F401957

General Info

Members Datasets Scaffolds Average Seq Length
312 182 304 234

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939582691|2939585831
Length 278
Sequence VMTAGRVSLSPAVDASTRALALRHVPLADVKPVVRTLRAVRGAIVATAAQVPRRRAITIAVAIVILVAVALLVPLPTAVQLRDWATSVGPWFPLAFLAAHIVITVLPFPRTAFTLAAGLLFGPIVGVTIAVVASAVSAVIALLLVRAAGWHLDRLVKHPRVDTLNTRLAERGWPTVLSMRMIPAVPFSVLNYAAGSSAVRVVPYTLATFAGLLPGTAAVVILGDALTGNVSPLLFLVSVCTACLGIAGLFYEFRTHRRNHNREPESDPEPVSEPVVAP

Samples

Sample ID Description Type Environment
1 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
2 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.01
Nodule 0
Rhizoplane 18.91
Rhizosphere 61.54
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10070522 3300003320 Bacteria 7575
2 Ga0055540_1000036 3300003792 Bacteria 164285
3 Ga0055540_1008357 3300003792 Bacteria 3736
4 Ga0070670_100128778 3300005331 Bacteria 2185
5 Ga0070668_100004631 3300005347 Bacteria 10184
6 Ga0070669_100002566 3300005353 Bacteria 13142
7 Ga0070669_100435927 3300005353 Bacteria 1078
8 Ga0070675_100313469 3300005354 Bacteria 1384
9 Ga0070671_100003588 3300005355 Bacteria 12130
10 Ga0070671_100132841 3300005355 Bacteria 2097
11 Ga0070674_100017167 3300005356 Bacteria 4547
12 Ga0070659_100059942 3300005366 Bacteria 3005
13 Ga0070667_100000082 3300005367 Bacteria 118320
14 Ga0070667_100005464 3300005367 Bacteria 10612
15 Ga0070667_100193328 3300005367 Bacteria 1803
16 Ga0070714_100107706 3300005435 Bacteria 2463
17 Ga0070713_100068207 3300005436 Bacteria 2997
18 Ga0070705_100075477 3300005440 Bacteria 2052
19 Ga0070663_100004363 3300005455 Bacteria 8299
20 Ga0068867_100018541 3300005459 Bacteria 4946
21 Ga0070685_10118489 3300005466 Bacteria 1641
22 Ga0070685_10282671 3300005466 Bacteria 1111
23 Ga0070665_100003904 3300005548 Bacteria 15759
24 Ga0070665_100036049 3300005548 Bacteria 4977
25 Ga0070665_100462211 3300005548 Bacteria 1279
26 Ga0068854_100383385 3300005578 Bacteria 1159
27 Ga0070702_100056063 3300005615 Bacteria 2274
28 Ga0068852_100042953 3300005616 Bacteria 3830
29 Ga0068859_100027390 3300005617 Bacteria 5716
30 Ga0068861_100034257 3300005719 Bacteria 3754
31 Ga0068863_100004304 3300005841 Bacteria 14021
32 Ga0068863_100021305 3300005841 Bacteria 6186
33 Ga0068863_100074720 3300005841 Bacteria 3207
34 Ga0068858_100008035 3300005842 Bacteria 10158
35 Ga0068860_100000011 3300005843 Bacteria 328172
36 Ga0068860_100240903 3300005843 Bacteria 1759
37 Ga0068860_100403549 3300005843 Bacteria 1352
38 Ga0068862_100000012 3300005844 Bacteria 267598
39 Ga0081455_10200526 3300005937 Bacteria 1494
40 Ga0070717_10375151 3300006028 Bacteria 1275
41 Ga0070717_10624592 3300006028 Bacteria 978
42 Ga0075363_100002541 3300006048 Bacteria 7486
43 Ga0075364_10010922 3300006051 Bacteria 5503
44 Ga0075364_10035598 3300006051 Bacteria 3217
45 Ga0075364_10132221 3300006051 Bacteria 1675
46 Ga0070716_100021805 3300006173 Bacteria 3378
47 Ga0075369_10037114 3300006186 Bacteria 2075
48 Ga0075369_10114103 3300006186 Bacteria 1219
49 Ga0075370_10008948 3300006353 Bacteria 5176
50 Ga0075370_10130206 3300006353 Bacteria 1468
51 Ga0075428_100009057 3300006844 Bacteria 11045
52 Ga0075430_100003014 3300006846 Bacteria 14092
53 Ga0075431_100067318 3300006847 Bacteria 3697
54 Ga0097620_100027390 3300006931 Bacteria 5716
55 Ga0105250_10086200 3300009092 Bacteria 1275
56 Ga0111539_11189303 3300009094 Bacteria 886
57 Ga0105245_10112640 3300009098 Bacteria 2532
58 Ga0105245_10336621 3300009098 Bacteria 1491
59 Ga0105245_10380914 3300009098 Bacteria 1405
60 Ga0105247_10000007 3300009101 Bacteria 409490
61 Ga0105247_10013640 3300009101 Bacteria 4873
62 Ga0114129_10022243 3300009147 Bacteria 9001
63 Ga0114129_10333503 3300009147 Bacteria 2013
64 Ga0105243_10008644 3300009148 Bacteria 7812
65 Ga0105243_10441627 3300009148 Bacteria 1218
66 Ga0105242_10002910 3300009176 Bacteria 13388
67 Ga0105242_10230473 3300009176 Bacteria 1660
68 Ga0105242_10238158 3300009176 Bacteria 1635
69 Ga0105248_10000114 3300009177 Bacteria 90862
70 Ga0105248_10024195 3300009177 Bacteria 6750
71 Ga0105248_10180806 3300009177 Bacteria 2377
72 Ga0105237_10022502 3300009545 Bacteria 6466
73 Ga0105237_10123676 3300009545 Bacteria 2581
74 Ga0105249_10000001 3300009553 Bacteria 504948
75 Ga0105249_10007373 3300009553 Bacteria 9592
76 Ga0105249_10058315 3300009553 Bacteria 3539
77 Ga0105239_10414579 3300010375 Bacteria 1525
78 Ga0157374_10022545 3300013296 Bacteria 5618
79 Ga0157378_10048936 3300013297 Bacteria 3760
80 Ga0163162_10113707 3300013306 Bacteria 2806
81 Ga0163162_10128207 3300013306 Bacteria 2645
82 Ga0163162_10842098 3300013306 Bacteria 1033
83 Ga0157375_10002286 3300013308 Bacteria 16565
84 Ga0157375_10151125 3300013308 Bacteria 2458
85 Ga0157375_10323038 3300013308 Bacteria 1708
86 Ga0157375_10909512 3300013308 Bacteria 1023
87 Ga0163163_10026718 3300014325 Bacteria 5521
88 Ga0163163_10068418 3300014325 Bacteria 3533
89 Ga0157380_10153203 3300014326 Bacteria 1995
90 Ga0157377_10003499 3300014745 Bacteria 7109
91 Ga0157379_10015568 3300014968 Bacteria 6677
92 Ga0157379_10035879 3300014968 Bacteria 4422
93 Ga0163161_10084055 3300017792 Bacteria 2347
94 Ga0213876_10000482 3300021384 Bacteria 31554
95 Ga0209051_1000021 3300025303 Bacteria 507633
96 Ga0209051_1001289 3300025303 Bacteria 22159
97 Ga0209051_1011525 3300025303 Bacteria 4357
98 Ga0207696_1072413 3300025711 Bacteria 957
99 Ga0207710_10000013 3300025900 Bacteria 409402
100 Ga0207710_10006088 3300025900 Bacteria 5167
101 Ga0207671_10229929 3300025914 Bacteria 1455
102 Ga0207681_10007174 3300025923 Bacteria 6837
103 Ga0207700_10075544 3300025928 Bacteria 2611
104 Ga0207664_10063719 3300025929 Bacteria 2947
105 Ga0207664_10524273 3300025929 Bacteria 1062
106 Ga0207644_10018290 3300025931 Bacteria 4738
107 Ga0207644_10078678 3300025931 Bacteria 2431
108 Ga0207706_10031998 3300025933 Bacteria 4686
109 Ga0207686_10011595 3300025934 Bacteria 4830
110 Ga0207686_10188337 3300025934 Bacteria 1469
111 Ga0207709_10150966 3300025935 Bacteria 1609
112 Ga0207669_10007813 3300025937 Bacteria 4979
113 Ga0207711_10000327 3300025941 Bacteria 50683
114 Ga0207711_10131956 3300025941 Bacteria 2241
115 Ga0207661_10262088 3300025944 Bacteria 1540
116 Ga0207712_10000006 3300025961 Bacteria 573204
117 Ga0207712_10008460 3300025961 Bacteria 6504
118 Ga0207712_10018404 3300025961 Bacteria 4550
119 Ga0207668_10043685 3300025972 Bacteria 3043
120 Ga0207668_10119669 3300025972 Bacteria 1992
121 Ga0207658_10000140 3300025986 Bacteria 76436
122 Ga0207658_10003803 3300025986 Bacteria 10631
123 Ga0207658_10096822 3300025986 Bacteria 2302
124 Ga0207677_10009179 3300026023 Bacteria 5554
125 Ga0207703_10021251 3300026035 Bacteria 5081
126 Ga0207703_10482207 3300026035 Bacteria 1162
127 Ga0207678_10016783 3300026067 Bacteria 6430
128 Ga0207641_10015710 3300026088 Bacteria 6202
129 Ga0207641_10102525 3300026088 Bacteria 2523
130 Ga0207675_100355463 3300026118 Bacteria 1436
131 Ga0207683_10060762 3300026121 Bacteria 3323
132 Ga0207683_10296783 3300026121 Bacteria 1478
133 Ga0268266_10008678 3300028379 Bacteria 9018
134 Ga0268266_10038623 3300028379 Bacteria 4064
135 Ga0268266_10562573 3300028379 Bacteria 1093
136 Ga0268265_10000016 3300028380 Bacteria 299380
137 Ga0268264_10000026 3300028381 Bacteria 459088
138 Ga0265327_10000081 3300031251 Bacteria 205988
139 Ga0265327_10001624 3300031251 Bacteria 27161
140 Ga0265327_10051697 3300031251 Bacteria 2143
141 Ga0307406_10023302 3300031901 Bacteria 3682
142 Ga0373931_0007637 3300035691 Bacteria 5099
143 Ga0316584_0253364 3300036712 Bacteria 1285
144 Ga0436365_0243891 3300039437 Bacteria 26248
145 Ga0436365_0564838 3300039437 Bacteria 13238
146 Ga0436365_1318799 3300039437 Bacteria 31110
147 Ga0436363_1421662 3300039450 Bacteria 3901
148 Ga0439445_0019510 3300042004 Bacteria 1690
149 Ga0439434_0003612 3300042435 Bacteria 4521
150 Ga0466972_0031103 3300044658 Bacteria 2626
151 Ga0466972_0056046 3300044658 Bacteria 1895
152 Ga0466965_0004743 3300044683 Bacteria 6059
153 Ga0466965_0039187 3300044683 Bacteria 2329
154 Ga0466965_0047554 3300044683 Bacteria 2125
155 Ga0466966_0018474 3300044684 Bacteria 4597
156 Ga0466961_0006753 3300044693 Bacteria 7302
157 Ga0466963_0039097 3300044694 Bacteria 3106
158 Ga0466963_0298418 3300044694 Bacteria 1133
159 Ga0466971_0027942 3300044719 Bacteria 2526
160 Ga0466968_0071201 3300044735 Bacteria 1514
161 Ga0466968_0073516 3300044735 Bacteria 1492
162 Ga0466968_0100037 3300044735 Bacteria 1293
163 Ga0466970_0082233 3300044765 Bacteria 1742
164 Ga0466957_0016353 3300044842 Bacteria 4340
165 Ga0466957_0091988 3300044842 Bacteria 1902
166 Ga0466960_0000659 3300044901 Bacteria 11980
167 Ga0466960_0016639 3300044901 Bacteria 3194
168 Ga0466959_0000906 3300045049 Bacteria 17518
169 Ga0466958_0001115 3300045836 Bacteria 12379
170 Ga0466958_0009251 3300045836 Bacteria 5485
171 Ga0466958_0089304 3300045836 Bacteria 1905
172 Ga0466967_0031464 3300045976 Bacteria 4466
173 Ga0466967_0115839 3300045976 Bacteria 2468
174 Ga0466967_0297389 3300045976 Bacteria 1552
175 Ga0466967_0433015 3300045976 Bacteria 1283
176 Ga0495603_0040966 3300046455 Bacteria 2771
177 Ga0495629_0085659 3300046459 Bacteria 2198
178 Ga0495638_0012805 3300046460 Bacteria 5730
179 Ga0495582_0048774 3300046473 Bacteria 2332
180 Ga0495630_0393719 3300046517 Bacteria 1061
181 Ga0495634_0281320 3300046642 Bacteria 1010
182 Ga0495647_0086493 3300046681 Bacteria 1279
183 Ga0495658_0037145 3300046683 Bacteria 2691
184 Ga0495624_0058514 3300046690 Bacteria 2420
185 Ga0495649_0128163 3300046694 Bacteria 1340
186 Ga0495674_0116825 3300047319 Bacteria 2257
187 Ga0495686_0055153 3300047472 Bacteria 2487
188 Ga0495593_0003642 3300047673 Bacteria 9203
189 Ga0495614_0088370 3300048089 Bacteria 1347
190 Ga0495626_0052034 3300048091 Bacteria 1888
191 Ga0496100_0000011 3300048903 Bacteria 190969
192 Ga0496100_0000154 3300048903 Bacteria 38218
193 Ga0496100_0004825 3300048903 Bacteria 7202
194 Ga0496100_0094715 3300048903 Bacteria 2045
195 Ga0496101_0000017 3300048904 Bacteria 239153
196 Ga0496101_0000184 3300048904 Bacteria 49703
197 Ga0496101_0032830 3300048904 Bacteria 3657
198 Ga0496101_0036925 3300048904 Bacteria 3463
199 Ga0496101_0042873 3300048904 Bacteria 3231
200 Ga0496101_0109806 3300048904 Bacteria 2075
201 Ga0496101_0182979 3300048904 Bacteria 1614
202 Ga0496102_0000124 3300048905 Bacteria 110030
203 Ga0496102_0062266 3300048905 Bacteria 3416
204 Ga0496102_0159110 3300048905 Bacteria 2124
205 Ga0496103_0000981 3300048906 Bacteria 20163
206 Ga0496103_0001690 3300048906 Bacteria 14432
207 Ga0496103_0007644 3300048906 Bacteria 6429
208 Ga0496104_0030541 3300048907 Bacteria 5008
209 Ga0496104_0050052 3300048907 Bacteria 3942
210 Ga0496104_0102740 3300048907 Bacteria 2738
211 Ga0496104_0398897 3300048907 Bacteria 1288
212 Ga0496105_0102511 3300048908 Bacteria 2363
213 Ga0496106_0002366 3300048909 Bacteria 14034
214 Ga0496106_0009098 3300048909 Bacteria 7339
215 Ga0496106_0053079 3300048909 Bacteria 3060
216 Ga0496106_0093917 3300048909 Bacteria 2318
217 Ga0496106_0272632 3300048909 Bacteria 1355
218 Ga0496107_0002125 3300048910 Bacteria 12702
219 Ga0496107_0002170 3300048910 Bacteria 12606
220 Ga0496107_0003846 3300048910 Bacteria 10084
221 Ga0496107_0042529 3300048910 Bacteria 3263
222 Ga0496107_0056867 3300048910 Bacteria 2827
223 Ga0496108_0002989 3300048911 Bacteria 13582
224 Ga0496108_0003435 3300048911 Bacteria 12702
225 Ga0496108_0026459 3300048911 Bacteria 4784
226 Ga0496108_0048173 3300048911 Bacteria 3563
227 Ga0496108_0079873 3300048911 Bacteria 2770
228 Ga0496109_0000179 3300048912 Bacteria 62857
229 Ga0496109_0000883 3300048912 Bacteria 25040
230 Ga0496109_0005555 3300048912 Bacteria 10555
231 Ga0496109_0063943 3300048912 Bacteria 3366
232 Ga0496110_0003036 3300048913 Bacteria 12734
233 Ga0496110_0013171 3300048913 Bacteria 6829
234 Ga0496110_0064224 3300048913 Bacteria 3244
235 Ga0496110_0373475 3300048913 Bacteria 1299
236 Ga0496112_0003265 3300048915 Bacteria 13385
237 Ga0496112_0004789 3300048915 Bacteria 11545
238 Ga0496112_0017299 3300048915 Bacteria 6770
239 Ga0496112_0059663 3300048915 Bacteria 3760
240 Ga0496112_0158714 3300048915 Bacteria 2228
241 Ga0496113_0011220 3300048916 Bacteria 5967
242 Ga0496113_0041039 3300048916 Bacteria 3412
243 Ga0496113_0042037 3300048916 Bacteria 3375
244 Ga0496114_0004263 3300048917 Bacteria 11068
245 Ga0496114_0008620 3300048917 Bacteria 8082
246 Ga0496114_0061020 3300048917 Bacteria 3153
247 Ga0496115_0001737 3300048918 Bacteria 15625
248 Ga0496115_0026818 3300048918 Bacteria 4501
249 Ga0496115_0099398 3300048918 Bacteria 2384
250 Ga0496116_0011148 3300048919 Bacteria 7470
251 Ga0496116_0013114 3300048919 Bacteria 6713
252 Ga0496117_0000401 3300048920 Bacteria 73619
253 Ga0496117_0068898 3300048920 Bacteria 2385
254 Ga0496118_0002281 3300048921 Bacteria 26176
255 Ga0496118_0002742 3300048921 Bacteria 23180
256 Ga0496118_0120170 3300048921 Bacteria 1715
257 Ga0496119_0006519 3300048922 Bacteria 10772
258 Ga0496119_0008351 3300048922 Bacteria 9122
259 Ga0496120_0005957 3300048923 Bacteria 9499
260 Ga0496120_0105767 3300048923 Bacteria 1479
261 Ga0496121_0000014 3300048924 Bacteria 609379
262 Ga0496121_0022893 3300048924 Bacteria 6038
263 Ga0496122_0000084 3300048925 Bacteria 208740
264 Ga0496123_0017478 3300048926 Bacteria 5766
265 Ga0496124_0000019 3300048927 Bacteria 436995
266 Ga0496125_0000014 3300048928 Bacteria 610124
267 Ga0496125_0077586 3300048928 Bacteria 2560
268 Ga0496125_0106700 3300048928 Bacteria 2043
269 Ga0496125_0179324 3300048928 Bacteria 1414
270 Ga0496126_0000017 3300048929 Bacteria 610676
271 Ga0496126_0003717 3300048929 Bacteria 19024
272 Ga0496126_0078826 3300048929 Bacteria 2917
273 Ga0501032_0018538 3300049569 Bacteria 4874
274 Ga0501033_0107213 3300049570 Bacteria 2035
275 Ga0501034_0373797 3300049571 Bacteria 1351
276 Ga0501036_0204154 3300049572 Bacteria 1662
277 Ga0501037_0014139 3300049573 Bacteria 5878
278 Ga0501043_0186606 3300049579 Bacteria 1614
279 Ga0501043_0428178 3300049579 Bacteria 997
280 Ga0501046_0008973 3300049580 Bacteria 8682
281 Ga0501047_0030503 3300049581 Bacteria 5197
282 Ga0501048_0012406 3300049582 Bacteria 6339
283 Ga0501069_0028280 3300049585 Bacteria 3074
284 Ga0501070_0064487 3300049586 Bacteria 3033
285 Ga0501080_0156720 3300049742 Bacteria 2103
286 Ga0501035_0240067 3300049822 Bacteria 1541
287 Ga0501044_0004957 3300049823 Bacteria 14888
288 Ga0501044_0008915 3300049823 Bacteria 10965
289 nmdc:mga00v17_7351_c1 3300050491 Bacteria 5871
290 nmdc:mga0yw44_29378_c1 3300050492 Bacteria 3173
291 nmdc:mga07m45_6872_c2 3300050496 Bacteria 1468
292 nmdc:mga07m45_92737_c1 3300050496 Bacteria 1731
293 nmdc:mga05p37_44599_c1 3300050507 Bacteria 5126
294 nmdc:mga0qj67_95786_c1 3300050509 Bacteria 2389
295 nmdc:mga06r32_56173_c1 3300050510 Bacteria 3778
296 nmdc:mga0sz30_26490_c1 3300050516 Bacteria 2376
297 nmdc:mga0sz30_3388_c1 3300050516 Bacteria 5734
298 Ga0500556_0025849 3300053104 Bacteria 1944
299 Ga0500642_0146501 3300053130 Bacteria 1108
300 Ga0500577_0136375 3300053142 Bacteria 1032
301 Ga0500604_0045391 3300053151 Bacteria 1341
302 Ga0500616_0057681 3300053153 Bacteria 2023
303 Ga0500627_0001471 3300053158 Bacteria 6594
304 Ga0466962_0033197 3300061719 Bacteria 2469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0017478 Ga0496123_0017478_5183_5752 178
2 3300047472 Ga0495686_0055153 Ga0495686_0055153_17_673 185
3 3300005841 Ga0068863_100021305 Ga0068863_1000213053 186
4 3300026088 Ga0207641_10015710 Ga0207641_100157103 186
5 3300005353 Ga0070669_100002566 Ga0070669_1000025662 187
6 3300005367 Ga0070667_100000082 Ga0070667_10000008237 187
7 3300005548 Ga0070665_100003904 Ga0070665_1000039045 187
8 3300005617 Ga0068859_100027390 Ga0068859_1000273906 187
9 3300005842 Ga0068858_100008035 Ga0068858_1000080356 187
10 3300005843 Ga0068860_100000011 Ga0068860_100000011263 187
11 3300005844 Ga0068862_100000012 Ga0068862_100000012155 187
12 3300006931 Ga0097620_100027390 Ga0097620_1000273906 187
13 3300009101 Ga0105247_10000007 Ga0105247_10000007181 187
14 3300009177 Ga0105248_10000114 Ga0105248_1000011414 187
15 3300013306 Ga0163162_10113707 Ga0163162_101137072 187
16 3300014325 Ga0163163_10026718 Ga0163163_100267184 187
17 3300014968 Ga0157379_10015568 Ga0157379_100155682 187
18 3300025900 Ga0207710_10000013 Ga0207710_10000013181 187
19 3300025923 Ga0207681_10007174 Ga0207681_100071745 187
20 3300025941 Ga0207711_10000327 Ga0207711_1000032730 187
21 3300025986 Ga0207658_10000140 Ga0207658_1000014010 187
22 3300026035 Ga0207703_10021251 Ga0207703_100212513 187
23 3300028379 Ga0268266_10008678 Ga0268266_100086788 187
24 3300028380 Ga0268265_10000016 Ga0268265_10000016180 187
25 3300028381 Ga0268264_10000026 Ga0268264_10000026183 187
26 3300048903 Ga0496100_0094715 Ga0496100_0094715_823_1680 187
27 3300048904 Ga0496101_0042873 Ga0496101_0042873_1295_2152 187
28 3300048905 Ga0496102_0000124 Ga0496102_0000124_4959_5816 187
29 3300048906 Ga0496103_0001690 Ga0496103_0001690_3439_4296 187
30 3300048910 Ga0496107_0042529 Ga0496107_0042529_321_1178 187
31 3300048919 Ga0496116_0013114 Ga0496116_0013114_909_1766 187
32 3300048920 Ga0496117_0000401 Ga0496117_0000401_31797_32654 187
33 3300048921 Ga0496118_0002281 Ga0496118_0002281_19020_19877 187
34 3300048922 Ga0496119_0008351 Ga0496119_0008351_4598_5455 187
35 3300048923 Ga0496120_0005957 Ga0496120_0005957_4566_5423 187
36 3300048924 Ga0496121_0022893 Ga0496121_0022893_4087_4944 187
37 3300048928 Ga0496125_0106700 Ga0496125_0106700_969_1826 187
38 3300048929 Ga0496126_0078826 Ga0496126_0078826_519_1376 187
39 3300005367 Ga0070667_100005464 Ga0070667_1000054643 191
40 3300044694 Ga0466963_0039097 Ga0466963_0039097_121_888 192
41 3300045976 Ga0466967_0031464 Ga0466967_0031464_643_1410 192
42 3300045976 Ga0466967_0433015 Ga0466967_0433015_31_798 192
43 3300049573 Ga0501037_0014139 Ga0501037_0014139_4040_4804 195
44 3300049579 Ga0501043_0428178 Ga0501043_0428178_154_918 195
45 3300049580 Ga0501046_0008973 Ga0501046_0008973_2343_3107 195
46 3300049581 Ga0501047_0030503 Ga0501047_0030503_1921_2685 195
47 3300049582 Ga0501048_0012406 Ga0501048_0012406_128_892 195
48 3300049586 Ga0501070_0064487 Ga0501070_0064487_177_941 195
49 3300049742 Ga0501080_0156720 Ga0501080_0156720_1046_1810 195
50 3300049822 Ga0501035_0240067 Ga0501035_0240067_727_1491 195
51 3300049823 Ga0501044_0004957 Ga0501044_0004957_1696_2460 195
52 3300009553 Ga0105249_10000001 Ga0105249_10000001306 196
53 3300025961 Ga0207712_10000006 Ga0207712_10000006186 196
54 3300025944 Ga0207661_10262088 Ga0207661_102620882 199
55 3300049570 Ga0501033_0107213 Ga0501033_0107213_102_869 206
56 3300049572 Ga0501036_0204154 Ga0501036_0204154_17_784 206
57 3300049585 Ga0501069_0028280 Ga0501069_0028280_1569_2336 206
58 3300006844 Ga0075428_100009057 Ga0075428_1000090574 210
59 3300006846 Ga0075430_100003014 Ga0075430_10000301416 210
60 3300006847 Ga0075431_100067318 Ga0075431_1000673184 210
61 3300005347 Ga0070668_100004631 Ga0070668_1000046315 211
62 3300025972 Ga0207668_10043685 Ga0207668_100436851 211
63 3300039450 Ga0436363_1421662 Ga0436363_1421662_2852_3601 211
64 3300048929 Ga0496126_0003717 Ga0496126_0003717_2306_3142 211
65 3300053158 Ga0500627_0001471 Ga0500627_0001471_4613_5380 211
66 3300003792 Ga0055540_1000036 Ga0055540_100003682 212
67 3300005937 Ga0081455_10200526 Ga0081455_102005262 212
68 3300025303 Ga0209051_1000021 Ga0209051_1000021431 212
69 3300049823 Ga0501044_0008915 Ga0501044_0008915_1659_2465 212
70 3300009147 Ga0114129_10022243 Ga0114129_100222438 213
71 3300025986 Ga0207658_10003803 Ga0207658_1000380310 213
72 3300044694 Ga0466963_0298418 Ga0466963_0298418_95_877 213
73 3300044842 Ga0466957_0091988 Ga0466957_0091988_433_1215 213
74 3300048091 Ga0495626_0052034 Ga0495626_0052034_838_1623 213
75 3300050507 nmdc:mga05p37_44599_c1 nmdc:mga05p37_44599_c1_2309_3064 213
76 3300050509 nmdc:mga0qj67_95786_c1 nmdc:mga0qj67_95786_c1_113_868 213
77 3300050510 nmdc:mga06r32_56173_c1 nmdc:mga06r32_56173_c1_2207_2962 213
78 3300025914 Ga0207671_10229929 Ga0207671_102299292 214
79 3300044683 Ga0466965_0004743 Ga0466965_0004743_1212_2057 214
80 3300044901 Ga0466960_0000659 Ga0466960_0000659_2967_3812 214
81 3300049569 Ga0501032_0018538 Ga0501032_0018538_414_1181 214
82 3300049579 Ga0501043_0186606 Ga0501043_0186606_330_1043 214
83 3300005355 Ga0070671_100132841 Ga0070671_1001328412 215
84 3300005841 Ga0068863_100074720 Ga0068863_1000747202 215
85 3300009553 Ga0105249_10058315 Ga0105249_100583152 215
86 3300014325 Ga0163163_10068418 Ga0163163_100684182 215
87 3300025931 Ga0207644_10078678 Ga0207644_100786782 215
88 3300025961 Ga0207712_10008460 Ga0207712_100084602 215
89 3300025986 Ga0207658_10096822 Ga0207658_100968221 215
90 3300026088 Ga0207641_10102525 Ga0207641_101025251 215
91 3300031251 Ga0265327_10001624 Ga0265327_100016247 215
92 3300044683 Ga0466965_0039187 Ga0466965_0039187_231_962 215
93 3300045976 Ga0466967_0297389 Ga0466967_0297389_156_887 215
94 3300048904 Ga0496101_0036925 Ga0496101_0036925_2602_3348 215
95 3300048907 Ga0496104_0050052 Ga0496104_0050052_1275_2021 215
96 3300048907 Ga0496104_0102740 Ga0496104_0102740_1413_2171 215
97 3300048911 Ga0496108_0048173 Ga0496108_0048173_1305_2063 215
98 3300048913 Ga0496110_0373475 Ga0496110_0373475_18_764 215
99 3300048915 Ga0496112_0003265 Ga0496112_0003265_7171_7929 215
100 3300048916 Ga0496113_0011220 Ga0496113_0011220_4484_5242 215
101 3300026035 Ga0207703_10482207 Ga0207703_104822072 216
102 3300048903 Ga0496100_0000011 Ga0496100_0000011_122277_123008 216
103 3300048904 Ga0496101_0000017 Ga0496101_0000017_224406_225137 216
104 3300048906 Ga0496103_0000981 Ga0496103_0000981_6183_6914 216
105 3300048909 Ga0496106_0093917 Ga0496106_0093917_1338_2069 216
106 3300048910 Ga0496107_0003846 Ga0496107_0003846_5656_6387 216
107 3300048911 Ga0496108_0026459 Ga0496108_0026459_1299_2030 216
108 3300048912 Ga0496109_0000179 Ga0496109_0000179_2756_3487 216
109 3300048913 Ga0496110_0003036 Ga0496110_0003036_3579_4310 216
110 3300048917 Ga0496114_0008620 Ga0496114_0008620_2724_3455 216
111 3300048918 Ga0496115_0099398 Ga0496115_0099398_226_957 216
112 3300048919 Ga0496116_0011148 Ga0496116_0011148_2118_2849 216
113 3300048920 Ga0496117_0068898 Ga0496117_0068898_1023_1754 216
114 3300048921 Ga0496118_0120170 Ga0496118_0120170_131_862 216
115 3300048922 Ga0496119_0006519 Ga0496119_0006519_5385_6116 216
116 3300048924 Ga0496121_0000014 Ga0496121_0000014_376887_377618 216
117 3300048925 Ga0496122_0000084 Ga0496122_0000084_177638_178369 216
118 3300048927 Ga0496124_0000019 Ga0496124_0000019_376887_377618 216
119 3300048928 Ga0496125_0000014 Ga0496125_0000014_376887_377618 216
120 3300048929 Ga0496126_0000017 Ga0496126_0000017_233059_233790 216
121 3300009545 Ga0105237_10022502 Ga0105237_100225026 217
122 3300046460 Ga0495638_0012805 Ga0495638_0012805_2818_3582 217
123 3300053142 Ga0500577_0136375 Ga0500577_0136375_213_977 217
124 3300053151 Ga0500604_0045391 Ga0500604_0045391_505_1269 217
125 3300005367 Ga0070667_100193328 Ga0070667_1001933282 218
126 3300005435 Ga0070714_100107706 Ga0070714_1001077061 218
127 3300005548 Ga0070665_100036049 Ga0070665_1000360492 218
128 3300005841 Ga0068863_100004304 Ga0068863_10000430413 218
129 3300009092 Ga0105250_10086200 Ga0105250_100862002 218
130 3300025929 Ga0207664_10063719 Ga0207664_100637191 218
131 3300028379 Ga0268266_10038623 Ga0268266_100386232 218
132 3300036712 Ga0316584_0253364 Ga0316584_0253364_159_923 218
133 3300044658 Ga0466972_0056046 Ga0466972_0056046_78_881 218
134 3300044735 Ga0466968_0073516 Ga0466968_0073516_247_1050 218
135 3300050492 nmdc:mga0yw44_29378_c1 nmdc:mga0yw44_29378_c1_872_1648 218
136 3300005331 Ga0070670_100128778 Ga0070670_1001287782 219
137 3300005355 Ga0070671_100003588 Ga0070671_1000035882 219
138 3300025931 Ga0207644_10018290 Ga0207644_100182903 219
139 iso_pu_bacteria 2902799365 2902801088 219
140 3300048904 Ga0496101_0182979 Ga0496101_0182979_32_865 220
141 3300048915 Ga0496112_0158714 Ga0496112_0158714_302_1135 220
142 3300048916 Ga0496113_0042037 Ga0496113_0042037_678_1511 220
143 3300048923 Ga0496120_0105767 Ga0496120_0105767_231_1064 220
144 3300048928 Ga0496125_0077586 Ga0496125_0077586_717_1550 220
145 3300006028 Ga0070717_10375151 Ga0070717_103751512 221
146 3300025303 Ga0209051_1011525 Ga0209051_10115253 221
147 3300025929 Ga0207664_10524273 Ga0207664_105242731 221
148 3300026121 Ga0207683_10296783 Ga0207683_102967831 221
149 3300053130 Ga0500642_0146501 Ga0500642_0146501_385_1077 221
150 3300005353 Ga0070669_100435927 Ga0070669_1004359271 222
151 3300005354 Ga0070675_100313469 Ga0070675_1003134692 222
152 3300005440 Ga0070705_100075477 Ga0070705_1000754771 222
153 3300005459 Ga0068867_100018541 Ga0068867_1000185411 222
154 3300005466 Ga0070685_10282671 Ga0070685_102826712 222
155 3300005615 Ga0070702_100056063 Ga0070702_1000560633 222
156 3300005616 Ga0068852_100042953 Ga0068852_1000429535 222
157 3300005843 Ga0068860_100240903 Ga0068860_1002409032 222
158 3300005843 Ga0068860_100403549 Ga0068860_1004035492 222
159 3300006051 Ga0075364_10132221 Ga0075364_101322212 222
160 3300006173 Ga0070716_100021805 Ga0070716_1000218052 222
161 3300006186 Ga0075369_10037114 Ga0075369_100371142 222
162 3300009098 Ga0105245_10380914 Ga0105245_103809142 222
163 3300009101 Ga0105247_10013640 Ga0105247_100136403 222
164 3300009147 Ga0114129_10333503 Ga0114129_103335032 222
165 3300009148 Ga0105243_10441627 Ga0105243_104416271 222
166 3300009176 Ga0105242_10230473 Ga0105242_102304732 222
167 3300013296 Ga0157374_10022545 Ga0157374_100225455 222
168 3300013306 Ga0163162_10842098 Ga0163162_108420981 222
169 3300013308 Ga0157375_10323038 Ga0157375_103230381 222
170 3300014326 Ga0157380_10153203 Ga0157380_101532032 222
171 3300014745 Ga0157377_10003499 Ga0157377_100034997 222
172 3300017792 Ga0163161_10084055 Ga0163161_100840552 222
173 3300025711 Ga0207696_1072413 Ga0207696_10724131 222
174 3300026121 Ga0207683_10060762 Ga0207683_100607622 222
175 3300035691 Ga0373931_0007637 Ga0373931_0007637_2988_3734 222
176 3300048904 Ga0496101_0109806 Ga0496101_0109806_379_1125 222
177 3300048905 Ga0496102_0062266 Ga0496102_0062266_2476_3222 222
178 3300048909 Ga0496106_0053079 Ga0496106_0053079_899_1645 222
179 3300048910 Ga0496107_0056867 Ga0496107_0056867_189_935 222
180 3300048911 Ga0496108_0002989 Ga0496108_0002989_7448_8194 222
181 3300048912 Ga0496109_0000883 Ga0496109_0000883_22408_23154 222
182 3300048913 Ga0496110_0013171 Ga0496110_0013171_6048_6794 222
183 3300048915 Ga0496112_0004789 Ga0496112_0004789_4412_5158 222
184 3300048917 Ga0496114_0061020 Ga0496114_0061020_1618_2364 222
185 3300005578 Ga0068854_100383385 Ga0068854_1003833851 223
186 3300006048 Ga0075363_100002541 Ga0075363_1000025413 223
187 3300006051 Ga0075364_10010922 Ga0075364_100109227 223
188 3300006353 Ga0075370_10130206 Ga0075370_101302062 223
189 3300031901 Ga0307406_10023302 Ga0307406_100233022 223
190 3300042004 Ga0439445_0019510 Ga0439445_0019510_537_1364 223
191 3300042435 Ga0439434_0003612 Ga0439434_0003612_292_1119 223
192 3300050496 nmdc:mga07m45_6872_c2 nmdc:mga07m45_6872_c2_74_847 223
193 3300009094 Ga0111539_11189303 Ga0111539_111893031 224
194 3300048912 Ga0496109_0063943 Ga0496109_0063943_1370_2119 224
195 3300048915 Ga0496112_0059663 Ga0496112_0059663_1696_2445 224
196 3300050491 nmdc:mga00v17_7351_c1 nmdc:mga00v17_7351_c1_2163_2897 224
197 3300003792 Ga0055540_1008357 Ga0055540_10083571 225
198 3300005356 Ga0070674_100017167 Ga0070674_1000171673 225
199 3300005466 Ga0070685_10118489 Ga0070685_101184892 225
200 3300005548 Ga0070665_100462211 Ga0070665_1004622112 225
201 3300009176 Ga0105242_10238158 Ga0105242_102381582 225
202 3300009177 Ga0105248_10024195 Ga0105248_100241957 225
203 3300010375 Ga0105239_10414579 Ga0105239_104145792 225
204 3300025303 Ga0209051_1001289 Ga0209051_10012893 225
205 3300025934 Ga0207686_10188337 Ga0207686_101883372 225
206 3300025937 Ga0207669_10007813 Ga0207669_100078133 225
207 3300025941 Ga0207711_10131956 Ga0207711_101319562 225
208 3300025972 Ga0207668_10119669 Ga0207668_101196692 225
209 3300026118 Ga0207675_100355463 Ga0207675_1003554632 225
210 3300028379 Ga0268266_10562573 Ga0268266_105625731 225
211 3300044658 Ga0466972_0031103 Ga0466972_0031103_262_1017 225
212 3300044735 Ga0466968_0071201 Ga0466968_0071201_126_881 225
213 3300045836 Ga0466958_0009251 Ga0466958_0009251_1371_2126 225
214 3300048903 Ga0496100_0000154 Ga0496100_0000154_9634_10380 225
215 3300048904 Ga0496101_0000184 Ga0496101_0000184_21139_21885 225
216 3300048907 Ga0496104_0030541 Ga0496104_0030541_1459_2205 225
217 3300048908 Ga0496105_0102511 Ga0496105_0102511_533_1279 225
218 3300048909 Ga0496106_0009098 Ga0496106_0009098_4488_5234 225
219 3300048910 Ga0496107_0002170 Ga0496107_0002170_257_1003 225
220 3300048917 Ga0496114_0004263 Ga0496114_0004263_8339_9085 225
221 3300048918 Ga0496115_0026818 Ga0496115_0026818_2235_2981 225
222 3300061719 Ga0466962_0033197 Ga0466962_0033197_866_1621 225
223 3300005719 Ga0068861_100034257 Ga0068861_1000342574 226
224 3300009148 Ga0105243_10008644 Ga0105243_100086447 226
225 3300009176 Ga0105242_10002910 Ga0105242_100029103 226
226 3300009177 Ga0105248_10180806 Ga0105248_101808062 226
227 3300009545 Ga0105237_10123676 Ga0105237_101236763 226
228 3300009553 Ga0105249_10007373 Ga0105249_100073732 226
229 3300013297 Ga0157378_10048936 Ga0157378_100489363 226
230 3300013308 Ga0157375_10002286 Ga0157375_100022863 226
231 3300014968 Ga0157379_10035879 Ga0157379_100358793 226
232 3300021384 Ga0213876_10000482 Ga0213876_100004829 226
233 3300025900 Ga0207710_10006088 Ga0207710_100060884 226
234 3300025933 Ga0207706_10031998 Ga0207706_100319983 226
235 3300025934 Ga0207686_10011595 Ga0207686_100115953 226
236 3300025961 Ga0207712_10018404 Ga0207712_100184041 226
237 3300039437 Ga0436365_1318799 Ga0436365_1318799_12103_12882 226
238 3300048903 Ga0496100_0004825 Ga0496100_0004825_4874_5620 226
239 3300048904 Ga0496101_0032830 Ga0496101_0032830_1718_2464 226
240 3300048906 Ga0496103_0007644 Ga0496103_0007644_4334_5080 226
241 3300048909 Ga0496106_0002366 Ga0496106_0002366_3782_4528 226
242 3300048910 Ga0496107_0002125 Ga0496107_0002125_3738_4484 226
243 3300048918 Ga0496115_0001737 Ga0496115_0001737_8185_8931 226
244 3300048928 Ga0496125_0179324 Ga0496125_0179324_100_807 226
245 iso_pu_bacteria 2738541264 2738668185 226
246 iso_pu_bacteria 2738541356 2739147255 226
247 3300005455 Ga0070663_100004363 Ga0070663_1000043636 227
248 3300009098 Ga0105245_10336621 Ga0105245_103366212 227
249 3300013308 Ga0157375_10151125 Ga0157375_101511251 227
250 3300013308 Ga0157375_10909512 Ga0157375_109095122 227
251 3300025935 Ga0207709_10150966 Ga0207709_101509662 227
252 3300026067 Ga0207678_10016783 Ga0207678_100167834 227
253 3300039437 Ga0436365_0243891 Ga0436365_0243891_9065_9835 227
254 3300048907 Ga0496104_0398897 Ga0496104_0398897_245_1069 227
255 3300048911 Ga0496108_0003435 Ga0496108_0003435_11775_12599 227
256 3300048912 Ga0496109_0005555 Ga0496109_0005555_6898_7722 227
257 3300048913 Ga0496110_0064224 Ga0496110_0064224_268_1092 227
258 3300048915 Ga0496112_0017299 Ga0496112_0017299_154_978 227
259 3300048916 Ga0496113_0041039 Ga0496113_0041039_2036_2860 227
260 3300006186 Ga0075369_10114103 Ga0075369_101141032 228
261 3300048905 Ga0496102_0159110 Ga0496102_0159110_718_1464 228
262 iso_pu_bacteria 2902837492 2902840671 228
263 3300009098 Ga0105245_10112640 Ga0105245_101126401 229
264 3300026023 Ga0207677_10009179 Ga0207677_100091792 230
265 3300044683 Ga0466965_0047554 Ga0466965_0047554_305_1066 230
266 3300044684 Ga0466966_0018474 Ga0466966_0018474_3135_3896 230
267 3300044693 Ga0466961_0006753 Ga0466961_0006753_2658_3419 230
268 3300044735 Ga0466968_0100037 Ga0466968_0100037_470_1231 230
269 3300044765 Ga0466970_0082233 Ga0466970_0082233_498_1259 230
270 3300044842 Ga0466957_0016353 Ga0466957_0016353_340_1101 230
271 3300045049 Ga0466959_0000906 Ga0466959_0000906_5272_6033 230
272 3300045836 Ga0466958_0001115 Ga0466958_0001115_1734_2495 230
273 3300050516 nmdc:mga0sz30_3388_c1 nmdc:mga0sz30_3388_c1_4147_4890 230
274 3300005366 Ga0070659_100059942 Ga0070659_1000599424 231
275 iso_pu_bacteria 2902810491 2902814995 231
276 3300048911 Ga0496108_0079873 Ga0496108_0079873_1218_1970 232
277 iso_pu_bacteria 2738543028 2739332687 232
278 3300013306 Ga0163162_10128207 Ga0163162_101282074 233
279 3300031251 Ga0265327_10000081 Ga0265327_10000081118 233
280 3300031251 Ga0265327_10051697 Ga0265327_100516972 233
281 3300005436 Ga0070713_100068207 Ga0070713_1000682073 235
282 3300006028 Ga0070717_10624592 Ga0070717_106245921 235
283 3300025928 Ga0207700_10075544 Ga0207700_100755443 235
284 iso_pu_bacteria 2902792274 2902795947 235
285 3300039437 Ga0436365_0564838 Ga0436365_0564838_4525_5298 236
286 3300046455 Ga0495603_0040966 Ga0495603_0040966_1613_2353 237
287 3300046459 Ga0495629_0085659 Ga0495629_0085659_498_1238 237
288 3300046473 Ga0495582_0048774 Ga0495582_0048774_1073_1813 237
289 3300046517 Ga0495630_0393719 Ga0495630_0393719_24_764 237
290 3300046642 Ga0495634_0281320 Ga0495634_0281320_85_825 237
291 3300046681 Ga0495647_0086493 Ga0495647_0086493_194_934 237
292 3300046683 Ga0495658_0037145 Ga0495658_0037145_1243_1983 237
293 3300047319 Ga0495674_0116825 Ga0495674_0116825_1465_2205 237
294 3300047673 Ga0495593_0003642 Ga0495593_0003642_1780_2520 237
295 3300048089 Ga0495614_0088370 Ga0495614_0088370_273_1013 237
296 3300048909 Ga0496106_0272632 Ga0496106_0272632_506_1246 237
297 3300048921 Ga0496118_0002742 Ga0496118_0002742_5784_6554 238
298 3300049571 Ga0501034_0373797 Ga0501034_0373797_104_847 238
299 3300053104 Ga0500556_0025849 Ga0500556_0025849_113_877 238
300 3300053153 Ga0500616_0057681 Ga0500616_0057681_1184_1927 238
301 3300006051 Ga0075364_10035598 Ga0075364_100355983 239
302 3300006353 Ga0075370_10008948 Ga0075370_100089484 239
303 3300046694 Ga0495649_0128163 Ga0495649_0128163_306_1052 239
304 3300050496 nmdc:mga07m45_92737_c1 nmdc:mga07m45_92737_c1_857_1615 239
305 3300050516 nmdc:mga0sz30_26490_c1 nmdc:mga0sz30_26490_c1_812_1570 239
306 3300046690 Ga0495624_0058514 Ga0495624_0058514_804_1586 241
307 3300003320 rootH2_10070522 rootH2_100705226 243
308 3300044719 Ga0466971_0027942 Ga0466971_0027942_1108_1875 243
309 3300044901 Ga0466960_0016639 Ga0466960_0016639_327_1094 243
310 3300045836 Ga0466958_0089304 Ga0466958_0089304_422_1189 243
311 3300045976 Ga0466967_0115839 Ga0466967_0115839_1086_1853 243
312 iso_pu_bacteria 2939582691 2939585831 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

108

225

0.98

Feature Viewer

pLDDT pTM Quality
49.9 0.26 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map