Unclassified 1773
153 Ga0163162_10451548 3300013306 Bacteria 1417
154 Ga0157375_10023876 3300013308 Bacteria 5649
155 Ga0157375_10136109 3300013308 Bacteria 2580
156 Ga0157375_10292843 3300013308 Unclassified 1791
157 Ga0157375_10299253 3300013308 Bacteria 1772
158 Ga0157375_10522804 3300013308 Bacteria 1350
159 Ga0157375_11652384 3300013308 Unclassified 758
160 Ga0163163_10071752 3300014325 Bacteria 3451
161 Ga0163163_10344023 3300014325 Bacteria 1547
162 Ga0163163_11776605 3300014325 Unclassified 677
163 Ga0157380_10012752 3300014326 Bacteria 6104
164 Ga0157380_10191300 3300014326 Bacteria 1807
165 Ga0157380_10574068 3300014326 Bacteria 1111
166 Ga0157380_11118176 3300014326 Bacteria 828
167 Ga0157379_10008764 3300014968 Bacteria 8819
168 Ga0157379_12389866 3300014968 Unclassified 527
169 Ga0157376_10080954 3300014969 Unclassified 2787
170 Ga0163161_10193547 3300017792 Bacteria 1564
171 Ga0163161_10307095 3300017792 Bacteria 1251
172 Ga0163161_10525826 3300017792 Unclassified 966
173 Ga0213876_10514539 3300021384 Bacteria 637
174 Ga0207682_10026037 3300025893 Bacteria 2322
175 Ga0207710_10001000 3300025900 Bacteria 14789
176 Ga0207710_10015138 3300025900 Unclassified 3257
177 Ga0207680_10215840 3300025903 Bacteria 1313
178 Ga0207647_10229709 3300025904 Unclassified 1068
179 Ga0207685_10289203 3300025905 Unclassified 807
180 Ga0207643_10111706 3300025908 Bacteria 1610
181 Ga0207654_10098904 3300025911 Bacteria 1793
182 Ga0207707_10012517 3300025912 Bacteria 7377
183 Ga0207660_10764155 3300025917 Unclassified 789
184 Ga0207662_10220754 3300025918 Bacteria 1234
185 Ga0207657_10809343 3300025919 Unclassified 724
186 Ga0207649_10044604 3300025920 Bacteria 2715
187 Ga0207652_10041634 3300025921 Bacteria 3906
188 Ga0207650_10009045 3300025925 Bacteria 6809
189 Ga0207650_10317262 3300025925 Unclassified 1276
190 Ga0207650_10458130 3300025925 Bacteria 1062
191 Ga0207650_10948489 3300025925 Unclassified 731
192 Ga0207650_11609012 3300025925 Unclassified 551
193 Ga0207659_10102094 3300025926 Bacteria 2164
194 Ga0207659_10121715 3300025926 Bacteria 2000
195 Ga0207659_10221317 3300025926 Bacteria 1522
196 Ga0207687_10136808 3300025927 Bacteria 1854
197 Ga0207687_10906648 3300025927 Unclassified 754
198 Ga0207644_10121918 3300025931 Bacteria 1985
199 Ga0207644_10153665 3300025931 Bacteria 1783
200 Ga0207644_10771531 3300025931 Unclassified 804
201 Ga0207690_10223744 3300025932 Unclassified 1441
202 Ga0207686_10356725 3300025934 Unclassified 1102
203 Ga0207670_10026782 3300025936 Bacteria 3638
204 Ga0207670_10099455 3300025936 Bacteria 2075
205 Ga0207670_10141823 3300025936 Bacteria 1773
206 Ga0207669_10199706 3300025937 Bacteria 1450
207 Ga0207669_10782148 3300025937 Unclassified 790
208 Ga0207691_11279884 3300025940 Bacteria 606
209 Ga0207711_10004376 3300025941 Bacteria 12048
210 Ga0207711_10287467 3300025941 Bacteria 1515
211 Ga0207689_10258138 3300025942 Unclassified 1442
212 Ga0207679_10076094 3300025945 Bacteria 2549
213 Ga0207679_10079059 3300025945 Bacteria 2507
214 Ga0207651_10195126 3300025960 Bacteria 1618
215 Ga0207651_11352067 3300025960 Bacteria 641
216 Ga0207712_10019373 3300025961 Bacteria 4443
217 Ga0207712_10024863 3300025961 Bacteria 3973
218 Ga0207712_10524113 3300025961 Bacteria 1016
219 Ga0207712_11011923 3300025961 Bacteria 738
220 Ga0207668_10065807 3300025972 Unclassified 2567
221 Ga0207668_10496828 3300025972 Bacteria 1049
222 Ga0207658_10131057 3300025986 Bacteria 2014
223 Ga0207658_10233209 3300025986 Unclassified 1555
224 Ga0207677_10237874 3300026023 Bacteria 1471
225 Ga0207703_10006616 3300026035 Bacteria 9246
226 Ga0207703_10429256 3300026035 Bacteria 1231
227 Ga0207639_10001355 3300026041 Bacteria 16538
228 Ga0207639_10031930 3300026041 Bacteria 3873
229 Ga0207639_10389194 3300026041 Bacteria 1254
230 Ga0207678_10059781 3300026067 Bacteria 3279
231 Ga0207702_10198171 3300026078 Bacteria 1860
232 Ga0207641_10003868 3300026088 Bacteria 13107
233 Ga0207641_10123846 3300026088 Bacteria 2311
234 Ga0207648_10095427 3300026089 Unclassified 2601
235 Ga0207648_10363039 3300026089 Bacteria 1307
236 Ga0207676_10013241 3300026095 Bacteria 5924
237 Ga0207676_10454959 3300026095 Unclassified 1207
238 Ga0207674_10005651 3300026116 Bacteria 14827
239 Ga0207674_11102122 3300026116 Bacteria 763
240 Ga0207675_100432611 3300026118 Bacteria 1301
241 Ga0207675_100519146 3300026118 Bacteria 1187
242 Ga0207675_100663932 3300026118 Bacteria 1049
243 Ga0207683_10066581 3300026121 Bacteria 3177
244 Ga0207683_10604759 3300026121 Bacteria 1015
245 Ga0207698_10095867 3300026142 Bacteria 2443
246 Ga0207698_10256568 3300026142 Bacteria 1603
247 Ga0207698_10455999 3300026142 Bacteria 1235
248 Ga0210002_1032283 3300027617 Unclassified 873
249 Ga0268266_10099573 3300028379 Bacteria 2559
250 Ga0268265_10159166 3300028380 Bacteria 1915
251 Ga0268264_10002794 3300028381 Bacteria 15251
252 Ga0307408_100272490 3300031548 Bacteria 1406
253 Ga0307408_100426134 3300031548 Bacteria 1145
254 Ga0307516_10086753 3300031730 Bacteria 2965
255 Ga0307405_10165006 3300031731 Bacteria 1573
256 Ga0307405_10329481 3300031731 Unclassified 1169
257 Ga0307413_10001467 3300031824 Bacteria 8960
258 Ga0307413_10028922 3300031824 Bacteria 3094
259 Ga0307413_10173994 3300031824 Unclassified 1527
260 Ga0307413_10179446 3300031824 Bacteria 1508
261 Ga0307413_10675730 3300031824 Unclassified 855
262 Ga0307413_10848621 3300031824 Bacteria 771
263 Ga0307410_10015204 3300031852 Bacteria 4558
264 Ga0307410_10338407 3300031852 Bacteria 1199
265 Ga0307410_10500517 3300031852 Unclassified 1000
266 Ga0307406_10028247 3300031901 Unclassified 3388
267 Ga0307406_10466544 3300031901 Bacteria 1016
268 Ga0307406_11888771 3300031901 Unclassified 532
269 Ga0307407_10004896 3300031903 Bacteria 5747
270 Ga0307407_10202170 3300031903 Bacteria 1332
271 Ga0307412_10135064 3300031911 Bacteria 1798
272 Ga0307412_10311306 3300031911 Bacteria 1249
273 Ga0307412_10388437 3300031911 Bacteria 1132
274 Ga0307409_100000635 3300031995 Bacteria 15464
275 Ga0307409_100036895 3300031995 Bacteria 3598
276 Ga0307409_100417279 3300031995 Unclassified 1286
277 Ga0307409_100752115 3300031995 Unclassified 978
278 Ga0307409_102050704 3300031995 Unclassified 602
279 Ga0307416_100475087 3300032002 Bacteria 1309
280 Ga0307416_101388487 3300032002 Bacteria 808
281 Ga0307414_10000900 3300032004 Bacteria 15232
282 Ga0307414_11581792 3300032004 Unclassified 611
283 Ga0307411_10029527 3300032005 Bacteria 3350
284 Ga0307411_10080388 3300032005 Unclassified 2241
285 Ga0307411_10199918 3300032005 Bacteria 1534
286 Ga0307411_10910563 3300032005 Bacteria 782
287 Ga0307411_11490750 3300032005 Unclassified 621
288 Ga0307415_100065543 3300032126 Bacteria 2531
289 Ga0307415_100571978 3300032126 Bacteria 1001
290 Ga0307415_100916764 3300032126 Unclassified 809
291 Ga0307415_101282270 3300032126 Unclassified 693
292 Ga0373960_0183480 3300035121 Bacteria 732
293 Ga0395905_0009217 3300037471 Bacteria 9665
294 Ga0395901_0662265 3300038443 Bacteria 1046
295 Ga0436365_0648832 3300039437 Bacteria 5416
296 Ga0436365_1203709 3300039437 Bacteria 1241
297 Ga0451791_1496141 3300041451 Unclassified 819
298 Ga0451837_0494304 3300041494 Unclassified 1504
299 Ga0451853_2553120 3300041512 Unclassified 659
300 Ga0439449_0152206 3300042007 Bacteria 863
301 Ga0439449_0243481 3300042007 Bacteria 676
302 Ga0439452_089546 3300042010 Bacteria 666
303 Ga0453683_1006874 3300044673 Unclassified 553
304 Ga0466957_1241477 3300044842 Unclassified 540
305 Ga0495669_0366290 3300046684 Bacteria 697
306 Ga0496104_0467748 3300048907 Bacteria 1172
307 Ga0496105_0103123 3300048908 Bacteria 2356
308 Ga0496108_0407297 3300048911 Bacteria 1188
309 Ga0496109_0391927 3300048912 Bacteria 1312
310 Ga0496114_0113669 3300048917 Bacteria 2321
311 Ga0501217_260947 3300049661 Unclassified 561
312 Ga0501235_034788 3300049669 Bacteria 1143
313 Ga0501079_0328018 3300049741 Bacteria 1199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886011 MRS1b_contig_8520897 MRS1b_0987.00003470 149
2 2162886012 MBSR1b_contig_1638386 MBSR1b_0359.00001890 149
3 2162886012 MBSR1b_contig_6988234 MBSR1b_0420.00003170 149
4 3300003322 rootL2_10161442 rootL2_101614422 149
5 3300005288 Ga0065714_10254546 Ga0065714_102545461 149
6 3300005290 Ga0065712_10090045 Ga0065712_100900452 149
7 3300005290 Ga0065712_10594408 Ga0065712_105944081 149
8 3300005293 Ga0065715_10134959 Ga0065715_101349592 149
9 3300005293 Ga0065715_10261341 Ga0065715_102613412 149
10 3300005295 Ga0065707_10092241 Ga0065707_100922412 149
11 3300005330 Ga0070690_100001956 Ga0070690_1000019566 149
12 3300005331 Ga0070670_100015402 Ga0070670_1000154022 149
13 3300005331 Ga0070670_100146568 Ga0070670_1001465682 149
14 3300005331 Ga0070670_100572515 Ga0070670_1005725152 149
15 3300005334 Ga0068869_100001190 Ga0068869_1000011902 149
16 3300005334 Ga0068869_100126260 Ga0068869_1001262602 149
17 3300005334 Ga0068869_100169615 Ga0068869_1001696152 149
18 3300005334 Ga0068869_100418386 Ga0068869_1004183861 149
19 3300005334 Ga0068869_101383517 Ga0068869_1013835171 149
20 3300005335 Ga0070666_10238475 Ga0070666_102384752 149
21 3300005337 Ga0070682_100165637 Ga0070682_1001656371 149
22 3300005337 Ga0070682_100357870 Ga0070682_1003578701 149
23 3300005338 Ga0068868_100123282 Ga0068868_1001232822 149
24 3300005340 Ga0070689_100015406 Ga0070689_1000154064 149
25 3300005340 Ga0070689_100135745 Ga0070689_1001357452 149
26 3300005340 Ga0070689_100299050 Ga0070689_1002990502 149
27 3300005343 Ga0070687_100199948 Ga0070687_1001999482 149
28 3300005344 Ga0070661_100016280 Ga0070661_1000162802 149
29 3300005344 Ga0070661_100445848 Ga0070661_1004458482 149
30 3300005347 Ga0070668_100803331 Ga0070668_1008033311 149
31 3300005347 Ga0070668_100961418 Ga0070668_1009614181 149
32 3300005353 Ga0070669_101691484 Ga0070669_1016914841 149
33 3300005354 Ga0070675_100089874 Ga0070675_1000898742 149
34 3300005354 Ga0070675_100096238 Ga0070675_1000962382 149
35 3300005354 Ga0070675_100209224 Ga0070675_1002092242 149
36 3300005354 Ga0070675_100291268 Ga0070675_1002912682 149
37 3300005355 Ga0070671_100042668 Ga0070671_1000426683 149
38 3300005355 Ga0070671_100135012 Ga0070671_1001350122 149
39 3300005355 Ga0070671_100469485 Ga0070671_1004694852 149
40 3300005355 Ga0070671_100753474 Ga0070671_1007534742 149
41 3300005356 Ga0070674_100345039 Ga0070674_1003450392 149
42 3300005364 Ga0070673_100591891 Ga0070673_1005918911 149
43 3300005364 Ga0070673_101505122 Ga0070673_1015051221 149
44 3300005365 Ga0070688_100070606 Ga0070688_1000706063 149
45 3300005367 Ga0070667_100010345 Ga0070667_1000103452 149
46 3300005367 Ga0070667_101061653 Ga0070667_1010616531 149
47 3300005440 Ga0070705_100123270 Ga0070705_1001232701 149
48 3300005440 Ga0070705_100863057 Ga0070705_1008630571 149
49 3300005455 Ga0070663_100033601 Ga0070663_1000336012 149
50 3300005456 Ga0070678_100471272 Ga0070678_1004712722 149
51 3300005456 Ga0070678_100711076 Ga0070678_1007110762 149
52 3300005456 Ga0070678_100774326 Ga0070678_1007743261 149
53 3300005457 Ga0070662_100022720 Ga0070662_1000227203 149
54 3300005457 Ga0070662_100374346 Ga0070662_1003743462 149
55 3300005459 Ga0068867_100186777 Ga0068867_1001867772 149
56 3300005459 Ga0068867_100364319 Ga0068867_1003643192 149
57 3300005459 Ga0068867_100380324 Ga0068867_1003803242 149
58 3300005466 Ga0070685_10023032 Ga0070685_100230322 149
59 3300005466 Ga0070685_10087722 Ga0070685_100877222 149
60 3300005467 Ga0070706_100049738 Ga0070706_1000497382 149
61 3300005471 Ga0070698_101073502 Ga0070698_1010735021 149
62 3300005539 Ga0068853_100004786 Ga0068853_1000047862 149
63 3300005539 Ga0068853_100452803 Ga0068853_1004528032 149
64 3300005543 Ga0070672_100066942 Ga0070672_1000669421 149
65 3300005543 Ga0070672_100607370 Ga0070672_1006073702 149
66 3300005543 Ga0070672_100752304 Ga0070672_1007523042 149
67 3300005543 Ga0070672_101618922 Ga0070672_1016189222 149
68 3300005544 Ga0070686_100116052 Ga0070686_1001160522 149
69 3300005544 Ga0070686_101848340 Ga0070686_1018483401 149
70 3300005545 Ga0070695_100282899 Ga0070695_1002828992 149
71 3300005546 Ga0070696_101251848 Ga0070696_1012518481 149
72 3300005547 Ga0070693_100328821 Ga0070693_1003288212 149
73 3300005547 Ga0070693_100768603 Ga0070693_1007686031 149
74 3300005548 Ga0070665_100212942 Ga0070665_1002129422 149
75 3300005563 Ga0068855_100020237 Ga0068855_1000202375 149
76 3300005563 Ga0068855_102330407 Ga0068855_1023304071 149
77 3300005564 Ga0070664_100021267 Ga0070664_1000212672 149
78 3300005564 Ga0070664_100141709 Ga0070664_1001417092 149
79 3300005577 Ga0068857_100006362 Ga0068857_1000063625 149
80 3300005577 Ga0068857_100599450 Ga0068857_1005994502 149
81 3300005614 Ga0068856_100589661 Ga0068856_1005896612 149
82 3300005615 Ga0070702_100026488 Ga0070702_1000264882 149
83 3300005616 Ga0068852_100041506 Ga0068852_1000415065 149
84 3300005616 Ga0068852_100147712 Ga0068852_1001477122 149
85 3300005616 Ga0068852_100225807 Ga0068852_1002258072 149
86 3300005617 Ga0068859_100008959 Ga0068859_1000089594 149
87 3300005617 Ga0068859_100014118 Ga0068859_1000141186 149
88 3300005617 Ga0068859_100049994 Ga0068859_1000499942 149
89 3300005617 Ga0068859_100806024 Ga0068859_1008060242 149
90 3300005618 Ga0068864_100055498 Ga0068864_1000554982 149
91 3300005618 Ga0068864_100057430 Ga0068864_1000574302 149
92 3300005618 Ga0068864_100737838 Ga0068864_1007378382 149
93 3300005719 Ga0068861_100387999 Ga0068861_1003879992 149
94 3300005719 Ga0068861_100522349 Ga0068861_1005223492 149
95 3300005719 Ga0068861_100591538 Ga0068861_1005915382 149
96 3300005840 Ga0068870_10028585 Ga0068870_100285853 149
97 3300005840 Ga0068870_10173527 Ga0068870_101735271 149
98 3300005841 Ga0068863_100084428 Ga0068863_1000844282 149
99 3300005841 Ga0068863_100155578 Ga0068863_1001555782 149
100 3300005841 Ga0068863_100155973 Ga0068863_1001559732 149
101 3300005841 Ga0068863_100325813 Ga0068863_1003258132 149
102 3300005841 Ga0068863_101176796 Ga0068863_1011767962 149
103 3300005842 Ga0068858_100144670 Ga0068858_1001446702 149
104 3300005842 Ga0068858_100183860 Ga0068858_1001838602 149
105 3300005842 Ga0068858_100690083 Ga0068858_1006900832 149
106 3300005843 Ga0068860_100020159 Ga0068860_1000201596 149
107 3300005843 Ga0068860_100331702 Ga0068860_1003317022 149
108 3300005844 Ga0068862_100053192 Ga0068862_1000531922 149
109 3300005844 Ga0068862_100076521 Ga0068862_1000765212 149
110 3300005844 Ga0068862_100092902 Ga0068862_1000929022 149
111 3300005844 Ga0068862_100213855 Ga0068862_1002138552 149
112 3300005844 Ga0068862_100282812 Ga0068862_1002828122 149
113 3300005844 Ga0068862_100379061 Ga0068862_1003790612 149
114 3300006163 Ga0070715_10177870 Ga0070715_101778702 149
115 3300006237 Ga0097621_100124619 Ga0097621_1001246192 149
116 3300006237 Ga0097621_100308880 Ga0097621_1003088802 149
117 3300006358 Ga0068871_100123511 Ga0068871_1001235112 149
118 3300006881 Ga0068865_100191854 Ga0068865_1001918541 149
119 3300006931 Ga0097620_100008960 Ga0097620_1000089604 149
120 3300006931 Ga0097620_100014118 Ga0097620_1000141186 149
121 3300006931 Ga0097620_100049994 Ga0097620_1000499943 149
122 3300006931 Ga0097620_100806018 Ga0097620_1008060182 149
123 3300009092 Ga0105250_10051159 Ga0105250_100511592 149
124 3300009093 Ga0105240_10092051 Ga0105240_100920515 149
125 3300009094 Ga0111539_10741246 Ga0111539_107412462 149
126 3300009094 Ga0111539_11928053 Ga0111539_119280532 149
127 3300009098 Ga0105245_10216095 Ga0105245_102160952 149
128 3300009101 Ga0105247_10002021 Ga0105247_100020216 149
129 3300009101 Ga0105247_10023150 Ga0105247_100231502 149
130 3300009147 Ga0114129_11885108 Ga0114129_118851081 149
131 3300009148 Ga0105243_10402737 Ga0105243_104027372 149
132 3300009148 Ga0105243_11303979 Ga0105243_113039792 149
133 3300009174 Ga0105241_10158004 Ga0105241_101580042 149
134 3300009174 Ga0105241_10267710 Ga0105241_102677102 149
135 3300009176 Ga0105242_10106901 Ga0105242_101069012 149
136 3300009177 Ga0105248_10277372 Ga0105248_102773722 149
137 3300009177 Ga0105248_10936597 Ga0105248_109365971 149
138 3300009553 Ga0105249_10023338 Ga0105249_100233383 149
139 3300009553 Ga0105249_10027231 Ga0105249_100272315 149
140 3300009553 Ga0105249_10061461 Ga0105249_100614613 149
141 3300009553 Ga0105249_10090089 Ga0105249_100900892 149
142 3300009553 Ga0105249_11038543 Ga0105249_110385432 149
143 3300010375 Ga0105239_10528735 Ga0105239_105287352 149
144 3300013100 Ga0157373_10006480 Ga0157373_100064805 149
145 3300013102 Ga0157371_10657939 Ga0157371_106579392 149
146 3300013104 Ga0157370_11045608 Ga0157370_110456081 149
147 3300013105 Ga0157369_10033592 Ga0157369_100335924 149
148 3300013297 Ga0157378_10148313 Ga0157378_101483132 149
149 3300013297 Ga0157378_10366376 Ga0157378_103663762 149
150 3300013306 Ga0163162_10181240 Ga0163162_101812402 149
151 3300013306 Ga0163162_10263070 Ga0163162_102630702 149
152 3300013306 Ga0163162_10288380 Ga0163162_102883801 149
153 3300013306 Ga0163162_10451548 Ga0163162_104515482 149
154 3300013308 Ga0157375_10023876 Ga0157375_100238762 149
155 3300013308 Ga0157375_10136109 Ga0157375_101361092 149
156 3300013308 Ga0157375_10292843 Ga0157375_102928432 149
157 3300013308 Ga0157375_10299253 Ga0157375_102992532 149
158 3300013308 Ga0157375_10522804 Ga0157375_105228042 149
159 3300013308 Ga0157375_11652384 Ga0157375_116523842 149
160 3300014325 Ga0163163_10071752 Ga0163163_100717523 149
161 3300014325 Ga0163163_10344023 Ga0163163_103440232 149
162 3300014325 Ga0163163_11776605 Ga0163163_117766051 149
163 3300014326 Ga0157380_10012752 Ga0157380_100127528 149
164 3300014326 Ga0157380_10191300 Ga0157380_101913002 149
165 3300014326 Ga0157380_10574068 Ga0157380_105740682 149
166 3300014326 Ga0157380_11118176 Ga0157380_111181762 149
167 3300014968 Ga0157379_10008764 Ga0157379_100087646 149
168 3300014968 Ga0157379_12389866 Ga0157379_123898661 149
169 3300014969 Ga0157376_10080954 Ga0157376_100809543 149
170 3300017792 Ga0163161_10193547 Ga0163161_101935471 149
171 3300017792 Ga0163161_10307095 Ga0163161_103070952 149
172 3300017792 Ga0163161_10525826 Ga0163161_105258262 149
173 3300021384 Ga0213876_10514539 Ga0213876_105145391 149
174 3300025893 Ga0207682_10026037 Ga0207682_100260372 149
175 3300025900 Ga0207710_10001000 Ga0207710_100010004 149
176 3300025900 Ga0207710_10015138 Ga0207710_100151382 149
177 3300025903 Ga0207680_10215840 Ga0207680_102158401 149
178 3300025904 Ga0207647_10229709 Ga0207647_102297091 149
179 3300025905 Ga0207685_10289203 Ga0207685_102892031 149
180 3300025908 Ga0207643_10111706 Ga0207643_101117062 149
181 3300025911 Ga0207654_10098904 Ga0207654_100989042 149
182 3300025912 Ga0207707_10012517 Ga0207707_100125177 149
183 3300025917 Ga0207660_10764155 Ga0207660_107641551 149
184 3300025918 Ga0207662_10220754 Ga0207662_102207542 149
185 3300025919 Ga0207657_10809343 Ga0207657_108093432 149
186 3300025920 Ga0207649_10044604 Ga0207649_100446043 149
187 3300025921 Ga0207652_10041634 Ga0207652_100416342 149
188 3300025925 Ga0207650_10009045 Ga0207650_100090452 149
189 3300025925 Ga0207650_10317262 Ga0207650_103172622 149
190 3300025925 Ga0207650_10458130 Ga0207650_104581302 149
191 3300025925 Ga0207650_10948489 Ga0207650_109484892 149
192 3300025925 Ga0207650_11609012 Ga0207650_116090122 149
193 3300025926 Ga0207659_10102094 Ga0207659_101020942 149
194 3300025926 Ga0207659_10121715 Ga0207659_101217152 149
195 3300025926 Ga0207659_10221317 Ga0207659_102213172 149
196 3300025927 Ga0207687_10136808 Ga0207687_101368081 149
197 3300025927 Ga0207687_10906648 Ga0207687_109066482 149
198 3300025931 Ga0207644_10121918 Ga0207644_101219182 149
199 3300025931 Ga0207644_10153665 Ga0207644_101536652 149
200 3300025931 Ga0207644_10771531 Ga0207644_107715311 149
201 3300025932 Ga0207690_10223744 Ga0207690_102237442 149
202 3300025934 Ga0207686_10356725 Ga0207686_103567252 149
203 3300025936 Ga0207670_10026782 Ga0207670_100267822 149
204 3300025936 Ga0207670_10099455 Ga0207670_100994552 149
205 3300025936 Ga0207670_10141823 Ga0207670_101418232 149
206 3300025937 Ga0207669_10199706 Ga0207669_101997062 149
207 3300025937 Ga0207669_10782148 Ga0207669_107821482 149
208 3300025940 Ga0207691_11279884 Ga0207691_112798841 149
209 3300025941 Ga0207711_10004376 Ga0207711_100043765 149
210 3300025941 Ga0207711_10287467 Ga0207711_102874675 149
211 3300025942 Ga0207689_10258138 Ga0207689_102581382 149
212 3300025945 Ga0207679_10076094 Ga0207679_100760942 149
213 3300025945 Ga0207679_10079059 Ga0207679_100790592 149
214 3300025960 Ga0207651_10195126 Ga0207651_101951262 149
215 3300025960 Ga0207651_11352067 Ga0207651_113520671 149
216 3300025961 Ga0207712_10019373 Ga0207712_100193732 149
217 3300025961 Ga0207712_10024863 Ga0207712_100248632 149
218 3300025961 Ga0207712_10524113 Ga0207712_105241132 149
219 3300025961 Ga0207712_11011923 Ga0207712_110119232 149
220 3300025972 Ga0207668_10065807 Ga0207668_100658072 149
221 3300025972 Ga0207668_10496828 Ga0207668_104968282 149
222 3300025986 Ga0207658_10131057 Ga0207658_101310572 149
223 3300025986 Ga0207658_10233209 Ga0207658_102332092 149
224 3300026023 Ga0207677_10237874 Ga0207677_102378742 149
225 3300026035 Ga0207703_10006616 Ga0207703_100066163 149
226 3300026035 Ga0207703_10429256 Ga0207703_104292561 149
227 3300026041 Ga0207639_10001355 Ga0207639_1000135516 149
228 3300026041 Ga0207639_10031930 Ga0207639_100319303 149
229 3300026041 Ga0207639_10389194 Ga0207639_103891942 149
230 3300026067 Ga0207678_10059781 Ga0207678_100597812 149
231 3300026078 Ga0207702_10198171 Ga0207702_101981712 149
232 3300026088 Ga0207641_10003868 Ga0207641_100038687 149
233 3300026088 Ga0207641_10123846 Ga0207641_101238462 149
234 3300026089 Ga0207648_10095427 Ga0207648_100954272 149
235 3300026089 Ga0207648_10363039 Ga0207648_103630392 149
236 3300026095 Ga0207676_10013241 Ga0207676_100132412 149
237 3300026095 Ga0207676_10454959 Ga0207676_104549592 149
238 3300026116 Ga0207674_10005651 Ga0207674_1000565112 149
239 3300026116 Ga0207674_11102122 Ga0207674_111021221 149
240 3300026118 Ga0207675_100432611 Ga0207675_1004326112 149
241 3300026118 Ga0207675_100519146 Ga0207675_1005191462 149
242 3300026118 Ga0207675_100663932 Ga0207675_1006639322 149
243 3300026121 Ga0207683_10066581 Ga0207683_100665812 149
244 3300026121 Ga0207683_10604759 Ga0207683_106047591 149
245 3300026142 Ga0207698_10095867 Ga0207698_100958674 149
246 3300026142 Ga0207698_10256568 Ga0207698_102565682 149
247 3300026142 Ga0207698_10455999 Ga0207698_104559992 149
248 3300027617 Ga0210002_1032283 Ga0210002_10322832 149
249 3300028379 Ga0268266_10099573 Ga0268266_100995732 149
250 3300028380 Ga0268265_10159166 Ga0268265_101591662 149
251 3300028381 Ga0268264_10002794 Ga0268264_100027942 149
252 3300031548 Ga0307408_100272490 Ga0307408_1002724902 149
253 3300031548 Ga0307408_100426134 Ga0307408_1004261342 149
254 3300031730 Ga0307516_10086753 Ga0307516_100867532 149
255 3300031731 Ga0307405_10165006 Ga0307405_101650062 149
256 3300031731 Ga0307405_10329481 Ga0307405_103294811 149
257 3300031824 Ga0307413_10001467 Ga0307413_100014672 149
258 3300031824 Ga0307413_10028922 Ga0307413_100289222 149
259 3300031824 Ga0307413_10173994 Ga0307413_101739942 149
260 3300031824 Ga0307413_10179446 Ga0307413_101794462 149
261 3300031824 Ga0307413_10675730 Ga0307413_106757302 149
262 3300031824 Ga0307413_10848621 Ga0307413_108486212 149
263 3300031852 Ga0307410_10015204 Ga0307410_100152042 149
264 3300031852 Ga0307410_10338407 Ga0307410_103384072 149
265 3300031852 Ga0307410_10500517 Ga0307410_105005172 149
266 3300031901 Ga0307406_10028247 Ga0307406_100282472 149
267 3300031901 Ga0307406_10466544 Ga0307406_104665442 149
268 3300031901 Ga0307406_11888771 Ga0307406_118887711 149
269 3300031903 Ga0307407_10004896 Ga0307407_100048964 149
270 3300031903 Ga0307407_10202170 Ga0307407_102021702 149
271 3300031911 Ga0307412_10135064 Ga0307412_101350642 149
272 3300031911 Ga0307412_10311306 Ga0307412_103113062 149
273 3300031911 Ga0307412_10388437 Ga0307412_103884371 149
274 3300031995 Ga0307409_100000635 Ga0307409_1000006354 149
275 3300031995 Ga0307409_100036895 Ga0307409_1000368954 149
276 3300031995 Ga0307409_100417279 Ga0307409_1004172792 149
277 3300031995 Ga0307409_100752115 Ga0307409_1007521152 149
278 3300031995 Ga0307409_102050704 Ga0307409_1020507041 149
279 3300032002 Ga0307416_100475087 Ga0307416_1004750872 149
280 3300032002 Ga0307416_101388487 Ga0307416_1013884872 149
281 3300032004 Ga0307414_10000900 Ga0307414_100009004 149
282 3300032004 Ga0307414_11581792 Ga0307414_115817921 149
283 3300032005 Ga0307411_10029527 Ga0307411_100295272 149
284 3300032005 Ga0307411_10080388 Ga0307411_100803882 149
285 3300032005 Ga0307411_10199918 Ga0307411_101999182 149
286 3300032005 Ga0307411_10910563 Ga0307411_109105632 149
287 3300032005 Ga0307411_11490750 Ga0307411_114907502 149
288 3300032126 Ga0307415_100065543 Ga0307415_1000655432 149
289 3300032126 Ga0307415_100571978 Ga0307415_1005719782 149
290 3300032126 Ga0307415_100916764 Ga0307415_1009167642 149
291 3300032126 Ga0307415_101282270 Ga0307415_1012822702 149
292 3300035121 Ga0373960_0183480 Ga0373960_0183480_180_629 149
293 3300037471 Ga0395905_0009217 Ga0395905_0009217_5142_5594 149
294 3300038443 Ga0395901_0662265 Ga0395901_0662265_153_611 149
295 3300039437 Ga0436365_0648832 Ga0436365_0648832_161_610 149
296 3300039437 Ga0436365_1203709 Ga0436365_1203709_544_993 149
297 3300041451 Ga0451791_1496141 Ga0451791_1496141_265_714 149
298 3300041494 Ga0451837_0494304 Ga0451837_0494304_984_1433 149
299 3300041512 Ga0451853_2553120 Ga0451853_2553120_36_485 149
300 3300042007 Ga0439449_0152206 Ga0439449_0152206_383_832 149
301 3300042007 Ga0439449_0243481 Ga0439449_0243481_184_633 149
302 3300042010 Ga0439452_089546 Ga0439452_089546_14_463 149
303 3300044673 Ga0453683_1006874 Ga0453683_1006874_23_472 149
304 3300044842 Ga0466957_1241477 Ga0466957_1241477_75_524 149
305 3300046684 Ga0495669_0366290 Ga0495669_0366290_123_572 149
306 3300048907 Ga0496104_0467748 Ga0496104_0467748_470_919 149
307 3300048908 Ga0496105_0103123 Ga0496105_0103123_809_1258 149
308 3300048911 Ga0496108_0407297 Ga0496108_0407297_470_919 149
309 3300048912 Ga0496109_0391927 Ga0496109_0391927_849_1298 149
310 3300048917 Ga0496114_0113669 Ga0496114_0113669_633_1082 149
311 3300049661 Ga0501217_260947 Ga0501217_260947_52_501 149
312 3300049669 Ga0501235_034788 Ga0501235_034788_65_514 149
313 3300049741 Ga0501079_0328018 Ga0501079_0328018_610_1068 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

115

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8194 2 87
2lrr-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate 0.7908 90 149
2fph-assembly1.cif.gz_X cell division protein ylmh from streptococcus pneumoniae 0.7651 86 148
2a1s-assembly1.cif.gz_A crystal structure of native parn nuclease domain 0.7641 87 149
2pt7-assembly1.cif.gz_H crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451) 0.741 5 147
ID Description Score Start End Superfamily
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9167 82 149 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8968 86 149 3.30.1370.50
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8919 82 149 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8722 86 149 3.30.1370.50
af_A0A0R4IN15_23_108_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8652 86 148 3.30.1370.50
ID Description Score Start End GO Terms
AF-A0A1F6KN25-F1-model_v4 R3H domain-containing protein 0.9604 81 149 GO:0003723
AF-A0A536AGC4-F1-model_v4 R3H domain-containing protein 0.9523 80 149 GO:0003723
AF-A0A2V8TF78-F1-model_v4 R3H domain-containing protein 0.9501 81 149 GO:0003723
AF-A0A7C5HSS9-F1-model_v4 R3H domain-containing protein 0.9469 80 149 GO:0003723
AF-A0A6I2VDP9-F1-model_v4 Protein jag 0.9457 81 149 GO:0003723

Feature Viewer

pLDDT pTM Quality
93.6 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map