F402030

General Info

Members Datasets Scaffolds Average Seq Length
313 190 626 256

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100066595|Ga0068869_1000665953
Length 299
Sequence VDLSPLWSSATCRRFDALDSVYQGCDRSQPTKAVKVTVLQKTMTEKPLGSKTRLLPLVVLVVAIAIWSALWLLRVFPESVFPSPVAVAKGLGEELRTGRLPTDMVASLFRVTTGFMLAVVLGVPAGLWLGHHARSRYALLPAINFFRSLSPLAWIPFAILWFGIGDLPAVFLIFMACFFPVVVSTLAAVASIPSVYFRVAHDYGFKGLDLLTKVILPAIAPQVITSLRVTAGLAWLVVVAAEMIAGRDGLGFAIWDARNGLRMDLLVAGMIVIGVIGMVIDRVLLRLTRIPSVRWGYDG

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 2.56
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100066595 3300005334 Bacteria 2654
2 Ga0065714_10002189 3300005288 Bacteria 128055
3 Ga0065704_10115483 3300005289 Bacteria 1871
4 Ga0065712_10000531 3300005290 Bacteria 10443
5 Ga0065712_10068643 3300005290 Bacteria 9545
6 Ga0065715_10008249 3300005293 Bacteria 2942
7 Ga0065715_10091472 3300005293 Bacteria 5764
8 Ga0065715_10091970 3300005293 Bacteria 5422
9 Ga0065707_10009468 3300005295 Bacteria 3525
10 Ga0065707_10099299 3300005295 Bacteria 3017
11 Ga0065707_10107831 3300005295 Bacteria 2531
12 Ga0070676_10107705 3300005328 Bacteria 1731
13 Ga0070670_100015602 3300005331 Bacteria 6524
14 Ga0070670_100384091 3300005331 Bacteria 1237
15 Ga0068869_100002444 3300005334 Bacteria 11205
16 Ga0070680_100001249 3300005336 Bacteria 18349
17 Ga0070682_100000098 3300005337 Bacteria 78492
18 Ga0070687_100200369 3300005343 Unclassified 1209
19 Ga0070661_100080457 3300005344 Bacteria 2405
20 Ga0070692_10154488 3300005345 Bacteria 1310
21 Ga0070668_100118900 3300005347 Bacteria 2110
22 Ga0070669_100006904 3300005353 Bacteria 8161
23 Ga0070669_100171773 3300005353 Bacteria 1690
24 Ga0070675_100062496 3300005354 Bacteria 3077
25 Ga0070671_100037034 3300005355 Bacteria 4045
26 Ga0070674_100060049 3300005356 Bacteria 2649
27 Ga0070674_100075011 3300005356 Bacteria 2401
28 Ga0070688_100026570 3300005365 Bacteria 3440
29 Ga0070701_10041957 3300005438 Bacteria 2333
30 Ga0070701_10118856 3300005438 Bacteria 1486
31 Ga0070700_100016048 3300005441 Bacteria 4259
32 Ga0070694_100006330 3300005444 Bacteria 7186
33 Ga0070694_100041429 3300005444 Bacteria 3073
34 Ga0070708_100002474 3300005445 Bacteria 14267
35 Ga0070708_100007378 3300005445 Bacteria 8797
36 Ga0070708_100200748 3300005445 Bacteria 1867
37 Ga0070708_100220760 3300005445 Bacteria 1777
38 Ga0070708_100471308 3300005445 Bacteria 1185
39 Ga0070678_100011986 3300005456 Bacteria 5369
40 Ga0070662_100155961 3300005457 Bacteria 1782
41 Ga0070662_100280282 3300005457 Bacteria 1349
42 Ga0070681_10000312 3300005458 Bacteria 39403
43 Ga0068867_100130451 3300005459 Bacteria 1953
44 Ga0070685_10363621 3300005466 Bacteria 992
45 Ga0070706_100002472 3300005467 Bacteria 18629
46 Ga0070706_100030220 3300005467 Bacteria 4991
47 Ga0070707_100000550 3300005468 Bacteria 37566
48 Ga0070707_100000655 3300005468 Bacteria 34484
49 Ga0070707_100172090 3300005468 Bacteria 2110
50 Ga0070707_100451086 3300005468 Bacteria 1247
51 Ga0070698_100002654 3300005471 Bacteria 19722
52 Ga0070698_100005533 3300005471 Bacteria 13803
53 Ga0070698_100006852 3300005471 Bacteria 12344
54 Ga0070698_100018871 3300005471 Bacteria 7256
55 Ga0070698_100069573 3300005471 Bacteria 3533
56 Ga0070698_100176632 3300005471 Bacteria 2075
57 Ga0070699_100001638 3300005518 Bacteria 20417
58 Ga0070699_100051399 3300005518 Bacteria 3567
59 Ga0070699_100102871 3300005518 Unclassified 2505
60 Ga0070699_100215317 3300005518 Bacteria 1711
61 Ga0070679_100000278 3300005530 Bacteria 43146
62 Ga0070679_100026701 3300005530 Bacteria 5677
63 Ga0070684_100320155 3300005535 Bacteria 1425
64 Ga0070697_100001300 3300005536 Bacteria 18815
65 Ga0070697_100011493 3300005536 Bacteria 6921
66 Ga0070697_100043470 3300005536 Bacteria 3638
67 Ga0070697_100660203 3300005536 Bacteria 921
68 Ga0068853_100012169 3300005539 Bacteria 6998
69 Ga0068853_100090631 3300005539 Unclassified 2687
70 Ga0070672_100627667 3300005543 Unclassified 937
71 Ga0070695_100085449 3300005545 Bacteria 2095
72 Ga0070696_100067511 3300005546 Bacteria 2510
73 Ga0070665_100039730 3300005548 Bacteria 4730
74 Ga0070665_100132477 3300005548 Bacteria 2495
75 Ga0070704_100050314 3300005549 Bacteria 2928
76 Ga0070704_100151617 3300005549 Bacteria 1823
77 Ga0070704_100652580 3300005549 Unclassified 929
78 Ga0068855_100009216 3300005563 Bacteria 11922
79 Ga0070664_100000569 3300005564 Bacteria 28150
80 Ga0068857_100002916 3300005577 Bacteria 14097
81 Ga0068854_100019032 3300005578 Bacteria 4620
82 Ga0068854_100359699 3300005578 Unclassified 1194
83 Ga0068856_100467249 3300005614 Unclassified 1282
84 Ga0070702_100016497 3300005615 Bacteria 3791
85 Ga0068852_100002276 3300005616 Bacteria 13190
86 Ga0068859_100074026 3300005617 Bacteria 3445
87 Ga0068859_100082393 3300005617 Unclassified 3260
88 Ga0068859_100116736 3300005617 Bacteria 2733
89 Ga0068864_100021035 3300005618 Bacteria 5463
90 Ga0068864_100024513 3300005618 Bacteria 5076
91 Ga0068861_100163941 3300005719 Bacteria 1836
92 Ga0068870_10258674 3300005840 Bacteria 1082
93 Ga0068863_100014194 3300005841 Bacteria 7673
94 Ga0068863_100307156 3300005841 Bacteria 1539
95 Ga0068858_100077268 3300005842 Bacteria 3092
96 Ga0068860_100166841 3300005843 Unclassified 2126
97 Ga0068860_100485033 3300005843 Bacteria 1232
98 Ga0068862_100041350 3300005844 Bacteria 3921
99 Ga0068862_100074570 3300005844 Unclassified 2933
100 Ga0068862_100199756 3300005844 Bacteria 1802
101 Ga0081539_10005182 3300005985 Bacteria 13540
102 Ga0075368_10020232 3300006042 Bacteria 2518
103 Ga0070716_100104157 3300006173 Bacteria 1746
104 Ga0097621_100016891 3300006237 Bacteria 5531
105 Ga0075430_100078884 3300006846 Bacteria 2760
106 Ga0075431_100059277 3300006847 Bacteria 3951
107 Ga0075431_100170976 3300006847 Bacteria 2233
108 Ga0075433_10009372 3300006852 Bacteria 7823
109 Ga0075433_10093937 3300006852 Bacteria 2654
110 Ga0075434_100092927 3300006871 Unclassified 3019
111 Ga0075434_100131526 3300006871 Unclassified 2522
112 Ga0097620_100074027 3300006931 Bacteria 3445
113 Ga0097620_100082389 3300006931 Unclassified 3260
114 Ga0097620_100116733 3300006931 Bacteria 2733
115 Ga0075435_100273244 3300007076 Bacteria 1442
116 Ga0111539_10029151 3300009094 Bacteria 6728
117 Ga0111539_10195838 3300009094 Bacteria 2357
118 Ga0111539_10952219 3300009094 Bacteria 998
119 Ga0105245_10097279 3300009098 Bacteria 2718
120 Ga0114129_10014168 3300009147 Bacteria 11360
121 Ga0114129_10315613 3300009147 Bacteria 2079
122 Ga0105243_10011076 3300009148 Bacteria 6823
123 Ga0105241_10258953 3300009174 Bacteria 1478
124 Ga0105242_10014690 3300009176 Bacteria 6063
125 Ga0105248_10021433 3300009177 Bacteria 7158
126 Ga0105248_10025725 3300009177 Bacteria 6546
127 Ga0105248_10198281 3300009177 Bacteria 2262
128 Ga0105248_10870730 3300009177 Bacteria 1017
129 Ga0105237_10011487 3300009545 Bacteria 9369
130 Ga0105249_10006924 3300009553 Bacteria 9887
131 Ga0105249_10053215 3300009553 Bacteria 3700
132 Ga0105249_10058714 3300009553 Bacteria 3526
133 Ga0105249_10131036 3300009553 Bacteria 2394
134 Ga0105239_10133973 3300010375 Bacteria 2758
135 Ga0105239_10148633 3300010375 Bacteria 2614
136 Ga0105239_10160134 3300010375 Bacteria 2514
137 Ga0157374_10042243 3300013296 Bacteria 4205
138 Ga0157378_10007192 3300013297 Bacteria 9723
139 Ga0157378_10010409 3300013297 Bacteria 8121
140 Ga0157378_10333646 3300013297 Bacteria 1477
141 Ga0163162_10008328 3300013306 Bacteria 10113
142 Ga0163162_10022482 3300013306 Bacteria 6213
143 Ga0163162_10029402 3300013306 Bacteria 5438
144 Ga0163162_10034973 3300013306 Bacteria 5003
145 Ga0163162_10299003 3300013306 Bacteria 1741
146 Ga0157372_10272879 3300013307 Unclassified 1966
147 Ga0157372_10293171 3300013307 Bacteria 1892
148 Ga0157375_10023746 3300013308 Bacteria 5664
149 Ga0157375_10115540 3300013308 Bacteria 2787
150 Ga0157375_10121000 3300013308 Unclassified 2727
151 Ga0163163_10007367 3300014325 Bacteria 9709
152 Ga0163163_10014227 3300014325 Bacteria 7310
153 Ga0163163_10023353 3300014325 Bacteria 5867
154 Ga0163163_10047270 3300014325 Bacteria 4229
155 Ga0163163_10116331 3300014325 Bacteria 2705
156 Ga0163163_10135953 3300014325 Bacteria 2500
157 Ga0163163_10178902 3300014325 Bacteria 2168
158 Ga0157380_10000620 3300014326 Bacteria 21834
159 Ga0157380_10008249 3300014326 Bacteria 7422
160 Ga0157380_10016213 3300014326 Bacteria 5491
161 Ga0157380_10214674 3300014326 Bacteria 1717
162 Ga0157377_10010643 3300014745 Bacteria 4558
163 Ga0157377_10080611 3300014745 Bacteria 1902
164 Ga0157377_10339851 3300014745 Unclassified 1004
165 Ga0157379_10039592 3300014968 Bacteria 4206
166 Ga0157376_10050285 3300014969 Bacteria 3458
167 Ga0213876_10000438 3300021384 Bacteria 33948
168 Ga0207682_10047871 3300025893 Bacteria 1761
169 Ga0207688_10092102 3300025901 Bacteria 1742
170 Ga0207680_10320431 3300025903 Bacteria 1084
171 Ga0207647_10120439 3300025904 Bacteria 1548
172 Ga0207684_10007409 3300025910 Bacteria 9881
173 Ga0207684_10020793 3300025910 Bacteria 5607
174 Ga0207684_10027242 3300025910 Bacteria 4871
175 Ga0207684_10033451 3300025910 Bacteria 4371
176 Ga0207684_10492872 3300025910 Unclassified 1051
177 Ga0207660_10002899 3300025917 Bacteria 11207
178 Ga0207662_10007236 3300025918 Bacteria 6036
179 Ga0207662_10154833 3300025918 Bacteria 1460
180 Ga0207649_10185796 3300025920 Bacteria 1458
181 Ga0207652_10000189 3300025921 Bacteria 64976
182 Ga0207646_10000380 3300025922 Bacteria 59596
183 Ga0207646_10001296 3300025922 Bacteria 31119
184 Ga0207681_10055372 3300025923 Bacteria 2701
185 Ga0207681_10148243 3300025923 Bacteria 1755
186 Ga0207681_10184145 3300025923 Bacteria 1593
187 Ga0207650_10339387 3300025925 Bacteria 1234
188 Ga0207659_10019483 3300025926 Bacteria 4468
189 Ga0207687_10104906 3300025927 Bacteria 2087
190 Ga0207644_10361462 3300025931 Bacteria 1181
191 Ga0207644_10415449 3300025931 Bacteria 1101
192 Ga0207706_10097637 3300025933 Bacteria 2584
193 Ga0207706_10336442 3300025933 Bacteria 1313
194 Ga0207670_10645081 3300025936 Bacteria 873
195 Ga0207669_10034234 3300025937 Bacteria 2876
196 Ga0207669_10169033 3300025937 Unclassified 1554
197 Ga0207704_10284464 3300025938 Bacteria 1259
198 Ga0207665_10168541 3300025939 Bacteria 1580
199 Ga0207711_10654574 3300025941 Bacteria 980
200 Ga0207689_10003521 3300025942 Bacteria 14303
201 Ga0207689_10006777 3300025942 Bacteria 10081
202 Ga0207689_10197150 3300025942 Bacteria 1662
203 Ga0207689_10337106 3300025942 Bacteria 1252
204 Ga0207679_10016410 3300025945 Bacteria 4919
205 Ga0207667_10032661 3300025949 Bacteria 5605
206 Ga0207712_10134282 3300025961 Bacteria 1890
207 Ga0207712_10147923 3300025961 Bacteria 1811
208 Ga0207677_10152462 3300026023 Bacteria 1785
209 Ga0207677_10180025 3300026023 Bacteria 1662
210 Ga0207639_10012490 3300026041 Bacteria 5916
211 Ga0207708_10009234 3300026075 Bacteria 7299
212 Ga0207708_10032382 3300026075 Bacteria 3970
213 Ga0207702_10018739 3300026078 Bacteria 5725
214 Ga0207702_10405949 3300026078 Bacteria 1315
215 Ga0207641_10107217 3300026088 Bacteria 2471
216 Ga0207641_10108619 3300026088 Bacteria 2456
217 Ga0207648_10276899 3300026089 Bacteria 1500
218 Ga0207648_10496981 3300026089 Bacteria 1116
219 Ga0207676_10007414 3300026095 Bacteria 7780
220 Ga0207676_10016241 3300026095 Bacteria 5391
221 Ga0207676_10017850 3300026095 Bacteria 5148
222 Ga0207676_10341910 3300026095 Bacteria 1381
223 Ga0207674_10001516 3300026116 Bacteria 29946
224 Ga0207675_100010768 3300026118 Bacteria 8570
225 Ga0207675_100116279 3300026118 Unclassified 2528
226 Ga0207675_100250433 3300026118 Bacteria 1714
227 Ga0207683_10021879 3300026121 Bacteria 5484
228 Ga0207698_10005166 3300026142 Bacteria 8025
229 Ga0209998_10014595 3300027717 Bacteria 1640
230 Ga0207428_10113522 3300027907 Bacteria 2082
231 Ga0268266_10293017 3300028379 Unclassified 1516
232 Ga0268265_10028180 3300028380 Bacteria 4019
233 Ga0268265_10541768 3300028380 Unclassified 1103
234 Ga0268264_10198238 3300028381 Unclassified 1835
235 Ga0268264_10226950 3300028381 Bacteria 1722
236 Ga0268264_10356220 3300028381 Bacteria 1394
237 Ga0307513_10453590 3300031456 Bacteria 1006
238 Ga0307408_100222998 3300031548 Bacteria 1539
239 Ga0307409_100047888 3300031995 Bacteria 3249
240 Ga0307411_10193163 3300032005 Bacteria 1556
241 Ga0307415_100154549 3300032126 Bacteria 1770
242 Ga0373937_0081844 3300036401 Bacteria 2987
243 Ga0395900_0267373 3300037418 Bacteria 1706
244 Ga0436364_1199016 3300037853 Unclassified 1531
245 Ga0436365_0838184 3300039437 Bacteria 69697
246 Ga0439439_0065123 3300041406 Bacteria 972
247 Ga0451851_0249656 3300041507 Unclassified 1022
248 Ga0439450_010552 3300042008 Bacteria 1785
249 Ga0450923_038806 3300042125 Bacteria 995
250 Ga0450894_004215 3300042131 Bacteria 1872
251 Ga0450896_000041 3300042133 Bacteria 7706
252 Ga0439464_0098610 3300042439 Bacteria 886
253 Ga0451576_0691523 3300045051 Unclassified 1072
254 Ga0495638_0003545 3300046460 Bacteria 12228
255 Ga0495638_0032079 3300046460 Bacteria 3370
256 Ga0495663_0000121 3300046525 Bacteria 32576
257 Ga0495598_0000110 3300046537 Bacteria 13597
258 Ga0495621_0045883 3300046539 Bacteria 1549
259 Ga0495668_0095820 3300046616 Bacteria 1624
260 Ga0495672_0007969 3300047320 Bacteria 7896
261 Ga0495672_0019487 3300047320 Bacteria 4472
262 Ga0496102_0079339 3300048905 Unclassified 3023
263 Ga0496102_0231287 3300048905 Bacteria 1743
264 Ga0496104_0121096 3300048907 Bacteria 2512
265 Ga0496105_0307154 3300048908 Bacteria 1274
266 Ga0496106_0122194 3300048909 Unclassified 2036
267 Ga0496108_0150416 3300048911 Unclassified 2008
268 Ga0496112_0208596 3300048915 Bacteria 1911
269 Ga0496113_0022579 3300048916 Bacteria 4453
270 Ga0501033_0056426 3300049570 Bacteria 2903
271 Ga0501036_0245195 3300049572 Bacteria 1502
272 Ga0501037_0082845 3300049573 Bacteria 2324
273 Ga0501038_0124010 3300049574 Bacteria 2128
274 Ga0501038_0212320 3300049574 Bacteria 1548
275 Ga0501039_0062750 3300049575 Bacteria 2879
276 Ga0501039_0092142 3300049575 Unclassified 2362
277 Ga0501041_0043910 3300049577 Bacteria 2717
278 Ga0501046_0052496 3300049580 Bacteria 3213
279 Ga0501048_0115519 3300049582 Bacteria 1896
280 Ga0501048_0122995 3300049582 Bacteria 1834
281 Ga0501072_0013439 3300049588 Bacteria 6267
282 Ga0501074_0205252 3300049590 Bacteria 1404
283 Ga0501075_0086515 3300049591 Unclassified 2375
284 Ga0501075_0099779 3300049591 Bacteria 2205
285 Ga0501076_0034756 3300049592 Bacteria 3942
286 Ga0501076_0195240 3300049592 Bacteria 1652
287 Ga0501081_0161598 3300049743 Bacteria 1614
288 Ga0501083_0208617 3300049744 Bacteria 1274
289 Ga0501035_0255484 3300049822 Bacteria 1487
290 nmdc:mga03n38_42817_c1 3300050490 Bacteria 1981
291 nmdc:mga0yw44_10307_c1 3300050492 Bacteria 4767
292 nmdc:mga07m45_177741_c1 3300050496 Bacteria 1237
293 nmdc:mga05p37_155643_c1 3300050507 Bacteria 2077
294 nmdc:mga05p37_46138_c1 3300050507 Bacteria 5358
295 nmdc:mga05p37_754046_c1 3300050507 Unclassified 1072
296 nmdc:mga05p37_98403_c1 3300050507 Unclassified 3603
297 nmdc:mga09592_564487_c1 3300050508 Unclassified 977
298 nmdc:mga0qj67_130160_c1 3300050509 Bacteria 2038
299 nmdc:mga0qj67_59020_c1 3300050509 Bacteria 3042
300 nmdc:mga06r32_266548_c1 3300050510 Bacteria 1700
301 nmdc:mga08y16_239686_c1 3300050511 Bacteria 1875
302 nmdc:mga0n895_198094_c1 3300050512 Bacteria 2040
303 nmdc:mga0rr50_574376_c1 3300050513 Bacteria 960
304 nmdc:mga0a205_338092_c1 3300050515 Bacteria 1374
305 nmdc:mga0a205_433435_c1 3300050515 Bacteria 1176
306 nmdc:mga0a205_71126_c1 3300050515 Unclassified 3360
307 Ga0495595_0091992 3300053084 Bacteria 1456
308 Ga0495619_0263640 3300053085 Bacteria 1194
309 Ga0500616_0005601 3300053153 Bacteria 8478
310 Ga0500611_032660 3300053727 Bacteria 1090
311 Ga0501084_0226145 3300054114 Bacteria 1579
312 Ga0501082_0112795 3300060353 Bacteria 2354
313 Ga0501082_0271414 3300060353 Bacteria 1476
314 Ga0068869_100066595
315 Ga0065714_10002189
316 Ga0065704_10115483
317 Ga0065712_10000531
318 Ga0065712_10068643
319 Ga0065715_10008249
320 Ga0065715_10091472
321 Ga0065715_10091970
322 Ga0065707_10009468
323 Ga0065707_10099299
324 Ga0065707_10107831
325 Ga0070676_10107705
326 Ga0070670_100015602
327 Ga0070670_100384091
328 Ga0068869_100002444
329 Ga0070680_100001249
330 Ga0070682_100000098
331 Ga0070687_100200369
332 Ga0070661_100080457
333 Ga0070692_10154488
334 Ga0070668_100118900
335 Ga0070669_100006904
336 Ga0070669_100171773
337 Ga0070675_100062496
338 Ga0070671_100037034
339 Ga0070674_100060049
340 Ga0070674_100075011
341 Ga0070688_100026570
342 Ga0070701_10041957
343 Ga0070701_10118856
344 Ga0070700_100016048
345 Ga0070694_100006330
346 Ga0070694_100041429
347 Ga0070708_100002474
348 Ga0070708_100007378
349 Ga0070708_100200748
350 Ga0070708_100220760
351 Ga0070708_100471308
352 Ga0070678_100011986
353 Ga0070662_100155961
354 Ga0070662_100280282
355 Ga0070681_10000312
356 Ga0068867_100130451
357 Ga0070685_10363621
358 Ga0070706_100002472
359 Ga0070706_100030220
360 Ga0070707_100000550
361 Ga0070707_100000655
362 Ga0070707_100172090
363 Ga0070707_100451086
364 Ga0070698_100002654
365 Ga0070698_100005533
366 Ga0070698_100006852
367 Ga0070698_100018871
368 Ga0070698_100069573
369 Ga0070698_100176632
370 Ga0070699_100001638
371 Ga0070699_100051399
372 Ga0070699_100102871
373 Ga0070699_100215317
374 Ga0070679_100000278
375 Ga0070679_100026701
376 Ga0070684_100320155
377 Ga0070697_100001300
378 Ga0070697_100011493
379 Ga0070697_100043470
380 Ga0070697_100660203
381 Ga0068853_100012169
382 Ga0068853_100090631
383 Ga0070672_100627667
384 Ga0070695_100085449
385 Ga0070696_100067511
386 Ga0070665_100039730
387 Ga0070665_100132477
388 Ga0070704_100050314
389 Ga0070704_100151617
390 Ga0070704_100652580
391 Ga0068855_100009216
392 Ga0070664_100000569
393 Ga0068857_100002916
394 Ga0068854_100019032
395 Ga0068854_100359699
396 Ga0068856_100467249
397 Ga0070702_100016497
398 Ga0068852_100002276
399 Ga0068859_100074026
400 Ga0068859_100082393
401 Ga0068859_100116736
402 Ga0068864_100021035
403 Ga0068864_100024513
404 Ga0068861_100163941
405 Ga0068870_10258674
406 Ga0068863_100014194
407 Ga0068863_100307156
408 Ga0068858_100077268
409 Ga0068860_100166841
410 Ga0068860_100485033
411 Ga0068862_100041350
412 Ga0068862_100074570
413 Ga0068862_100199756
414 Ga0081539_10005182
415 Ga0075368_10020232
416 Ga0070716_100104157
417 Ga0097621_100016891
418 Ga0075430_100078884
419 Ga0075431_100059277
420 Ga0075431_100170976
421 Ga0075433_10009372
422 Ga0075433_10093937
423 Ga0075434_100092927
424 Ga0075434_100131526
425 Ga0097620_100074027
426 Ga0097620_100082389
427 Ga0097620_100116733
428 Ga0075435_100273244
429 Ga0111539_10029151
430 Ga0111539_10195838
431 Ga0111539_10952219
432 Ga0105245_10097279
433 Ga0114129_10014168
434 Ga0114129_10315613
435 Ga0105243_10011076
436 Ga0105241_10258953
437 Ga0105242_10014690
438 Ga0105248_10021433
439 Ga0105248_10025725
440 Ga0105248_10198281
441 Ga0105248_10870730
442 Ga0105237_10011487
443 Ga0105249_10006924
444 Ga0105249_10053215
445 Ga0105249_10058714
446 Ga0105249_10131036
447 Ga0105239_10133973
448 Ga0105239_10148633
449 Ga0105239_10160134
450 Ga0157374_10042243
451 Ga0157378_10007192
452 Ga0157378_10010409
453 Ga0157378_10333646
454 Ga0163162_10008328
455 Ga0163162_10022482
456 Ga0163162_10029402
457 Ga0163162_10034973
458 Ga0163162_10299003
459 Ga0157372_10272879
460 Ga0157372_10293171
461 Ga0157375_10023746
462 Ga0157375_10115540
463 Ga0157375_10121000
464 Ga0163163_10007367
465 Ga0163163_10014227
466 Ga0163163_10023353
467 Ga0163163_10047270
468 Ga0163163_10116331
469 Ga0163163_10135953
470 Ga0163163_10178902
471 Ga0157380_10000620
472 Ga0157380_10008249
473 Ga0157380_10016213
474 Ga0157380_10214674
475 Ga0157377_10010643
476 Ga0157377_10080611
477 Ga0157377_10339851
478 Ga0157379_10039592
479 Ga0157376_10050285
480 Ga0213876_10000438
481 Ga0207682_10047871
482 Ga0207688_10092102
483 Ga0207680_10320431
484 Ga0207647_10120439
485 Ga0207684_10007409
486 Ga0207684_10020793
487 Ga0207684_10027242
488 Ga0207684_10033451
489 Ga0207684_10492872
490 Ga0207660_10002899
491 Ga0207662_10007236
492 Ga0207662_10154833
493 Ga0207649_10185796
494 Ga0207652_10000189
495 Ga0207646_10000380
496 Ga0207646_10001296
497 Ga0207681_10055372
498 Ga0207681_10148243
499 Ga0207681_10184145
500 Ga0207650_10339387
501 Ga0207659_10019483
502 Ga0207687_10104906
503 Ga0207644_10361462
504 Ga0207644_10415449
505 Ga0207706_10097637
506 Ga0207706_10336442
507 Ga0207670_10645081
508 Ga0207669_10034234
509 Ga0207669_10169033
510 Ga0207704_10284464
511 Ga0207665_10168541
512 Ga0207711_10654574
513 Ga0207689_10003521
514 Ga0207689_10006777
515 Ga0207689_10197150
516 Ga0207689_10337106
517 Ga0207679_10016410
518 Ga0207667_10032661
519 Ga0207712_10134282
520 Ga0207712_10147923
521 Ga0207677_10152462
522 Ga0207677_10180025
523 Ga0207639_10012490
524 Ga0207708_10009234
525 Ga0207708_10032382
526 Ga0207702_10018739
527 Ga0207702_10405949
528 Ga0207641_10107217
529 Ga0207641_10108619
530 Ga0207648_10276899
531 Ga0207648_10496981
532 Ga0207676_10007414
533 Ga0207676_10016241
534 Ga0207676_10017850
535 Ga0207676_10341910
536 Ga0207674_10001516
537 Ga0207675_100010768
538 Ga0207675_100116279
539 Ga0207675_100250433
540 Ga0207683_10021879
541 Ga0207698_10005166
542 Ga0209998_10014595
543 Ga0207428_10113522
544 Ga0268266_10293017
545 Ga0268265_10028180
546 Ga0268265_10541768
547 Ga0268264_10198238
548 Ga0268264_10226950
549 Ga0268264_10356220
550 Ga0307513_10453590
551 Ga0307408_100222998
552 Ga0307409_100047888
553 Ga0307411_10193163
554 Ga0307415_100154549
555 Ga0373937_0081844
556 Ga0395900_0267373
557 Ga0436364_1199016
558 Ga0436365_0838184
559 Ga0439439_0065123
560 Ga0451851_0249656
561 Ga0439450_010552
562 Ga0450923_038806
563 Ga0450894_004215
564 Ga0450896_000041
565 Ga0439464_0098610
566 Ga0451576_0691523
567 Ga0495638_0003545
568 Ga0495638_0032079
569 Ga0495663_0000121
570 Ga0495598_0000110
571 Ga0495621_0045883
572 Ga0495668_0095820
573 Ga0495672_0007969
574 Ga0495672_0019487
575 Ga0496102_0079339
576 Ga0496102_0231287
577 Ga0496104_0121096
578 Ga0496105_0307154
579 Ga0496106_0122194
580 Ga0496108_0150416
581 Ga0496112_0208596
582 Ga0496113_0022579
583 Ga0501033_0056426
584 Ga0501036_0245195
585 Ga0501037_0082845
586 Ga0501038_0124010
587 Ga0501038_0212320
588 Ga0501039_0062750
589 Ga0501039_0092142
590 Ga0501041_0043910
591 Ga0501046_0052496
592 Ga0501048_0115519
593 Ga0501048_0122995
594 Ga0501072_0013439
595 Ga0501074_0205252
596 Ga0501075_0086515
597 Ga0501075_0099779
598 Ga0501076_0034756
599 Ga0501076_0195240
600 Ga0501081_0161598
601 Ga0501083_0208617
602 Ga0501035_0255484
603 nmdc:mga03n38_42817_c1
604 nmdc:mga0yw44_10307_c1
605 nmdc:mga07m45_177741_c1
606 nmdc:mga05p37_155643_c1
607 nmdc:mga05p37_46138_c1
608 nmdc:mga05p37_754046_c1
609 nmdc:mga05p37_98403_c1
610 nmdc:mga09592_564487_c1
611 nmdc:mga0qj67_130160_c1
612 nmdc:mga0qj67_59020_c1
613 nmdc:mga06r32_266548_c1
614 nmdc:mga08y16_239686_c1
615 nmdc:mga0n895_198094_c1
616 nmdc:mga0rr50_574376_c1
617 nmdc:mga0a205_338092_c1
618 nmdc:mga0a205_433435_c1
619 nmdc:mga0a205_71126_c1
620 Ga0495595_0091992
621 Ga0495619_0263640
622 Ga0500616_0005601
623 Ga0500611_032660
624 Ga0501084_0226145
625 Ga0501082_0112795
626 Ga0501082_0271414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

118

292

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.869 58 247
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.8149 58 241
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.807 52 246
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7975 20 245
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7908 49 247
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9552 54 245 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.955 58 247 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9423 58 245 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9384 56 247 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9364 54 245 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4V6BL40-F1-model_v4 ABC transporter permease 0.9612 14 246 GO:0005886
GO:0055085
AF-A0A2T2WQL2-F1-model_v4 Taurine ABC transporter permease 0.961 1 253 GO:0005886
GO:0055085
AF-A0A7C6Q2B6-F1-model_v4 ABC transporter permease 0.9595 14 255 GO:0005886
GO:0055085
AF-A0A4Q9G9V0-F1-model_v4 ABC transporter permease 0.959 13 253 GO:0005886
GO:0010438
GO:0055085
AF-A0A359KQK9-F1-model_v4 1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74) 0.9589 10 246 GO:0005886
GO:0009234
GO:0032194
GO:0042371
GO:0046428
GO:0055085

Map