F402022

General Info

Members Datasets Scaffolds Average Seq Length
313 192 626 260

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100458706|Ga0070683_1004587061
Length 303
Sequence MGDVVRNLHRHVQLDLHREPGAPLDRAQVAAQDNGIPDFIDSHAHLADSAFDGDRDEVIQRARDAGARSIVCIGSGSGGDDPLGSARASAELAARYAGFLFHSAGVHPHDASGFDPSSTIDELSDLIANGAVAIGECGLDYHYDNSPRTDQRRAFAEQLRLARETQKPVIVHTRDAEDDTRAMIKEAASAGIVGVLHCFTGSRALAEDAIDAGWLISFSGIVTFKKWTDDDIVRLVPADRILAESDSPYLAPVPNRGKRNEPAWVSFTVSRLADARGVTVDEMSATVSANATRLFNLASNART

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 2.56
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100458706 3300005329 Bacteria 1216
2 Ga0065712_10071325 3300005290 Bacteria 5338
3 Ga0070658_10007233 3300005327 Bacteria 8961
4 Ga0070658_10128630 3300005327 Bacteria 2109
5 Ga0070658_10624397 3300005327 Bacteria 934
6 Ga0070676_10013227 3300005328 Bacteria 4520
7 Ga0070676_10104907 3300005328 Unclassified 1752
8 Ga0070683_100005493 3300005329 Bacteria 10590
9 Ga0070683_100005784 3300005329 Bacteria 10339
10 Ga0070683_100063199 3300005329 Bacteria 3443
11 Ga0070683_100170449 3300005329 Bacteria 2066
12 Ga0070683_100234719 3300005329 Bacteria 1744
13 Ga0070690_100013610 3300005330 Bacteria 4813
14 Ga0070677_10006833 3300005333 Bacteria 3792
15 Ga0070680_100019344 3300005336 Bacteria 5396
16 Ga0070680_100096790 3300005336 Bacteria 2447
17 Ga0070680_100226504 3300005336 Bacteria 1578
18 Ga0070680_100345169 3300005336 Unclassified 1265
19 Ga0070682_100053235 3300005337 Bacteria 2536
20 Ga0070660_100077730 3300005339 Bacteria 2601
21 Ga0070660_100189921 3300005339 Bacteria 1664
22 Ga0070691_10027234 3300005341 Bacteria 2667
23 Ga0070691_10062557 3300005341 Bacteria 1792
24 Ga0070687_100062951 3300005343 Bacteria 1965
25 Ga0070661_100184314 3300005344 Unclassified 1589
26 Ga0070668_100027822 3300005347 Bacteria 4291
27 Ga0070668_100206733 3300005347 Bacteria 1613
28 Ga0070669_100169842 3300005353 Bacteria 1699
29 Ga0070675_100001278 3300005354 Bacteria 18388
30 Ga0070671_100196238 3300005355 Bacteria 1711
31 Ga0070674_100088978 3300005356 Bacteria 2223
32 Ga0070659_100021768 3300005366 Bacteria 4887
33 Ga0070659_100057632 3300005366 Bacteria 3063
34 Ga0070659_100072390 3300005366 Bacteria 2742
35 Ga0070667_100013705 3300005367 Bacteria 6700
36 Ga0070667_100074934 3300005367 Bacteria 2888
37 Ga0070709_10084027 3300005434 Bacteria 2084
38 Ga0070709_10314919 3300005434 Bacteria 1147
39 Ga0070714_100006983 3300005435 Bacteria 8754
40 Ga0070714_100017881 3300005435 Bacteria 5748
41 Ga0070714_100279974 3300005435 Bacteria 1549
42 Ga0070711_100096811 3300005439 Bacteria 2139
43 Ga0070711_100216923 3300005439 Bacteria 1485
44 Ga0070711_100265285 3300005439 Bacteria 1353
45 Ga0070708_100583929 3300005445 Bacteria 1053
46 Ga0070662_100133873 3300005457 Bacteria 1914
47 Ga0070681_10019695 3300005458 Bacteria 6758
48 Ga0070681_10042181 3300005458 Bacteria 4573
49 Ga0070681_10212954 3300005458 Bacteria 1848
50 Ga0070681_10536450 3300005458 Bacteria 1083
51 Ga0070698_100002088 3300005471 Bacteria 22182
52 Ga0070699_100060734 3300005518 Bacteria 3276
53 Ga0070679_100004074 3300005530 Bacteria 13474
54 Ga0070679_100008634 3300005530 Bacteria 9600
55 Ga0070679_100108504 3300005530 Bacteria 2762
56 Ga0070679_100481174 3300005530 Bacteria 1186
57 Ga0070684_100007534 3300005535 Bacteria 8474
58 Ga0070684_100157357 3300005535 Bacteria 2061
59 Ga0070684_100459885 3300005535 Unclassified 1177
60 Ga0070697_100303138 3300005536 Unclassified 1373
61 Ga0070696_100001496 3300005546 Bacteria 15332
62 Ga0070696_100005995 3300005546 Bacteria 8114
63 Ga0070704_100227776 3300005549 Bacteria 1519
64 Ga0068855_100004766 3300005563 Bacteria 16560
65 Ga0068855_100070652 3300005563 Bacteria 4061
66 Ga0070664_100007200 3300005564 Bacteria 8972
67 Ga0070664_100029234 3300005564 Bacteria 4593
68 Ga0070664_100079446 3300005564 Bacteria 2824
69 Ga0068857_100028545 3300005577 Bacteria 4924
70 Ga0068854_100055584 3300005578 Bacteria 2850
71 Ga0068854_100215260 3300005578 Bacteria 1517
72 Ga0068854_100300124 3300005578 Bacteria 1299
73 Ga0068852_100010557 3300005616 Bacteria 6909
74 Ga0068852_100806411 3300005616 Bacteria 953
75 Ga0068859_100002321 3300005617 Bacteria 19328
76 Ga0068864_100208709 3300005618 Bacteria 1798
77 Ga0068864_100244204 3300005618 Bacteria 1664
78 Ga0068861_100178648 3300005719 Bacteria 1765
79 Ga0068861_100262561 3300005719 Bacteria 1479
80 Ga0068870_10001351 3300005840 Bacteria 9904
81 Ga0068863_100291567 3300005841 Bacteria 1582
82 Ga0068858_100072475 3300005842 Bacteria 3196
83 Ga0068860_100149524 3300005843 Bacteria 2248
84 Ga0070712_100153591 3300006175 Bacteria 1770
85 Ga0075428_101000898 3300006844 Bacteria 885
86 Ga0075430_100096337 3300006846 Bacteria 2473
87 Ga0075431_100218238 3300006847 Bacteria 1946
88 Ga0075434_100517806 3300006871 Bacteria 1213
89 Ga0068865_100008019 3300006881 Bacteria 6520
90 Ga0075436_100010163 3300006914 Bacteria 6444
91 Ga0075436_100041918 3300006914 Bacteria 3157
92 Ga0075436_100065537 3300006914 Bacteria 2510
93 Ga0097620_100002321 3300006931 Bacteria 19328
94 Ga0075435_100079891 3300007076 Unclassified 2684
95 Ga0105240_10009402 3300009093 Bacteria 13842
96 Ga0105240_10031692 3300009093 Bacteria 6851
97 Ga0105240_10065218 3300009093 Bacteria 4521
98 Ga0105240_10151804 3300009093 Bacteria 2758
99 Ga0105240_10193434 3300009093 Bacteria 2390
100 Ga0111539_10011376 3300009094 Bacteria 11171
101 Ga0111539_10236029 3300009094 Bacteria 2129
102 Ga0111539_10432267 3300009094 Bacteria 1533
103 Ga0105245_10171078 3300009098 Bacteria 2069
104 Ga0114129_10021149 3300009147 Bacteria 9239
105 Ga0114129_10733889 3300009147 Bacteria 1266
106 Ga0105241_10171246 3300009174 Bacteria 1794
107 Ga0105248_10020607 3300009177 Bacteria 7307
108 Ga0105248_10400773 3300009177 Bacteria 1545
109 Ga0105248_10531314 3300009177 Bacteria 1326
110 Ga0105237_10003899 3300009545 Bacteria 17497
111 Ga0105238_10101008 3300009551 Bacteria 2867
112 Ga0157373_10013165 3300013100 Bacteria 6071
113 Ga0157373_10057122 3300013100 Bacteria 2769
114 Ga0157373_10143220 3300013100 Bacteria 1681
115 Ga0157373_10180098 3300013100 Bacteria 1488
116 Ga0157370_10005070 3300013104 Bacteria 14859
117 Ga0157370_10049424 3300013104 Bacteria 4025
118 Ga0157370_10353791 3300013104 Bacteria 1354
119 Ga0157370_10397154 3300013104 Bacteria 1269
120 Ga0157369_10010462 3300013105 Bacteria 10568
121 Ga0157369_10066892 3300013105 Bacteria 3865
122 Ga0157369_10118917 3300013105 Bacteria 2804
123 Ga0157369_10244660 3300013105 Bacteria 1873
124 Ga0157369_10326826 3300013105 Bacteria 1594
125 Ga0157369_10486262 3300013105 Bacteria 1277
126 Ga0157374_10016261 3300013296 Bacteria 6538
127 Ga0157378_10020460 3300013297 Bacteria 5818
128 Ga0157378_10022165 3300013297 Bacteria 5590
129 Ga0157378_10373664 3300013297 Bacteria 1398
130 Ga0163162_10159141 3300013306 Bacteria 2380
131 Ga0157372_10007450 3300013307 Bacteria 11640
132 Ga0157372_10019559 3300013307 Bacteria 7298
133 Ga0157372_10025919 3300013307 Bacteria 6377
134 Ga0157372_10047789 3300013307 Bacteria 4756
135 Ga0157372_10089813 3300013307 Bacteria 3491
136 Ga0157372_10141296 3300013307 Bacteria 2774
137 Ga0157372_10152546 3300013307 Bacteria 2667
138 Ga0157372_10648112 3300013307 Bacteria 1230
139 Ga0157375_10008842 3300013308 Bacteria 8820
140 Ga0157375_10022369 3300013308 Bacteria 5819
141 Ga0157375_10070281 3300013308 Bacteria 3510
142 Ga0157377_10041849 3300014745 Bacteria 2543
143 Ga0207682_10185227 3300025893 Unclassified 952
144 Ga0207645_10111135 3300025907 Unclassified 1774
145 Ga0207645_10257500 3300025907 Bacteria 1155
146 Ga0207643_10008040 3300025908 Bacteria 5658
147 Ga0207705_10005249 3300025909 Bacteria 9711
148 Ga0207705_10384145 3300025909 Unclassified 1085
149 Ga0207707_10002165 3300025912 Bacteria 17778
150 Ga0207707_10069860 3300025912 Bacteria 3060
151 Ga0207707_10337785 3300025912 Unclassified 1299
152 Ga0207695_10001890 3300025913 Bacteria 32757
153 Ga0207695_10067409 3300025913 Bacteria 3671
154 Ga0207695_10103173 3300025913 Bacteria 2844
155 Ga0207695_10170055 3300025913 Bacteria 2105
156 Ga0207695_10262139 3300025913 Bacteria 1626
157 Ga0207693_10146665 3300025915 Unclassified 1856
158 Ga0207663_10058290 3300025916 Bacteria 2436
159 Ga0207660_10000538 3300025917 Bacteria 25403
160 Ga0207660_10032895 3300025917 Bacteria 3582
161 Ga0207660_10121278 3300025917 Bacteria 1980
162 Ga0207662_10010231 3300025918 Bacteria 5174
163 Ga0207657_10004466 3300025919 Bacteria 14806
164 Ga0207657_10546612 3300025919 Unclassified 906
165 Ga0207652_10000993 3300025921 Bacteria 26220
166 Ga0207652_10004678 3300025921 Bacteria 11099
167 Ga0207652_10015888 3300025921 Bacteria 6134
168 Ga0207652_10105805 3300025921 Bacteria 2490
169 Ga0207681_10001903 3300025923 Bacteria 13367
170 Ga0207650_10204069 3300025925 Bacteria 1585
171 Ga0207659_10004815 3300025926 Bacteria 8188
172 Ga0207664_10002720 3300025929 Bacteria 11731
173 Ga0207664_10010721 3300025929 Bacteria 6482
174 Ga0207664_10038268 3300025929 Bacteria 3718
175 Ga0207664_10558396 3300025929 Bacteria 1027
176 Ga0207644_10070180 3300025931 Bacteria 2560
177 Ga0207644_10273488 3300025931 Bacteria 1354
178 Ga0207690_10012206 3300025932 Bacteria 5142
179 Ga0207706_10017288 3300025933 Bacteria 6498
180 Ga0207706_10103337 3300025933 Bacteria 2506
181 Ga0207669_10041361 3300025937 Bacteria 2682
182 Ga0207704_10167153 3300025938 Bacteria 1573
183 Ga0207691_10020425 3300025940 Bacteria 6260
184 Ga0207691_10081539 3300025940 Bacteria 2907
185 Ga0207691_10170077 3300025940 Bacteria 1909
186 Ga0207711_10412461 3300025941 Bacteria 1256
187 Ga0207661_10002839 3300025944 Bacteria 11968
188 Ga0207661_10009465 3300025944 Bacteria 6987
189 Ga0207661_10016708 3300025944 Bacteria 5416
190 Ga0207661_10156580 3300025944 Bacteria 1974
191 Ga0207661_10186285 3300025944 Bacteria 1817
192 Ga0207679_10014001 3300025945 Bacteria 5261
193 Ga0207679_10282329 3300025945 Bacteria 1424
194 Ga0207667_10059850 3300025949 Bacteria 3987
195 Ga0207651_10139615 3300025960 Bacteria 1869
196 Ga0207668_10221023 3300025972 Unclassified 1521
197 Ga0207640_10000509 3300025981 Bacteria 23500
198 Ga0207703_10461698 3300026035 Unclassified 1188
199 Ga0207639_10160860 3300026041 Bacteria 1892
200 Ga0207639_10194000 3300026041 Bacteria 1737
201 Ga0207639_10206767 3300026041 Bacteria 1687
202 Ga0207641_10249754 3300026088 Bacteria 1656
203 Ga0207648_10081900 3300026089 Bacteria 2814
204 Ga0207676_10162515 3300026095 Bacteria 1936
205 Ga0207674_10012244 3300026116 Bacteria 9593
206 Ga0207675_100022169 3300026118 Bacteria 5913
207 Ga0207675_100352019 3300026118 Bacteria 1443
208 Ga0207675_100394388 3300026118 Bacteria 1363
209 Ga0207675_100403559 3300026118 Unclassified 1347
210 Ga0207698_10007338 3300026142 Bacteria 6909
211 Ga0207698_10700131 3300026142 Bacteria 1008
212 Ga0207428_10122733 3300027907 Bacteria 1991
213 Ga0265336_10014190 3300028666 Bacteria 2643
214 Ga0265327_10001801 3300031251 Bacteria 25152
215 Ga0307413_10164326 3300031824 Bacteria 1563
216 Ga0307413_10468746 3300031824 Bacteria 1004
217 Ga0307410_10005752 3300031852 Bacteria 6607
218 Ga0307407_10000259 3300031903 Bacteria 15683
219 Ga0307412_10034839 3300031911 Bacteria 3211
220 Ga0307412_10040202 3300031911 Bacteria 3025
221 Ga0307409_100001816 3300031995 Bacteria 10825
222 Ga0307409_100158033 3300031995 Bacteria 1978
223 Ga0307416_100014761 3300032002 Bacteria 5368
224 Ga0307416_100145886 3300032002 Bacteria 2160
225 Ga0307416_100357052 3300032002 Bacteria 1482
226 Ga0307414_10187989 3300032004 Bacteria 1668
227 Ga0307411_10001457 3300032005 Bacteria 9689
228 Ga0307415_100064415 3300032126 Bacteria 2550
229 Ga0307415_100425888 3300032126 Bacteria 1140
230 Ga0373934_0008040 3300035086 Bacteria 3925
231 Ga0373936_0084066 3300035113 Bacteria 1328
232 Ga0373945_0012123 3300035116 Unclassified 2858
233 Ga0373953_0037432 3300035117 Bacteria 1915
234 Ga0373956_0047243 3300035119 Bacteria 1925
235 Ga0373943_0015034 3300035170 Bacteria 3513
236 Ga0373946_0014399 3300035171 Unclassified 2983
237 Ga0316574_0134003 3300035398 Bacteria 1595
238 Ga0373935_0013820 3300035692 Unclassified 4874
239 Ga0373927_0172123 3300035695 Bacteria 1419
240 Ga0373933_0041880 3300035724 Bacteria 2705
241 Ga0373947_0000121 3300035725 Bacteria 39350
242 Ga0373937_0017525 3300036401 Bacteria 6383
243 Ga0373925_0026949 3300037068 Unclassified 4207
244 Ga0400483_129147 3300039062 Bacteria 21671
245 Ga0400483_129544 3300039062 Bacteria 2690
246 Ga0400483_199662 3300039062 Bacteria 12998
247 Ga0400483_230517 3300039062 Bacteria 5217
248 Ga0436365_0205086 3300039437 Bacteria 3642
249 Ga0436360_0711407 3300039438 Bacteria 1662
250 Ga0439436_0049830 3300041404 Bacteria 1186
251 Ga0439439_0022713 3300041406 Bacteria 1569
252 Ga0439449_0149089 3300042007 Bacteria 872
253 Ga0439462_0044541 3300042015 Bacteria 1187
254 Ga0466966_0036923 3300044684 Bacteria 3152
255 Ga0466957_0239396 3300044842 Bacteria 1204
256 Ga0495580_0018166 3300046472 Bacteria 5240
257 Ga0495582_0002127 3300046473 Bacteria 11086
258 Ga0495639_0000207 3300046475 Bacteria 30271
259 Ga0495608_0012609 3300046511 Bacteria 5864
260 Ga0495628_0243560 3300046516 Bacteria 1344
261 Ga0495665_0002202 3300046531 Bacteria 10553
262 Ga0495588_0000662 3300046674 Bacteria 15939
263 Ga0495588_0149783 3300046674 Unclassified 1233
264 Ga0495657_0132933 3300046675 Unclassified 1557
265 Ga0495599_0076158 3300046678 Bacteria 2095
266 Ga0495623_0023873 3300046679 Bacteria 3945
267 Ga0495658_0014524 3300046683 Unclassified 4026
268 Ga0495613_0009576 3300046689 Bacteria 7197
269 Ga0495670_0231121 3300046691 Bacteria 983
270 Ga0495600_0131962 3300046809 Bacteria 1624
271 Ga0495581_0010206 3300047315 Bacteria 5432
272 Ga0495675_0036340 3300047444 Bacteria 3142
273 Ga0495593_0000110 3300047673 Bacteria 38271
274 Ga0495614_0249500 3300048089 Bacteria 811
275 Ga0496101_0303951 3300048904 Bacteria 1250
276 Ga0496104_0119376 3300048907 Bacteria 2532
277 Ga0496106_0248853 3300048909 Bacteria 1421
278 Ga0496112_0036088 3300048915 Bacteria 4820
279 Ga0496112_0059941 3300048915 Bacteria 3750
280 Ga0496112_0089411 3300048915 Bacteria 3048
281 Ga0496112_0158074 3300048915 Bacteria 2233
282 Ga0496114_0323965 3300048917 Bacteria 1362
283 Ga0501032_0002073 3300049569 Bacteria 15825
284 Ga0501034_0087652 3300049571 Bacteria 3112
285 Ga0501037_0000494 3300049573 Bacteria 31857
286 Ga0501040_0418970 3300049576 Bacteria 962
287 Ga0501043_0008036 3300049579 Bacteria 8330
288 Ga0501043_0510751 3300049579 Bacteria 897
289 Ga0501047_0079182 3300049581 Bacteria 3160
290 Ga0501047_0327468 3300049581 Bacteria 1371
291 Ga0501070_0004090 3300049586 Bacteria 12539
292 Ga0501071_0454670 3300049587 Bacteria 980
293 Ga0501071_0548060 3300049587 Bacteria 888
294 Ga0501076_0309416 3300049592 Bacteria 1295
295 Ga0501233_029709 3300049668 Bacteria 1228
296 Ga0501235_001378 3300049669 Bacteria 5153
297 Ga0501250_000974 3300049680 Bacteria 2189
298 Ga0501259_002298 3300049688 Bacteria 3129
299 Ga0501080_0062554 3300049742 Bacteria 3464
300 Ga0501035_0106877 3300049822 Bacteria 2453
301 Ga0501044_0000221 3300049823 Bacteria 71970
302 Ga0501045_0087092 3300049824 Bacteria 2306
303 nmdc:mga0yw44_181722_c1 3300050492 Bacteria 1384
304 nmdc:mga06r32_153369_c1 3300050510 Bacteria 2283
305 nmdc:mga08y16_288588_c1 3300050511 Bacteria 1692
306 nmdc:mga08y16_316564_c1 3300050511 Bacteria 1607
307 nmdc:mga0n895_111106_c1 3300050512 Bacteria 2757
308 nmdc:mga08x19_16695_c1 3300050514 Bacteria 4481
309 nmdc:mga0a205_4013_c1 3300050515 Bacteria 13163
310 Ga0495595_0053721 3300053084 Bacteria 1872
311 Ga0500566_0005107 3300053094 Bacteria 7824
312 Ga0500618_001860 3300053125 Bacteria 8817
313 Ga0466962_0213292 3300061719 Unclassified 945
314 Ga0070683_100458706
315 Ga0065712_10071325
316 Ga0070658_10007233
317 Ga0070658_10128630
318 Ga0070658_10624397
319 Ga0070676_10013227
320 Ga0070676_10104907
321 Ga0070683_100005493
322 Ga0070683_100005784
323 Ga0070683_100063199
324 Ga0070683_100170449
325 Ga0070683_100234719
326 Ga0070690_100013610
327 Ga0070677_10006833
328 Ga0070680_100019344
329 Ga0070680_100096790
330 Ga0070680_100226504
331 Ga0070680_100345169
332 Ga0070682_100053235
333 Ga0070660_100077730
334 Ga0070660_100189921
335 Ga0070691_10027234
336 Ga0070691_10062557
337 Ga0070687_100062951
338 Ga0070661_100184314
339 Ga0070668_100027822
340 Ga0070668_100206733
341 Ga0070669_100169842
342 Ga0070675_100001278
343 Ga0070671_100196238
344 Ga0070674_100088978
345 Ga0070659_100021768
346 Ga0070659_100057632
347 Ga0070659_100072390
348 Ga0070667_100013705
349 Ga0070667_100074934
350 Ga0070709_10084027
351 Ga0070709_10314919
352 Ga0070714_100006983
353 Ga0070714_100017881
354 Ga0070714_100279974
355 Ga0070711_100096811
356 Ga0070711_100216923
357 Ga0070711_100265285
358 Ga0070708_100583929
359 Ga0070662_100133873
360 Ga0070681_10019695
361 Ga0070681_10042181
362 Ga0070681_10212954
363 Ga0070681_10536450
364 Ga0070698_100002088
365 Ga0070699_100060734
366 Ga0070679_100004074
367 Ga0070679_100008634
368 Ga0070679_100108504
369 Ga0070679_100481174
370 Ga0070684_100007534
371 Ga0070684_100157357
372 Ga0070684_100459885
373 Ga0070697_100303138
374 Ga0070696_100001496
375 Ga0070696_100005995
376 Ga0070704_100227776
377 Ga0068855_100004766
378 Ga0068855_100070652
379 Ga0070664_100007200
380 Ga0070664_100029234
381 Ga0070664_100079446
382 Ga0068857_100028545
383 Ga0068854_100055584
384 Ga0068854_100215260
385 Ga0068854_100300124
386 Ga0068852_100010557
387 Ga0068852_100806411
388 Ga0068859_100002321
389 Ga0068864_100208709
390 Ga0068864_100244204
391 Ga0068861_100178648
392 Ga0068861_100262561
393 Ga0068870_10001351
394 Ga0068863_100291567
395 Ga0068858_100072475
396 Ga0068860_100149524
397 Ga0070712_100153591
398 Ga0075428_101000898
399 Ga0075430_100096337
400 Ga0075431_100218238
401 Ga0075434_100517806
402 Ga0068865_100008019
403 Ga0075436_100010163
404 Ga0075436_100041918
405 Ga0075436_100065537
406 Ga0097620_100002321
407 Ga0075435_100079891
408 Ga0105240_10009402
409 Ga0105240_10031692
410 Ga0105240_10065218
411 Ga0105240_10151804
412 Ga0105240_10193434
413 Ga0111539_10011376
414 Ga0111539_10236029
415 Ga0111539_10432267
416 Ga0105245_10171078
417 Ga0114129_10021149
418 Ga0114129_10733889
419 Ga0105241_10171246
420 Ga0105248_10020607
421 Ga0105248_10400773
422 Ga0105248_10531314
423 Ga0105237_10003899
424 Ga0105238_10101008
425 Ga0157373_10013165
426 Ga0157373_10057122
427 Ga0157373_10143220
428 Ga0157373_10180098
429 Ga0157370_10005070
430 Ga0157370_10049424
431 Ga0157370_10353791
432 Ga0157370_10397154
433 Ga0157369_10010462
434 Ga0157369_10066892
435 Ga0157369_10118917
436 Ga0157369_10244660
437 Ga0157369_10326826
438 Ga0157369_10486262
439 Ga0157374_10016261
440 Ga0157378_10020460
441 Ga0157378_10022165
442 Ga0157378_10373664
443 Ga0163162_10159141
444 Ga0157372_10007450
445 Ga0157372_10019559
446 Ga0157372_10025919
447 Ga0157372_10047789
448 Ga0157372_10089813
449 Ga0157372_10141296
450 Ga0157372_10152546
451 Ga0157372_10648112
452 Ga0157375_10008842
453 Ga0157375_10022369
454 Ga0157375_10070281
455 Ga0157377_10041849
456 Ga0207682_10185227
457 Ga0207645_10111135
458 Ga0207645_10257500
459 Ga0207643_10008040
460 Ga0207705_10005249
461 Ga0207705_10384145
462 Ga0207707_10002165
463 Ga0207707_10069860
464 Ga0207707_10337785
465 Ga0207695_10001890
466 Ga0207695_10067409
467 Ga0207695_10103173
468 Ga0207695_10170055
469 Ga0207695_10262139
470 Ga0207693_10146665
471 Ga0207663_10058290
472 Ga0207660_10000538
473 Ga0207660_10032895
474 Ga0207660_10121278
475 Ga0207662_10010231
476 Ga0207657_10004466
477 Ga0207657_10546612
478 Ga0207652_10000993
479 Ga0207652_10004678
480 Ga0207652_10015888
481 Ga0207652_10105805
482 Ga0207681_10001903
483 Ga0207650_10204069
484 Ga0207659_10004815
485 Ga0207664_10002720
486 Ga0207664_10010721
487 Ga0207664_10038268
488 Ga0207664_10558396
489 Ga0207644_10070180
490 Ga0207644_10273488
491 Ga0207690_10012206
492 Ga0207706_10017288
493 Ga0207706_10103337
494 Ga0207669_10041361
495 Ga0207704_10167153
496 Ga0207691_10020425
497 Ga0207691_10081539
498 Ga0207691_10170077
499 Ga0207711_10412461
500 Ga0207661_10002839
501 Ga0207661_10009465
502 Ga0207661_10016708
503 Ga0207661_10156580
504 Ga0207661_10186285
505 Ga0207679_10014001
506 Ga0207679_10282329
507 Ga0207667_10059850
508 Ga0207651_10139615
509 Ga0207668_10221023
510 Ga0207640_10000509
511 Ga0207703_10461698
512 Ga0207639_10160860
513 Ga0207639_10194000
514 Ga0207639_10206767
515 Ga0207641_10249754
516 Ga0207648_10081900
517 Ga0207676_10162515
518 Ga0207674_10012244
519 Ga0207675_100022169
520 Ga0207675_100352019
521 Ga0207675_100394388
522 Ga0207675_100403559
523 Ga0207698_10007338
524 Ga0207698_10700131
525 Ga0207428_10122733
526 Ga0265336_10014190
527 Ga0265327_10001801
528 Ga0307413_10164326
529 Ga0307413_10468746
530 Ga0307410_10005752
531 Ga0307407_10000259
532 Ga0307412_10034839
533 Ga0307412_10040202
534 Ga0307409_100001816
535 Ga0307409_100158033
536 Ga0307416_100014761
537 Ga0307416_100145886
538 Ga0307416_100357052
539 Ga0307414_10187989
540 Ga0307411_10001457
541 Ga0307415_100064415
542 Ga0307415_100425888
543 Ga0373934_0008040
544 Ga0373936_0084066
545 Ga0373945_0012123
546 Ga0373953_0037432
547 Ga0373956_0047243
548 Ga0373943_0015034
549 Ga0373946_0014399
550 Ga0316574_0134003
551 Ga0373935_0013820
552 Ga0373927_0172123
553 Ga0373933_0041880
554 Ga0373947_0000121
555 Ga0373937_0017525
556 Ga0373925_0026949
557 Ga0400483_129147
558 Ga0400483_129544
559 Ga0400483_199662
560 Ga0400483_230517
561 Ga0436365_0205086
562 Ga0436360_0711407
563 Ga0439436_0049830
564 Ga0439439_0022713
565 Ga0439449_0149089
566 Ga0439462_0044541
567 Ga0466966_0036923
568 Ga0466957_0239396
569 Ga0495580_0018166
570 Ga0495582_0002127
571 Ga0495639_0000207
572 Ga0495608_0012609
573 Ga0495628_0243560
574 Ga0495665_0002202
575 Ga0495588_0000662
576 Ga0495588_0149783
577 Ga0495657_0132933
578 Ga0495599_0076158
579 Ga0495623_0023873
580 Ga0495658_0014524
581 Ga0495613_0009576
582 Ga0495670_0231121
583 Ga0495600_0131962
584 Ga0495581_0010206
585 Ga0495675_0036340
586 Ga0495593_0000110
587 Ga0495614_0249500
588 Ga0496101_0303951
589 Ga0496104_0119376
590 Ga0496106_0248853
591 Ga0496112_0036088
592 Ga0496112_0059941
593 Ga0496112_0089411
594 Ga0496112_0158074
595 Ga0496114_0323965
596 Ga0501032_0002073
597 Ga0501034_0087652
598 Ga0501037_0000494
599 Ga0501040_0418970
600 Ga0501043_0008036
601 Ga0501043_0510751
602 Ga0501047_0079182
603 Ga0501047_0327468
604 Ga0501070_0004090
605 Ga0501071_0454670
606 Ga0501071_0548060
607 Ga0501076_0309416
608 Ga0501233_029709
609 Ga0501235_001378
610 Ga0501250_000974
611 Ga0501259_002298
612 Ga0501080_0062554
613 Ga0501035_0106877
614 Ga0501044_0000221
615 Ga0501045_0087092
616 nmdc:mga0yw44_181722_c1
617 nmdc:mga06r32_153369_c1
618 nmdc:mga08y16_288588_c1
619 nmdc:mga08y16_316564_c1
620 nmdc:mga0n895_111106_c1
621 nmdc:mga08x19_16695_c1
622 nmdc:mga0a205_4013_c1
623 Ga0495595_0053721
624 Ga0500566_0005107
625 Ga0500618_001860
626 Ga0466962_0213292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

40

296

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9565 1 256
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9529 1 256
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9492 4 253
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9426 4 256
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9355 2 253
ID Description Score Start End Superfamily
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9488 2 256 3.20.20.140
af_G5EG18_4_286_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9455 1 256 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9426 4 256 3.20.20.140
af_G5EG18_4_286_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.942 1 256 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9416 2 256 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V7SQA0-F1-model_v4 Hydrolase TatD 0.9981 1 256 GO:0004536
GO:0005829
GO:0046872
AF-A0A3D4V8X0-F1-model_v4 TatD family deoxyribonuclease 0.9959 2 256 GO:0004536
GO:0005829
GO:0046872
AF-A0A2V7S300-F1-model_v4 LuxR family transcriptional regulator 0.9957 2 238 GO:0004536
GO:0005829
GO:0046872
AF-A0A7W1A3N6-F1-model_v4 TatD family hydrolase 0.9933 33 256 GO:0004536
GO:0005829
GO:0046872
AF-A0A3D4V8X0-F1-model_v4 TatD family deoxyribonuclease 0.9881 2 256 GO:0004536
GO:0005829
GO:0046872

Map