F402032

General Info

Members Datasets Scaffolds Average Seq Length
313 158 626 136

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10180292|Ga0070666_101802921
Length 150
Sequence MRETRMAAQPFDLNEGRVPMPKLPLLTVAASAFALAVPVPAAAQNGRISEIIVYGTDPCPRSTDDEVVVCARKPESERFRIPERYRQSGPRQTREAWANKAIAFETYSKNGINSCSPVGPSGLTGCTQQLINQAFKEREEQADQGSVPAE

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
144 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
145 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
146 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
149 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
150 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
151 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
152 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10180292 3300005335 Bacteria 1481
2 JGI24746J21847_1009502 3300001977 Bacteria 1451
3 JGI24750J21931_1009064 3300002070 Bacteria 1275
4 JGI24749J21850_1002000 3300002076 Bacteria 2881
5 JGI24035J26624_1003212 3300002126 Bacteria 1534
6 JGI24033J26618_1014829 3300002155 Bacteria 956
7 JGI24034J26672_10007834 3300002239 Bacteria 1555
8 Ga0065712_10154136 3300005290 Bacteria 1347
9 Ga0065715_10089047 3300005293 Bacteria 15651
10 Ga0065715_10414634 3300005293 Bacteria 865
11 Ga0070658_10004285 3300005327 Bacteria 11655
12 Ga0070658_10311344 3300005327 Bacteria 1343
13 Ga0070676_10000501 3300005328 Bacteria 18699
14 Ga0070670_100001829 3300005331 Bacteria 17314
15 Ga0070670_100007705 3300005331 Bacteria 9154
16 Ga0070677_10000374 3300005333 Bacteria 15814
17 Ga0070677_10394338 3300005333 Bacteria 728
18 Ga0068868_100265067 3300005338 Bacteria 1450
19 Ga0070660_100744717 3300005339 Bacteria 823
20 Ga0070660_101479308 3300005339 Bacteria 577
21 Ga0070661_100145136 3300005344 Bacteria 1791
22 Ga0070668_100000800 3300005347 Bacteria 21663
23 Ga0070668_100511136 3300005347 Bacteria 1041
24 Ga0070668_101385353 3300005347 Unclassified 641
25 Ga0070668_101743682 3300005347 Bacteria 572
26 Ga0070669_100000890 3300005353 Bacteria 21728
27 Ga0070669_100001383 3300005353 Bacteria 17504
28 Ga0070675_100001581 3300005354 Bacteria 16808
29 Ga0070671_100001057 3300005355 Bacteria 20291
30 Ga0070674_100115040 3300005356 Bacteria 1982
31 Ga0070673_100036630 3300005364 Bacteria 3731
32 Ga0070659_100023101 3300005366 Bacteria 4754
33 Ga0070659_101112302 3300005366 Bacteria 697
34 Ga0070667_100041572 3300005367 Bacteria 3857
35 Ga0070667_100218209 3300005367 Bacteria 1697
36 Ga0070701_10137794 3300005438 Bacteria 1392
37 Ga0070700_100087027 3300005441 Bacteria 2030
38 Ga0070663_100005251 3300005455 Bacteria 7679
39 Ga0070678_100029924 3300005456 Bacteria 3736
40 Ga0070662_100000287 3300005457 Bacteria 29960
41 Ga0070681_11888839 3300005458 Bacteria 525
42 Ga0068867_100105907 3300005459 Bacteria 2154
43 Ga0068853_100073785 3300005539 Bacteria 2976
44 Ga0070672_100004463 3300005543 Bacteria 9165
45 Ga0070696_100983192 3300005546 Bacteria 704
46 Ga0068855_100148420 3300005563 Bacteria 2668
47 Ga0068855_100753561 3300005563 Bacteria 1038
48 Ga0070664_101200955 3300005564 Bacteria 715
49 Ga0068857_100310357 3300005577 Bacteria 1455
50 Ga0068854_100057796 3300005578 Bacteria 2798
51 Ga0068854_100113475 3300005578 Bacteria 2047
52 Ga0068852_100068940 3300005616 Bacteria 3097
53 Ga0068859_100041650 3300005617 Bacteria 4613
54 Ga0068864_100110989 3300005618 Bacteria 2443
55 Ga0068864_100372299 3300005618 Bacteria 1352
56 Ga0068866_10250561 3300005718 Bacteria 1083
57 Ga0068861_100005175 3300005719 Bacteria 8799
58 Ga0068870_10218974 3300005840 Bacteria 1164
59 Ga0068860_100224788 3300005843 Bacteria 1823
60 Ga0068860_100606939 3300005843 Bacteria 1100
61 Ga0068862_100002942 3300005844 Bacteria 14886
62 Ga0068862_100062361 3300005844 Bacteria 3206
63 Ga0068862_100253438 3300005844 Bacteria 1605
64 Ga0068862_100487450 3300005844 Bacteria 1168
65 Ga0068862_102138641 3300005844 Bacteria 571
66 Ga0075428_101054025 3300006844 Bacteria 860
67 Ga0075429_100958701 3300006880 Bacteria 748
68 Ga0068865_100593246 3300006881 Bacteria 935
69 Ga0097620_100041649 3300006931 Bacteria 4613
70 Ga0111539_10215141 3300009094 Bacteria 2238
71 Ga0105243_10084905 3300009148 Bacteria 2594
72 Ga0105237_12625485 3300009545 Bacteria 514
73 Ga0105238_10004914 3300009551 Bacteria 13228
74 Ga0105249_10014232 3300009553 Bacteria 7034
75 Ga0105249_10098143 3300009553 Bacteria 2751
76 Ga0105249_10113198 3300009553 Bacteria 2567
77 Ga0157370_10546034 3300013104 Bacteria 1062
78 Ga0157369_10008924 3300013105 Bacteria 11480
79 Ga0157380_10000319 3300014326 Bacteria 29011
80 Ga0157380_10001210 3300014326 Bacteria 16709
81 Ga0157380_10075357 3300014326 Bacteria 2742
82 Ga0157380_11052610 3300014326 Bacteria 850
83 Ga0163161_10255819 3300017792 Bacteria 1366
84 Ga0207666_1001928 3300025271 Bacteria 2468
85 Ga0207697_10000459 3300025315 Bacteria 22944
86 Ga0207682_10000549 3300025893 Bacteria 17276
87 Ga0207688_10029425 3300025901 Bacteria 3024
88 Ga0207688_11046574 3300025901 Bacteria 515
89 Ga0207680_10135815 3300025903 Bacteria 1625
90 Ga0207647_10138220 3300025904 Bacteria 1429
91 Ga0207645_10023825 3300025907 Bacteria 3974
92 Ga0207643_10121531 3300025908 Bacteria 1548
93 Ga0207705_10042902 3300025909 Bacteria 3248
94 Ga0207705_10110139 3300025909 Bacteria 2034
95 Ga0207657_11198148 3300025919 Bacteria 577
96 Ga0207649_11059997 3300025920 Unclassified 639
97 Ga0207681_10000414 3300025923 Bacteria 29779
98 Ga0207681_10937766 3300025923 Bacteria 725
99 Ga0207694_10034317 3300025924 Bacteria 3890
100 Ga0207650_10006161 3300025925 Bacteria 8173
101 Ga0207650_10133595 3300025925 Bacteria 1944
102 Ga0207659_10000722 3300025926 Bacteria 19576
103 Ga0207644_10596063 3300025931 Bacteria 917
104 Ga0207690_10226203 3300025932 Bacteria 1434
105 Ga0207690_10235291 3300025932 Bacteria 1408
106 Ga0207706_10000411 3300025933 Bacteria 45884
107 Ga0207669_10066118 3300025937 Bacteria 2246
108 Ga0207704_11044345 3300025938 Bacteria 693
109 Ga0207691_10001043 3300025940 Bacteria 27477
110 Ga0207691_11560849 3300025940 Unclassified 538
111 Ga0207689_10222486 3300025942 Bacteria 1560
112 Ga0207661_10204252 3300025944 Bacteria 1738
113 Ga0207712_10027460 3300025961 Bacteria 3801
114 Ga0207712_10055334 3300025961 Bacteria 2790
115 Ga0207668_10000205 3300025972 Bacteria 40046
116 Ga0207668_10067328 3300025972 Bacteria 2542
117 Ga0207668_10355704 3300025972 Bacteria 1226
118 Ga0207640_10166234 3300025981 Bacteria 1638
119 Ga0207640_10555650 3300025981 Bacteria 965
120 Ga0207658_10003997 3300025986 Bacteria 10332
121 Ga0207677_10472159 3300026023 Bacteria 1079
122 Ga0207678_10005715 3300026067 Bacteria 11102
123 Ga0207708_10161990 3300026075 Bacteria 1767
124 Ga0207702_10607563 3300026078 Bacteria 1073
125 Ga0207676_10070038 3300026095 Bacteria 2811
126 Ga0207676_10334373 3300026095 Bacteria 1395
127 Ga0207676_10359964 3300026095 Bacteria 1348
128 Ga0207674_10334686 3300026116 Bacteria 1464
129 Ga0207674_12254573 3300026116 Unclassified 507
130 Ga0207675_100006756 3300026118 Bacteria 10851
131 Ga0207675_100703845 3300026118 Bacteria 1019
132 Ga0207683_10003574 3300026121 Bacteria 13560
133 Ga0207683_10455040 3300026121 Bacteria 1180
134 Ga0207698_10009275 3300026142 Bacteria 6263
135 Ga0207428_10421281 3300027907 Bacteria 976
136 Ga0268265_10002289 3300028380 Bacteria 14577
137 Ga0268265_10013749 3300028380 Bacteria 5508
138 Ga0268265_10155494 3300028380 Bacteria 1934
139 Ga0268265_10220819 3300028380 Bacteria 1658
140 Ga0268264_10203685 3300028381 Bacteria 1812
141 Ga0307408_100027215 3300031548 Bacteria 3938
142 Ga0307408_100028854 3300031548 Bacteria 3838
143 Ga0307408_100048604 3300031548 Bacteria 3043
144 Ga0307408_100614763 3300031548 Bacteria 967
145 Ga0307405_10012327 3300031731 Bacteria 4518
146 Ga0307405_10016232 3300031731 Bacteria 4054
147 Ga0307405_10023715 3300031731 Bacteria 3492
148 Ga0307405_10032575 3300031731 Bacteria 3082
149 Ga0307405_10168610 3300031731 Bacteria 1559
150 Ga0307405_10265192 3300031731 Bacteria 1285
151 Ga0307405_10489668 3300031731 Bacteria 983
152 Ga0307405_10839778 3300031731 Bacteria 772
153 Ga0307405_11018269 3300031731 Unclassified 707
154 Ga0307405_11300576 3300031731 Unclassified 632
155 Ga0307413_10010691 3300031824 Bacteria 4468
156 Ga0307413_10058204 3300031824 Bacteria 2367
157 Ga0307413_10073604 3300031824 Bacteria 2160
158 Ga0307413_10081794 3300031824 Bacteria 2072
159 Ga0307413_10358440 3300031824 Bacteria 1128
160 Ga0307413_10508316 3300031824 Bacteria 969
161 Ga0307413_10784146 3300031824 Bacteria 799
162 Ga0307410_10014899 3300031852 Bacteria 4593
163 Ga0307410_10018962 3300031852 Bacteria 4172
164 Ga0307410_10026793 3300031852 Bacteria 3633
165 Ga0307410_10033245 3300031852 Bacteria 3328
166 Ga0307410_10033401 3300031852 Bacteria 3321
167 Ga0307410_10039852 3300031852 Bacteria 3087
168 Ga0307410_10040986 3300031852 Bacteria 3051
169 Ga0307410_10049816 3300031852 Bacteria 2813
170 Ga0307410_10207697 3300031852 Bacteria 1499
171 Ga0307406_10027977 3300031901 Bacteria 3402
172 Ga0307406_10040361 3300031901 Bacteria 2901
173 Ga0307406_10136916 3300031901 Bacteria 1727
174 Ga0307406_10143260 3300031901 Bacteria 1695
175 Ga0307406_10198125 3300031901 Bacteria 1476
176 Ga0307406_10205750 3300031901 Bacteria 1452
177 Ga0307406_10833470 3300031901 Bacteria 781
178 Ga0307406_11524686 3300031901 Unclassified 589
179 Ga0307407_10004355 3300031903 Bacteria 5994
180 Ga0307407_10014514 3300031903 Bacteria 3861
181 Ga0307407_10048924 3300031903 Bacteria 2410
182 Ga0307407_10060873 3300031903 Bacteria 2204
183 Ga0307407_10067571 3300031903 Bacteria 2113
184 Ga0307412_10005061 3300031911 Bacteria 7368
185 Ga0307412_10005882 3300031911 Bacteria 6909
186 Ga0307412_10129353 3300031911 Bacteria 1831
187 Ga0307412_10390910 3300031911 Bacteria 1129
188 Ga0307412_10602741 3300031911 Bacteria 930
189 Ga0307409_100020912 3300031995 Bacteria 4473
190 Ga0307409_100030212 3300031995 Bacteria 3890
191 Ga0307409_100033872 3300031995 Bacteria 3723
192 Ga0307409_100052979 3300031995 Bacteria 3115
193 Ga0307409_100082286 3300031995 Bacteria 2606
194 Ga0307409_100687071 3300031995 Bacteria 1021
195 Ga0307409_100718470 3300031995 Bacteria 1000
196 Ga0307409_101034795 3300031995 Bacteria 840
197 Ga0307409_101167833 3300031995 Unclassified 792
198 Ga0307409_101365954 3300031995 Unclassified 734
199 Ga0307409_101424142 3300031995 Unclassified 719
200 Ga0307409_102761160 3300031995 Bacteria 519
201 Ga0307416_100007621 3300032002 Bacteria 6906
202 Ga0307416_100247422 3300032002 Bacteria 1732
203 Ga0307416_100319411 3300032002 Bacteria 1554
204 Ga0307416_100669413 3300032002 Bacteria 1124
205 Ga0307416_101460986 3300032002 Bacteria 789
206 Ga0307416_102138722 3300032002 Unclassified 661
207 Ga0307414_10000550 3300032004 Bacteria 19583
208 Ga0307414_10013256 3300032004 Bacteria 4903
209 Ga0307414_10014440 3300032004 Bacteria 4735
210 Ga0307414_10024892 3300032004 Bacteria 3824
211 Ga0307414_10050595 3300032004 Bacteria 2879
212 Ga0307414_10090861 3300032004 Bacteria 2267
213 Ga0307414_10161378 3300032004 Bacteria 1781
214 Ga0307414_10169369 3300032004 Bacteria 1744
215 Ga0307414_10216851 3300032004 Bacteria 1568
216 Ga0307414_10238751 3300032004 Bacteria 1503
217 Ga0307414_10682480 3300032004 Bacteria 928
218 Ga0307414_11902495 3300032004 Bacteria 555
219 Ga0307411_10005963 3300032005 Bacteria 6054
220 Ga0307411_10014689 3300032005 Bacteria 4367
221 Ga0307411_10020177 3300032005 Bacteria 3869
222 Ga0307411_10023010 3300032005 Bacteria 3681
223 Ga0307411_10026709 3300032005 Bacteria 3480
224 Ga0307411_10038111 3300032005 Bacteria 3029
225 Ga0307411_10094575 3300032005 Bacteria 2095
226 Ga0307411_10125927 3300032005 Bacteria 1863
227 Ga0307411_10130224 3300032005 Bacteria 1837
228 Ga0307411_10199034 3300032005 Bacteria 1537
229 Ga0307411_10392857 3300032005 Bacteria 1144
230 Ga0307415_100029314 3300032126 Bacteria 3515
231 Ga0307415_100059902 3300032126 Bacteria 2628
232 Ga0307415_100084735 3300032126 Bacteria 2275
233 Ga0307415_100102834 3300032126 Bacteria 2100
234 Ga0307415_100179509 3300032126 Bacteria 1659
235 Ga0307415_100317872 3300032126 Bacteria 1297
236 Ga0307415_100392722 3300032126 Bacteria 1182
237 Ga0307415_101400193 3300032126 Bacteria 666
238 Ga0395899_0055045 3300037312 Bacteria 2943
239 Ga0395899_0186038 3300037312 Bacteria 1455
240 Ga0395900_0007965 3300037418 Bacteria 10907
241 Ga0395900_0053158 3300037418 Bacteria 4168
242 Ga0395900_0354620 3300037418 Bacteria 1440
243 Ga0395898_0018562 3300037466 Bacteria 7090
244 Ga0395905_0000732 3300037471 Bacteria 43295
245 Ga0395905_0210293 3300037471 Bacteria 1822
246 Ga0395905_1261106 3300037471 Bacteria 643
247 Ga0395901_0000988 3300038443 Bacteria 30688
248 Ga0395901_0004930 3300038443 Bacteria 13470
249 Ga0439445_0003399 3300042004 Bacteria 3569
250 Ga0439432_168782 3300042006 Bacteria 639
251 Ga0450920_078558 3300042122 Bacteria 675
252 Ga0439446_0236026 3300042156 Unclassified 627
253 Ga0450908_009572 3300042184 Bacteria 1799
254 Ga0439435_0362021 3300042436 Bacteria 505
255 Ga0466957_0717681 3300044842 Bacteria 706
256 Ga0466967_0014419 3300045976 Bacteria 6156
257 Ga0495584_0180484 3300046491 Bacteria 1073
258 Ga0495585_0072137 3300046492 Bacteria 1882
259 Ga0495596_0083799 3300046500 Bacteria 1238
260 Ga0495663_0017659 3300046525 Bacteria 2026
261 Ga0495663_0081377 3300046525 Bacteria 1043
262 Ga0495663_0133313 3300046525 Bacteria 839
263 Ga0495663_0279853 3300046525 Bacteria 597
264 Ga0495642_0014357 3300046528 Bacteria 3068
265 Ga0495642_0089171 3300046528 Bacteria 1304
266 Ga0495598_0006731 3300046537 Bacteria 2606
267 Ga0495598_0255594 3300046537 Bacteria 650
268 Ga0495598_0401872 3300046537 Bacteria 536
269 Ga0495621_0000067 3300046539 Bacteria 20406
270 Ga0495621_0010006 3300046539 Bacteria 2893
271 Ga0495621_0031797 3300046539 Bacteria 1812
272 Ga0495621_0052095 3300046539 Bacteria 1466
273 Ga0495621_0138364 3300046539 Bacteria 951
274 Ga0495633_0098482 3300046558 Bacteria 1358
275 Ga0495633_0125806 3300046558 Bacteria 1186
276 Ga0495656_0388189 3300046615 Bacteria 729
277 Ga0495668_0068033 3300046616 Bacteria 1959
278 Ga0495659_0007852 3300046664 Bacteria 3384
279 Ga0495659_0041457 3300046664 Bacteria 1644
280 Ga0495659_0073644 3300046664 Bacteria 1284
281 Ga0495669_0004828 3300046684 Bacteria 5593
282 Ga0495669_0030748 3300046684 Bacteria 2357
283 Ga0495669_0060358 3300046684 Bacteria 1714
284 Ga0495670_0013921 3300046691 Bacteria 3957
285 Ga0495670_0073280 3300046691 Bacteria 1735
286 Ga0495670_0106335 3300046691 Bacteria 1449
287 Ga0495670_0109654 3300046691 Bacteria 1427
288 Ga0495670_0125220 3300046691 Bacteria 1337
289 Ga0495670_0137815 3300046691 Bacteria 1274
290 Ga0495670_0245121 3300046691 Bacteria 954
291 Ga0495636_0085982 3300047318 Bacteria 1360
292 Ga0495677_0158357 3300047445 Bacteria 873
293 Ga0495677_0440142 3300047445 Bacteria 516
294 Ga0496109_0236684 3300048912 Bacteria 1718
295 Ga0496111_0519920 3300048914 Bacteria 875
296 Ga0501207_016115 3300049654 Bacteria 1157
297 Ga0501223_035387 3300049663 Bacteria 971
298 Ga0501227_057172 3300049665 Bacteria 994
299 Ga0501233_030041 3300049668 Bacteria 1222
300 Ga0501239_003362 3300049672 Bacteria 1517
301 Ga0501259_035460 3300049688 Bacteria 961
302 Ga0501225_0010935 3300049705 Bacteria 2562
303 Ga0501262_097664 3300049759 Bacteria 503
304 Ga0501263_011893 3300049760 Bacteria 1085
305 Ga0501267_032050 3300049764 Bacteria 623
306 Ga0501268_035645 3300049765 Bacteria 919
307 Ga0501272_009503 3300049769 Bacteria 1077
308 Ga0501283_012199 3300049779 Bacteria 1289
309 nmdc:mga06r32_263541_c1 3300050510 Bacteria 1259
310 nmdc:mga0n895_1131633_c1 3300050512 Bacteria 759
311 nmdc:mga0a205_1523340_c1 3300050515 Bacteria 517
312 Ga0501084_0664204 3300054114 Bacteria 880
313 Ga0530510_0992912 3300061734 Bacteria 642
314 Ga0070666_10180292
315 JGI24746J21847_1009502
316 JGI24750J21931_1009064
317 JGI24749J21850_1002000
318 JGI24035J26624_1003212
319 JGI24033J26618_1014829
320 JGI24034J26672_10007834
321 Ga0065712_10154136
322 Ga0065715_10089047
323 Ga0065715_10414634
324 Ga0070658_10004285
325 Ga0070658_10311344
326 Ga0070676_10000501
327 Ga0070670_100001829
328 Ga0070670_100007705
329 Ga0070677_10000374
330 Ga0070677_10394338
331 Ga0068868_100265067
332 Ga0070660_100744717
333 Ga0070660_101479308
334 Ga0070661_100145136
335 Ga0070668_100000800
336 Ga0070668_100511136
337 Ga0070668_101385353
338 Ga0070668_101743682
339 Ga0070669_100000890
340 Ga0070669_100001383
341 Ga0070675_100001581
342 Ga0070671_100001057
343 Ga0070674_100115040
344 Ga0070673_100036630
345 Ga0070659_100023101
346 Ga0070659_101112302
347 Ga0070667_100041572
348 Ga0070667_100218209
349 Ga0070701_10137794
350 Ga0070700_100087027
351 Ga0070663_100005251
352 Ga0070678_100029924
353 Ga0070662_100000287
354 Ga0070681_11888839
355 Ga0068867_100105907
356 Ga0068853_100073785
357 Ga0070672_100004463
358 Ga0070696_100983192
359 Ga0068855_100148420
360 Ga0068855_100753561
361 Ga0070664_101200955
362 Ga0068857_100310357
363 Ga0068854_100057796
364 Ga0068854_100113475
365 Ga0068852_100068940
366 Ga0068859_100041650
367 Ga0068864_100110989
368 Ga0068864_100372299
369 Ga0068866_10250561
370 Ga0068861_100005175
371 Ga0068870_10218974
372 Ga0068860_100224788
373 Ga0068860_100606939
374 Ga0068862_100002942
375 Ga0068862_100062361
376 Ga0068862_100253438
377 Ga0068862_100487450
378 Ga0068862_102138641
379 Ga0075428_101054025
380 Ga0075429_100958701
381 Ga0068865_100593246
382 Ga0097620_100041649
383 Ga0111539_10215141
384 Ga0105243_10084905
385 Ga0105237_12625485
386 Ga0105238_10004914
387 Ga0105249_10014232
388 Ga0105249_10098143
389 Ga0105249_10113198
390 Ga0157370_10546034
391 Ga0157369_10008924
392 Ga0157380_10000319
393 Ga0157380_10001210
394 Ga0157380_10075357
395 Ga0157380_11052610
396 Ga0163161_10255819
397 Ga0207666_1001928
398 Ga0207697_10000459
399 Ga0207682_10000549
400 Ga0207688_10029425
401 Ga0207688_11046574
402 Ga0207680_10135815
403 Ga0207647_10138220
404 Ga0207645_10023825
405 Ga0207643_10121531
406 Ga0207705_10042902
407 Ga0207705_10110139
408 Ga0207657_11198148
409 Ga0207649_11059997
410 Ga0207681_10000414
411 Ga0207681_10937766
412 Ga0207694_10034317
413 Ga0207650_10006161
414 Ga0207650_10133595
415 Ga0207659_10000722
416 Ga0207644_10596063
417 Ga0207690_10226203
418 Ga0207690_10235291
419 Ga0207706_10000411
420 Ga0207669_10066118
421 Ga0207704_11044345
422 Ga0207691_10001043
423 Ga0207691_11560849
424 Ga0207689_10222486
425 Ga0207661_10204252
426 Ga0207712_10027460
427 Ga0207712_10055334
428 Ga0207668_10000205
429 Ga0207668_10067328
430 Ga0207668_10355704
431 Ga0207640_10166234
432 Ga0207640_10555650
433 Ga0207658_10003997
434 Ga0207677_10472159
435 Ga0207678_10005715
436 Ga0207708_10161990
437 Ga0207702_10607563
438 Ga0207676_10070038
439 Ga0207676_10334373
440 Ga0207676_10359964
441 Ga0207674_10334686
442 Ga0207674_12254573
443 Ga0207675_100006756
444 Ga0207675_100703845
445 Ga0207683_10003574
446 Ga0207683_10455040
447 Ga0207698_10009275
448 Ga0207428_10421281
449 Ga0268265_10002289
450 Ga0268265_10013749
451 Ga0268265_10155494
452 Ga0268265_10220819
453 Ga0268264_10203685
454 Ga0307408_100027215
455 Ga0307408_100028854
456 Ga0307408_100048604
457 Ga0307408_100614763
458 Ga0307405_10012327
459 Ga0307405_10016232
460 Ga0307405_10023715
461 Ga0307405_10032575
462 Ga0307405_10168610
463 Ga0307405_10265192
464 Ga0307405_10489668
465 Ga0307405_10839778
466 Ga0307405_11018269
467 Ga0307405_11300576
468 Ga0307413_10010691
469 Ga0307413_10058204
470 Ga0307413_10073604
471 Ga0307413_10081794
472 Ga0307413_10358440
473 Ga0307413_10508316
474 Ga0307413_10784146
475 Ga0307410_10014899
476 Ga0307410_10018962
477 Ga0307410_10026793
478 Ga0307410_10033245
479 Ga0307410_10033401
480 Ga0307410_10039852
481 Ga0307410_10040986
482 Ga0307410_10049816
483 Ga0307410_10207697
484 Ga0307406_10027977
485 Ga0307406_10040361
486 Ga0307406_10136916
487 Ga0307406_10143260
488 Ga0307406_10198125
489 Ga0307406_10205750
490 Ga0307406_10833470
491 Ga0307406_11524686
492 Ga0307407_10004355
493 Ga0307407_10014514
494 Ga0307407_10048924
495 Ga0307407_10060873
496 Ga0307407_10067571
497 Ga0307412_10005061
498 Ga0307412_10005882
499 Ga0307412_10129353
500 Ga0307412_10390910
501 Ga0307412_10602741
502 Ga0307409_100020912
503 Ga0307409_100030212
504 Ga0307409_100033872
505 Ga0307409_100052979
506 Ga0307409_100082286
507 Ga0307409_100687071
508 Ga0307409_100718470
509 Ga0307409_101034795
510 Ga0307409_101167833
511 Ga0307409_101365954
512 Ga0307409_101424142
513 Ga0307409_102761160
514 Ga0307416_100007621
515 Ga0307416_100247422
516 Ga0307416_100319411
517 Ga0307416_100669413
518 Ga0307416_101460986
519 Ga0307416_102138722
520 Ga0307414_10000550
521 Ga0307414_10013256
522 Ga0307414_10014440
523 Ga0307414_10024892
524 Ga0307414_10050595
525 Ga0307414_10090861
526 Ga0307414_10161378
527 Ga0307414_10169369
528 Ga0307414_10216851
529 Ga0307414_10238751
530 Ga0307414_10682480
531 Ga0307414_11902495
532 Ga0307411_10005963
533 Ga0307411_10014689
534 Ga0307411_10020177
535 Ga0307411_10023010
536 Ga0307411_10026709
537 Ga0307411_10038111
538 Ga0307411_10094575
539 Ga0307411_10125927
540 Ga0307411_10130224
541 Ga0307411_10199034
542 Ga0307411_10392857
543 Ga0307415_100029314
544 Ga0307415_100059902
545 Ga0307415_100084735
546 Ga0307415_100102834
547 Ga0307415_100179509
548 Ga0307415_100317872
549 Ga0307415_100392722
550 Ga0307415_101400193
551 Ga0395899_0055045
552 Ga0395899_0186038
553 Ga0395900_0007965
554 Ga0395900_0053158
555 Ga0395900_0354620
556 Ga0395898_0018562
557 Ga0395905_0000732
558 Ga0395905_0210293
559 Ga0395905_1261106
560 Ga0395901_0000988
561 Ga0395901_0004930
562 Ga0439445_0003399
563 Ga0439432_168782
564 Ga0450920_078558
565 Ga0439446_0236026
566 Ga0450908_009572
567 Ga0439435_0362021
568 Ga0466957_0717681
569 Ga0466967_0014419
570 Ga0495584_0180484
571 Ga0495585_0072137
572 Ga0495596_0083799
573 Ga0495663_0017659
574 Ga0495663_0081377
575 Ga0495663_0133313
576 Ga0495663_0279853
577 Ga0495642_0014357
578 Ga0495642_0089171
579 Ga0495598_0006731
580 Ga0495598_0255594
581 Ga0495598_0401872
582 Ga0495621_0000067
583 Ga0495621_0010006
584 Ga0495621_0031797
585 Ga0495621_0052095
586 Ga0495621_0138364
587 Ga0495633_0098482
588 Ga0495633_0125806
589 Ga0495656_0388189
590 Ga0495668_0068033
591 Ga0495659_0007852
592 Ga0495659_0041457
593 Ga0495659_0073644
594 Ga0495669_0004828
595 Ga0495669_0030748
596 Ga0495669_0060358
597 Ga0495670_0013921
598 Ga0495670_0073280
599 Ga0495670_0106335
600 Ga0495670_0109654
601 Ga0495670_0125220
602 Ga0495670_0137815
603 Ga0495670_0245121
604 Ga0495636_0085982
605 Ga0495677_0158357
606 Ga0495677_0440142
607 Ga0496109_0236684
608 Ga0496111_0519920
609 Ga0501207_016115
610 Ga0501223_035387
611 Ga0501227_057172
612 Ga0501233_030041
613 Ga0501239_003362
614 Ga0501259_035460
615 Ga0501225_0010935
616 Ga0501262_097664
617 Ga0501263_011893
618 Ga0501267_032050
619 Ga0501268_035645
620 Ga0501272_009503
621 Ga0501283_012199
622 nmdc:mga06r32_263541_c1
623 nmdc:mga0n895_1131633_c1
624 nmdc:mga0a205_1523340_c1
625 Ga0501084_0664204
626 Ga0530510_0992912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map