F401957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 182 | 304 | 234 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2939582691|2939585831 |
| Length | 278 |
| Sequence | VMTAGRVSLSPAVDASTRALALRHVPLADVKPVVRTLRAVRGAIVATAAQVPRRRAITIAVAIVILVAVALLVPLPTAVQLRDWATSVGPWFPLAFLAAHIVITVLPFPRTAFTLAAGLLFGPIVGVTIAVVASAVSAVIALLLVRAAGWHLDRLVKHPRVDTLNTRLAERGWPTVLSMRMIPAVPFSVLNYAAGSSAVRVVPYTLATFAGLLPGTAAVVILGDALTGNVSPLLFLVSVCTACLGIAGLFYEFRTHRRNHNREPESDPEPVSEPVVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 2 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 3 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 4 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 5 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 6 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 7 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 95 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 96 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 99 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 100 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 101 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 102 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 103 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 104 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 107 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 145 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 146 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 147 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 148 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 149 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 150 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 151 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 177 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 178 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 180 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 181 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 182 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.01 |
| Nodule | 0 |
| Rhizoplane | 18.91 |
| Rhizosphere | 61.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10070522 | 3300003320 | Bacteria | 7575 |
| 2 | Ga0055540_1000036 | 3300003792 | Bacteria | 164285 |
| 3 | Ga0055540_1008357 | 3300003792 | Bacteria | 3736 |
| 4 | Ga0070670_100128778 | 3300005331 | Bacteria | 2185 |
| 5 | Ga0070668_100004631 | 3300005347 | Bacteria | 10184 |
| 6 | Ga0070669_100002566 | 3300005353 | Bacteria | 13142 |
| 7 | Ga0070669_100435927 | 3300005353 | Bacteria | 1078 |
| 8 | Ga0070675_100313469 | 3300005354 | Bacteria | 1384 |
| 9 | Ga0070671_100003588 | 3300005355 | Bacteria | 12130 |
| 10 | Ga0070671_100132841 | 3300005355 | Bacteria | 2097 |
| 11 | Ga0070674_100017167 | 3300005356 | Bacteria | 4547 |
| 12 | Ga0070659_100059942 | 3300005366 | Bacteria | 3005 |
| 13 | Ga0070667_100000082 | 3300005367 | Bacteria | 118320 |
| 14 | Ga0070667_100005464 | 3300005367 | Bacteria | 10612 |
| 15 | Ga0070667_100193328 | 3300005367 | Bacteria | 1803 |
| 16 | Ga0070714_100107706 | 3300005435 | Bacteria | 2463 |
| 17 | Ga0070713_100068207 | 3300005436 | Bacteria | 2997 |
| 18 | Ga0070705_100075477 | 3300005440 | Bacteria | 2052 |
| 19 | Ga0070663_100004363 | 3300005455 | Bacteria | 8299 |
| 20 | Ga0068867_100018541 | 3300005459 | Bacteria | 4946 |
| 21 | Ga0070685_10118489 | 3300005466 | Bacteria | 1641 |
| 22 | Ga0070685_10282671 | 3300005466 | Bacteria | 1111 |
| 23 | Ga0070665_100003904 | 3300005548 | Bacteria | 15759 |
| 24 | Ga0070665_100036049 | 3300005548 | Bacteria | 4977 |
| 25 | Ga0070665_100462211 | 3300005548 | Bacteria | 1279 |
| 26 | Ga0068854_100383385 | 3300005578 | Bacteria | 1159 |
| 27 | Ga0070702_100056063 | 3300005615 | Bacteria | 2274 |
| 28 | Ga0068852_100042953 | 3300005616 | Bacteria | 3830 |
| 29 | Ga0068859_100027390 | 3300005617 | Bacteria | 5716 |
| 30 | Ga0068861_100034257 | 3300005719 | Bacteria | 3754 |
| 31 | Ga0068863_100004304 | 3300005841 | Bacteria | 14021 |
| 32 | Ga0068863_100021305 | 3300005841 | Bacteria | 6186 |
| 33 | Ga0068863_100074720 | 3300005841 | Bacteria | 3207 |
| 34 | Ga0068858_100008035 | 3300005842 | Bacteria | 10158 |
| 35 | Ga0068860_100000011 | 3300005843 | Bacteria | 328172 |
| 36 | Ga0068860_100240903 | 3300005843 | Bacteria | 1759 |
| 37 | Ga0068860_100403549 | 3300005843 | Bacteria | 1352 |
| 38 | Ga0068862_100000012 | 3300005844 | Bacteria | 267598 |
| 39 | Ga0081455_10200526 | 3300005937 | Bacteria | 1494 |
| 40 | Ga0070717_10375151 | 3300006028 | Bacteria | 1275 |
| 41 | Ga0070717_10624592 | 3300006028 | Bacteria | 978 |
| 42 | Ga0075363_100002541 | 3300006048 | Bacteria | 7486 |
| 43 | Ga0075364_10010922 | 3300006051 | Bacteria | 5503 |
| 44 | Ga0075364_10035598 | 3300006051 | Bacteria | 3217 |
| 45 | Ga0075364_10132221 | 3300006051 | Bacteria | 1675 |
| 46 | Ga0070716_100021805 | 3300006173 | Bacteria | 3378 |
| 47 | Ga0075369_10037114 | 3300006186 | Bacteria | 2075 |
| 48 | Ga0075369_10114103 | 3300006186 | Bacteria | 1219 |
| 49 | Ga0075370_10008948 | 3300006353 | Bacteria | 5176 |
| 50 | Ga0075370_10130206 | 3300006353 | Bacteria | 1468 |
| 51 | Ga0075428_100009057 | 3300006844 | Bacteria | 11045 |
| 52 | Ga0075430_100003014 | 3300006846 | Bacteria | 14092 |
| 53 | Ga0075431_100067318 | 3300006847 | Bacteria | 3697 |
| 54 | Ga0097620_100027390 | 3300006931 | Bacteria | 5716 |
| 55 | Ga0105250_10086200 | 3300009092 | Bacteria | 1275 |
| 56 | Ga0111539_11189303 | 3300009094 | Bacteria | 886 |
| 57 | Ga0105245_10112640 | 3300009098 | Bacteria | 2532 |
| 58 | Ga0105245_10336621 | 3300009098 | Bacteria | 1491 |
| 59 | Ga0105245_10380914 | 3300009098 | Bacteria | 1405 |
| 60 | Ga0105247_10000007 | 3300009101 | Bacteria | 409490 |
| 61 | Ga0105247_10013640 | 3300009101 | Bacteria | 4873 |
| 62 | Ga0114129_10022243 | 3300009147 | Bacteria | 9001 |
| 63 | Ga0114129_10333503 | 3300009147 | Bacteria | 2013 |
| 64 | Ga0105243_10008644 | 3300009148 | Bacteria | 7812 |
| 65 | Ga0105243_10441627 | 3300009148 | Bacteria | 1218 |
| 66 | Ga0105242_10002910 | 3300009176 | Bacteria | 13388 |
| 67 | Ga0105242_10230473 | 3300009176 | Bacteria | 1660 |
| 68 | Ga0105242_10238158 | 3300009176 | Bacteria | 1635 |
| 69 | Ga0105248_10000114 | 3300009177 | Bacteria | 90862 |
| 70 | Ga0105248_10024195 | 3300009177 | Bacteria | 6750 |
| 71 | Ga0105248_10180806 | 3300009177 | Bacteria | 2377 |
| 72 | Ga0105237_10022502 | 3300009545 | Bacteria | 6466 |
| 73 | Ga0105237_10123676 | 3300009545 | Bacteria | 2581 |
| 74 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 75 | Ga0105249_10007373 | 3300009553 | Bacteria | 9592 |
| 76 | Ga0105249_10058315 | 3300009553 | Bacteria | 3539 |
| 77 | Ga0105239_10414579 | 3300010375 | Bacteria | 1525 |
| 78 | Ga0157374_10022545 | 3300013296 | Bacteria | 5618 |
| 79 | Ga0157378_10048936 | 3300013297 | Bacteria | 3760 |
| 80 | Ga0163162_10113707 | 3300013306 | Bacteria | 2806 |
| 81 | Ga0163162_10128207 | 3300013306 | Bacteria | 2645 |
| 82 | Ga0163162_10842098 | 3300013306 | Bacteria | 1033 |
| 83 | Ga0157375_10002286 | 3300013308 | Bacteria | 16565 |
| 84 | Ga0157375_10151125 | 3300013308 | Bacteria | 2458 |
| 85 | Ga0157375_10323038 | 3300013308 | Bacteria | 1708 |
| 86 | Ga0157375_10909512 | 3300013308 | Bacteria | 1023 |
| 87 | Ga0163163_10026718 | 3300014325 | Bacteria | 5521 |
| 88 | Ga0163163_10068418 | 3300014325 | Bacteria | 3533 |
| 89 | Ga0157380_10153203 | 3300014326 | Bacteria | 1995 |
| 90 | Ga0157377_10003499 | 3300014745 | Bacteria | 7109 |
| 91 | Ga0157379_10015568 | 3300014968 | Bacteria | 6677 |
| 92 | Ga0157379_10035879 | 3300014968 | Bacteria | 4422 |
| 93 | Ga0163161_10084055 | 3300017792 | Bacteria | 2347 |
| 94 | Ga0213876_10000482 | 3300021384 | Bacteria | 31554 |
| 95 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 96 | Ga0209051_1001289 | 3300025303 | Bacteria | 22159 |
| 97 | Ga0209051_1011525 | 3300025303 | Bacteria | 4357 |
| 98 | Ga0207696_1072413 | 3300025711 | Bacteria | 957 |
| 99 | Ga0207710_10000013 | 3300025900 | Bacteria | 409402 |
| 100 | Ga0207710_10006088 | 3300025900 | Bacteria | 5167 |
| 101 | Ga0207671_10229929 | 3300025914 | Bacteria | 1455 |
| 102 | Ga0207681_10007174 | 3300025923 | Bacteria | 6837 |
| 103 | Ga0207700_10075544 | 3300025928 | Bacteria | 2611 |
| 104 | Ga0207664_10063719 | 3300025929 | Bacteria | 2947 |
| 105 | Ga0207664_10524273 | 3300025929 | Bacteria | 1062 |
| 106 | Ga0207644_10018290 | 3300025931 | Bacteria | 4738 |
| 107 | Ga0207644_10078678 | 3300025931 | Bacteria | 2431 |
| 108 | Ga0207706_10031998 | 3300025933 | Bacteria | 4686 |
| 109 | Ga0207686_10011595 | 3300025934 | Bacteria | 4830 |
| 110 | Ga0207686_10188337 | 3300025934 | Bacteria | 1469 |
| 111 | Ga0207709_10150966 | 3300025935 | Bacteria | 1609 |
| 112 | Ga0207669_10007813 | 3300025937 | Bacteria | 4979 |
| 113 | Ga0207711_10000327 | 3300025941 | Bacteria | 50683 |
| 114 | Ga0207711_10131956 | 3300025941 | Bacteria | 2241 |
| 115 | Ga0207661_10262088 | 3300025944 | Bacteria | 1540 |
| 116 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 117 | Ga0207712_10008460 | 3300025961 | Bacteria | 6504 |
| 118 | Ga0207712_10018404 | 3300025961 | Bacteria | 4550 |
| 119 | Ga0207668_10043685 | 3300025972 | Bacteria | 3043 |
| 120 | Ga0207668_10119669 | 3300025972 | Bacteria | 1992 |
| 121 | Ga0207658_10000140 | 3300025986 | Bacteria | 76436 |
| 122 | Ga0207658_10003803 | 3300025986 | Bacteria | 10631 |
| 123 | Ga0207658_10096822 | 3300025986 | Bacteria | 2302 |
| 124 | Ga0207677_10009179 | 3300026023 | Bacteria | 5554 |
| 125 | Ga0207703_10021251 | 3300026035 | Bacteria | 5081 |
| 126 | Ga0207703_10482207 | 3300026035 | Bacteria | 1162 |
| 127 | Ga0207678_10016783 | 3300026067 | Bacteria | 6430 |
| 128 | Ga0207641_10015710 | 3300026088 | Bacteria | 6202 |
| 129 | Ga0207641_10102525 | 3300026088 | Bacteria | 2523 |
| 130 | Ga0207675_100355463 | 3300026118 | Bacteria | 1436 |
| 131 | Ga0207683_10060762 | 3300026121 | Bacteria | 3323 |
| 132 | Ga0207683_10296783 | 3300026121 | Bacteria | 1478 |
| 133 | Ga0268266_10008678 | 3300028379 | Bacteria | 9018 |
| 134 | Ga0268266_10038623 | 3300028379 | Bacteria | 4064 |
| 135 | Ga0268266_10562573 | 3300028379 | Bacteria | 1093 |
| 136 | Ga0268265_10000016 | 3300028380 | Bacteria | 299380 |
| 137 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 138 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 139 | Ga0265327_10001624 | 3300031251 | Bacteria | 27161 |
| 140 | Ga0265327_10051697 | 3300031251 | Bacteria | 2143 |
| 141 | Ga0307406_10023302 | 3300031901 | Bacteria | 3682 |
| 142 | Ga0373931_0007637 | 3300035691 | Bacteria | 5099 |
| 143 | Ga0316584_0253364 | 3300036712 | Bacteria | 1285 |
| 144 | Ga0436365_0243891 | 3300039437 | Bacteria | 26248 |
| 145 | Ga0436365_0564838 | 3300039437 | Bacteria | 13238 |
| 146 | Ga0436365_1318799 | 3300039437 | Bacteria | 31110 |
| 147 | Ga0436363_1421662 | 3300039450 | Bacteria | 3901 |
| 148 | Ga0439445_0019510 | 3300042004 | Bacteria | 1690 |
| 149 | Ga0439434_0003612 | 3300042435 | Bacteria | 4521 |
| 150 | Ga0466972_0031103 | 3300044658 | Bacteria | 2626 |
| 151 | Ga0466972_0056046 | 3300044658 | Bacteria | 1895 |
| 152 | Ga0466965_0004743 | 3300044683 | Bacteria | 6059 |
| 153 | Ga0466965_0039187 | 3300044683 | Bacteria | 2329 |
| 154 | Ga0466965_0047554 | 3300044683 | Bacteria | 2125 |
| 155 | Ga0466966_0018474 | 3300044684 | Bacteria | 4597 |
| 156 | Ga0466961_0006753 | 3300044693 | Bacteria | 7302 |
| 157 | Ga0466963_0039097 | 3300044694 | Bacteria | 3106 |
| 158 | Ga0466963_0298418 | 3300044694 | Bacteria | 1133 |
| 159 | Ga0466971_0027942 | 3300044719 | Bacteria | 2526 |
| 160 | Ga0466968_0071201 | 3300044735 | Bacteria | 1514 |
| 161 | Ga0466968_0073516 | 3300044735 | Bacteria | 1492 |
| 162 | Ga0466968_0100037 | 3300044735 | Bacteria | 1293 |
| 163 | Ga0466970_0082233 | 3300044765 | Bacteria | 1742 |
| 164 | Ga0466957_0016353 | 3300044842 | Bacteria | 4340 |
| 165 | Ga0466957_0091988 | 3300044842 | Bacteria | 1902 |
| 166 | Ga0466960_0000659 | 3300044901 | Bacteria | 11980 |
| 167 | Ga0466960_0016639 | 3300044901 | Bacteria | 3194 |
| 168 | Ga0466959_0000906 | 3300045049 | Bacteria | 17518 |
| 169 | Ga0466958_0001115 | 3300045836 | Bacteria | 12379 |
| 170 | Ga0466958_0009251 | 3300045836 | Bacteria | 5485 |
| 171 | Ga0466958_0089304 | 3300045836 | Bacteria | 1905 |
| 172 | Ga0466967_0031464 | 3300045976 | Bacteria | 4466 |
| 173 | Ga0466967_0115839 | 3300045976 | Bacteria | 2468 |
| 174 | Ga0466967_0297389 | 3300045976 | Bacteria | 1552 |
| 175 | Ga0466967_0433015 | 3300045976 | Bacteria | 1283 |
| 176 | Ga0495603_0040966 | 3300046455 | Bacteria | 2771 |
| 177 | Ga0495629_0085659 | 3300046459 | Bacteria | 2198 |
| 178 | Ga0495638_0012805 | 3300046460 | Bacteria | 5730 |
| 179 | Ga0495582_0048774 | 3300046473 | Bacteria | 2332 |
| 180 | Ga0495630_0393719 | 3300046517 | Bacteria | 1061 |
| 181 | Ga0495634_0281320 | 3300046642 | Bacteria | 1010 |
| 182 | Ga0495647_0086493 | 3300046681 | Bacteria | 1279 |
| 183 | Ga0495658_0037145 | 3300046683 | Bacteria | 2691 |
| 184 | Ga0495624_0058514 | 3300046690 | Bacteria | 2420 |
| 185 | Ga0495649_0128163 | 3300046694 | Bacteria | 1340 |
| 186 | Ga0495674_0116825 | 3300047319 | Bacteria | 2257 |
| 187 | Ga0495686_0055153 | 3300047472 | Bacteria | 2487 |
| 188 | Ga0495593_0003642 | 3300047673 | Bacteria | 9203 |
| 189 | Ga0495614_0088370 | 3300048089 | Bacteria | 1347 |
| 190 | Ga0495626_0052034 | 3300048091 | Bacteria | 1888 |
| 191 | Ga0496100_0000011 | 3300048903 | Bacteria | 190969 |
| 192 | Ga0496100_0000154 | 3300048903 | Bacteria | 38218 |
| 193 | Ga0496100_0004825 | 3300048903 | Bacteria | 7202 |
| 194 | Ga0496100_0094715 | 3300048903 | Bacteria | 2045 |
| 195 | Ga0496101_0000017 | 3300048904 | Bacteria | 239153 |
| 196 | Ga0496101_0000184 | 3300048904 | Bacteria | 49703 |
| 197 | Ga0496101_0032830 | 3300048904 | Bacteria | 3657 |
| 198 | Ga0496101_0036925 | 3300048904 | Bacteria | 3463 |
| 199 | Ga0496101_0042873 | 3300048904 | Bacteria | 3231 |
| 200 | Ga0496101_0109806 | 3300048904 | Bacteria | 2075 |
| 201 | Ga0496101_0182979 | 3300048904 | Bacteria | 1614 |
| 202 | Ga0496102_0000124 | 3300048905 | Bacteria | 110030 |
| 203 | Ga0496102_0062266 | 3300048905 | Bacteria | 3416 |
| 204 | Ga0496102_0159110 | 3300048905 | Bacteria | 2124 |
| 205 | Ga0496103_0000981 | 3300048906 | Bacteria | 20163 |
| 206 | Ga0496103_0001690 | 3300048906 | Bacteria | 14432 |
| 207 | Ga0496103_0007644 | 3300048906 | Bacteria | 6429 |
| 208 | Ga0496104_0030541 | 3300048907 | Bacteria | 5008 |
| 209 | Ga0496104_0050052 | 3300048907 | Bacteria | 3942 |
| 210 | Ga0496104_0102740 | 3300048907 | Bacteria | 2738 |
| 211 | Ga0496104_0398897 | 3300048907 | Bacteria | 1288 |
| 212 | Ga0496105_0102511 | 3300048908 | Bacteria | 2363 |
| 213 | Ga0496106_0002366 | 3300048909 | Bacteria | 14034 |
| 214 | Ga0496106_0009098 | 3300048909 | Bacteria | 7339 |
| 215 | Ga0496106_0053079 | 3300048909 | Bacteria | 3060 |
| 216 | Ga0496106_0093917 | 3300048909 | Bacteria | 2318 |
| 217 | Ga0496106_0272632 | 3300048909 | Bacteria | 1355 |
| 218 | Ga0496107_0002125 | 3300048910 | Bacteria | 12702 |
| 219 | Ga0496107_0002170 | 3300048910 | Bacteria | 12606 |
| 220 | Ga0496107_0003846 | 3300048910 | Bacteria | 10084 |
| 221 | Ga0496107_0042529 | 3300048910 | Bacteria | 3263 |
| 222 | Ga0496107_0056867 | 3300048910 | Bacteria | 2827 |
| 223 | Ga0496108_0002989 | 3300048911 | Bacteria | 13582 |
| 224 | Ga0496108_0003435 | 3300048911 | Bacteria | 12702 |
| 225 | Ga0496108_0026459 | 3300048911 | Bacteria | 4784 |
| 226 | Ga0496108_0048173 | 3300048911 | Bacteria | 3563 |
| 227 | Ga0496108_0079873 | 3300048911 | Bacteria | 2770 |
| 228 | Ga0496109_0000179 | 3300048912 | Bacteria | 62857 |
| 229 | Ga0496109_0000883 | 3300048912 | Bacteria | 25040 |
| 230 | Ga0496109_0005555 | 3300048912 | Bacteria | 10555 |
| 231 | Ga0496109_0063943 | 3300048912 | Bacteria | 3366 |
| 232 | Ga0496110_0003036 | 3300048913 | Bacteria | 12734 |
| 233 | Ga0496110_0013171 | 3300048913 | Bacteria | 6829 |
| 234 | Ga0496110_0064224 | 3300048913 | Bacteria | 3244 |
| 235 | Ga0496110_0373475 | 3300048913 | Bacteria | 1299 |
| 236 | Ga0496112_0003265 | 3300048915 | Bacteria | 13385 |
| 237 | Ga0496112_0004789 | 3300048915 | Bacteria | 11545 |
| 238 | Ga0496112_0017299 | 3300048915 | Bacteria | 6770 |
| 239 | Ga0496112_0059663 | 3300048915 | Bacteria | 3760 |
| 240 | Ga0496112_0158714 | 3300048915 | Bacteria | 2228 |
| 241 | Ga0496113_0011220 | 3300048916 | Bacteria | 5967 |
| 242 | Ga0496113_0041039 | 3300048916 | Bacteria | 3412 |
| 243 | Ga0496113_0042037 | 3300048916 | Bacteria | 3375 |
| 244 | Ga0496114_0004263 | 3300048917 | Bacteria | 11068 |
| 245 | Ga0496114_0008620 | 3300048917 | Bacteria | 8082 |
| 246 | Ga0496114_0061020 | 3300048917 | Bacteria | 3153 |
| 247 | Ga0496115_0001737 | 3300048918 | Bacteria | 15625 |
| 248 | Ga0496115_0026818 | 3300048918 | Bacteria | 4501 |
| 249 | Ga0496115_0099398 | 3300048918 | Bacteria | 2384 |
| 250 | Ga0496116_0011148 | 3300048919 | Bacteria | 7470 |
| 251 | Ga0496116_0013114 | 3300048919 | Bacteria | 6713 |
| 252 | Ga0496117_0000401 | 3300048920 | Bacteria | 73619 |
| 253 | Ga0496117_0068898 | 3300048920 | Bacteria | 2385 |
| 254 | Ga0496118_0002281 | 3300048921 | Bacteria | 26176 |
| 255 | Ga0496118_0002742 | 3300048921 | Bacteria | 23180 |
| 256 | Ga0496118_0120170 | 3300048921 | Bacteria | 1715 |
| 257 | Ga0496119_0006519 | 3300048922 | Bacteria | 10772 |
| 258 | Ga0496119_0008351 | 3300048922 | Bacteria | 9122 |
| 259 | Ga0496120_0005957 | 3300048923 | Bacteria | 9499 |
| 260 | Ga0496120_0105767 | 3300048923 | Bacteria | 1479 |
| 261 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 262 | Ga0496121_0022893 | 3300048924 | Bacteria | 6038 |
| 263 | Ga0496122_0000084 | 3300048925 | Bacteria | 208740 |
| 264 | Ga0496123_0017478 | 3300048926 | Bacteria | 5766 |
| 265 | Ga0496124_0000019 | 3300048927 | Bacteria | 436995 |
| 266 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 267 | Ga0496125_0077586 | 3300048928 | Bacteria | 2560 |
| 268 | Ga0496125_0106700 | 3300048928 | Bacteria | 2043 |
| 269 | Ga0496125_0179324 | 3300048928 | Bacteria | 1414 |
| 270 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 271 | Ga0496126_0003717 | 3300048929 | Bacteria | 19024 |
| 272 | Ga0496126_0078826 | 3300048929 | Bacteria | 2917 |
| 273 | Ga0501032_0018538 | 3300049569 | Bacteria | 4874 |
| 274 | Ga0501033_0107213 | 3300049570 | Bacteria | 2035 |
| 275 | Ga0501034_0373797 | 3300049571 | Bacteria | 1351 |
| 276 | Ga0501036_0204154 | 3300049572 | Bacteria | 1662 |
| 277 | Ga0501037_0014139 | 3300049573 | Bacteria | 5878 |
| 278 | Ga0501043_0186606 | 3300049579 | Bacteria | 1614 |
| 279 | Ga0501043_0428178 | 3300049579 | Bacteria | 997 |
| 280 | Ga0501046_0008973 | 3300049580 | Bacteria | 8682 |
| 281 | Ga0501047_0030503 | 3300049581 | Bacteria | 5197 |
| 282 | Ga0501048_0012406 | 3300049582 | Bacteria | 6339 |
| 283 | Ga0501069_0028280 | 3300049585 | Bacteria | 3074 |
| 284 | Ga0501070_0064487 | 3300049586 | Bacteria | 3033 |
| 285 | Ga0501080_0156720 | 3300049742 | Bacteria | 2103 |
| 286 | Ga0501035_0240067 | 3300049822 | Bacteria | 1541 |
| 287 | Ga0501044_0004957 | 3300049823 | Bacteria | 14888 |
| 288 | Ga0501044_0008915 | 3300049823 | Bacteria | 10965 |
| 289 | nmdc:mga00v17_7351_c1 | 3300050491 | Bacteria | 5871 |
| 290 | nmdc:mga0yw44_29378_c1 | 3300050492 | Bacteria | 3173 |
| 291 | nmdc:mga07m45_6872_c2 | 3300050496 | Bacteria | 1468 |
| 292 | nmdc:mga07m45_92737_c1 | 3300050496 | Bacteria | 1731 |
| 293 | nmdc:mga05p37_44599_c1 | 3300050507 | Bacteria | 5126 |
| 294 | nmdc:mga0qj67_95786_c1 | 3300050509 | Bacteria | 2389 |
| 295 | nmdc:mga06r32_56173_c1 | 3300050510 | Bacteria | 3778 |
| 296 | nmdc:mga0sz30_26490_c1 | 3300050516 | Bacteria | 2376 |
| 297 | nmdc:mga0sz30_3388_c1 | 3300050516 | Bacteria | 5734 |
| 298 | Ga0500556_0025849 | 3300053104 | Bacteria | 1944 |
| 299 | Ga0500642_0146501 | 3300053130 | Bacteria | 1108 |
| 300 | Ga0500577_0136375 | 3300053142 | Bacteria | 1032 |
| 301 | Ga0500604_0045391 | 3300053151 | Bacteria | 1341 |
| 302 | Ga0500616_0057681 | 3300053153 | Bacteria | 2023 |
| 303 | Ga0500627_0001471 | 3300053158 | Bacteria | 6594 |
| 304 | Ga0466962_0033197 | 3300061719 | Bacteria | 2469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048926 | Ga0496123_0017478 | Ga0496123_0017478_5183_5752 | 178 |
| 2 | 3300047472 | Ga0495686_0055153 | Ga0495686_0055153_17_673 | 185 |
| 3 | 3300005841 | Ga0068863_100021305 | Ga0068863_1000213053 | 186 |
| 4 | 3300026088 | Ga0207641_10015710 | Ga0207641_100157103 | 186 |
| 5 | 3300005353 | Ga0070669_100002566 | Ga0070669_1000025662 | 187 |
| 6 | 3300005367 | Ga0070667_100000082 | Ga0070667_10000008237 | 187 |
| 7 | 3300005548 | Ga0070665_100003904 | Ga0070665_1000039045 | 187 |
| 8 | 3300005617 | Ga0068859_100027390 | Ga0068859_1000273906 | 187 |
| 9 | 3300005842 | Ga0068858_100008035 | Ga0068858_1000080356 | 187 |
| 10 | 3300005843 | Ga0068860_100000011 | Ga0068860_100000011263 | 187 |
| 11 | 3300005844 | Ga0068862_100000012 | Ga0068862_100000012155 | 187 |
| 12 | 3300006931 | Ga0097620_100027390 | Ga0097620_1000273906 | 187 |
| 13 | 3300009101 | Ga0105247_10000007 | Ga0105247_10000007181 | 187 |
| 14 | 3300009177 | Ga0105248_10000114 | Ga0105248_1000011414 | 187 |
| 15 | 3300013306 | Ga0163162_10113707 | Ga0163162_101137072 | 187 |
| 16 | 3300014325 | Ga0163163_10026718 | Ga0163163_100267184 | 187 |
| 17 | 3300014968 | Ga0157379_10015568 | Ga0157379_100155682 | 187 |
| 18 | 3300025900 | Ga0207710_10000013 | Ga0207710_10000013181 | 187 |
| 19 | 3300025923 | Ga0207681_10007174 | Ga0207681_100071745 | 187 |
| 20 | 3300025941 | Ga0207711_10000327 | Ga0207711_1000032730 | 187 |
| 21 | 3300025986 | Ga0207658_10000140 | Ga0207658_1000014010 | 187 |
| 22 | 3300026035 | Ga0207703_10021251 | Ga0207703_100212513 | 187 |
| 23 | 3300028379 | Ga0268266_10008678 | Ga0268266_100086788 | 187 |
| 24 | 3300028380 | Ga0268265_10000016 | Ga0268265_10000016180 | 187 |
| 25 | 3300028381 | Ga0268264_10000026 | Ga0268264_10000026183 | 187 |
| 26 | 3300048903 | Ga0496100_0094715 | Ga0496100_0094715_823_1680 | 187 |
| 27 | 3300048904 | Ga0496101_0042873 | Ga0496101_0042873_1295_2152 | 187 |
| 28 | 3300048905 | Ga0496102_0000124 | Ga0496102_0000124_4959_5816 | 187 |
| 29 | 3300048906 | Ga0496103_0001690 | Ga0496103_0001690_3439_4296 | 187 |
| 30 | 3300048910 | Ga0496107_0042529 | Ga0496107_0042529_321_1178 | 187 |
| 31 | 3300048919 | Ga0496116_0013114 | Ga0496116_0013114_909_1766 | 187 |
| 32 | 3300048920 | Ga0496117_0000401 | Ga0496117_0000401_31797_32654 | 187 |
| 33 | 3300048921 | Ga0496118_0002281 | Ga0496118_0002281_19020_19877 | 187 |
| 34 | 3300048922 | Ga0496119_0008351 | Ga0496119_0008351_4598_5455 | 187 |
| 35 | 3300048923 | Ga0496120_0005957 | Ga0496120_0005957_4566_5423 | 187 |
| 36 | 3300048924 | Ga0496121_0022893 | Ga0496121_0022893_4087_4944 | 187 |
| 37 | 3300048928 | Ga0496125_0106700 | Ga0496125_0106700_969_1826 | 187 |
| 38 | 3300048929 | Ga0496126_0078826 | Ga0496126_0078826_519_1376 | 187 |
| 39 | 3300005367 | Ga0070667_100005464 | Ga0070667_1000054643 | 191 |
| 40 | 3300044694 | Ga0466963_0039097 | Ga0466963_0039097_121_888 | 192 |
| 41 | 3300045976 | Ga0466967_0031464 | Ga0466967_0031464_643_1410 | 192 |
| 42 | 3300045976 | Ga0466967_0433015 | Ga0466967_0433015_31_798 | 192 |
| 43 | 3300049573 | Ga0501037_0014139 | Ga0501037_0014139_4040_4804 | 195 |
| 44 | 3300049579 | Ga0501043_0428178 | Ga0501043_0428178_154_918 | 195 |
| 45 | 3300049580 | Ga0501046_0008973 | Ga0501046_0008973_2343_3107 | 195 |
| 46 | 3300049581 | Ga0501047_0030503 | Ga0501047_0030503_1921_2685 | 195 |
| 47 | 3300049582 | Ga0501048_0012406 | Ga0501048_0012406_128_892 | 195 |
| 48 | 3300049586 | Ga0501070_0064487 | Ga0501070_0064487_177_941 | 195 |
| 49 | 3300049742 | Ga0501080_0156720 | Ga0501080_0156720_1046_1810 | 195 |
| 50 | 3300049822 | Ga0501035_0240067 | Ga0501035_0240067_727_1491 | 195 |
| 51 | 3300049823 | Ga0501044_0004957 | Ga0501044_0004957_1696_2460 | 195 |
| 52 | 3300009553 | Ga0105249_10000001 | Ga0105249_10000001306 | 196 |
| 53 | 3300025961 | Ga0207712_10000006 | Ga0207712_10000006186 | 196 |
| 54 | 3300025944 | Ga0207661_10262088 | Ga0207661_102620882 | 199 |
| 55 | 3300049570 | Ga0501033_0107213 | Ga0501033_0107213_102_869 | 206 |
| 56 | 3300049572 | Ga0501036_0204154 | Ga0501036_0204154_17_784 | 206 |
| 57 | 3300049585 | Ga0501069_0028280 | Ga0501069_0028280_1569_2336 | 206 |
| 58 | 3300006844 | Ga0075428_100009057 | Ga0075428_1000090574 | 210 |
| 59 | 3300006846 | Ga0075430_100003014 | Ga0075430_10000301416 | 210 |
| 60 | 3300006847 | Ga0075431_100067318 | Ga0075431_1000673184 | 210 |
| 61 | 3300005347 | Ga0070668_100004631 | Ga0070668_1000046315 | 211 |
| 62 | 3300025972 | Ga0207668_10043685 | Ga0207668_100436851 | 211 |
| 63 | 3300039450 | Ga0436363_1421662 | Ga0436363_1421662_2852_3601 | 211 |
| 64 | 3300048929 | Ga0496126_0003717 | Ga0496126_0003717_2306_3142 | 211 |
| 65 | 3300053158 | Ga0500627_0001471 | Ga0500627_0001471_4613_5380 | 211 |
| 66 | 3300003792 | Ga0055540_1000036 | Ga0055540_100003682 | 212 |
| 67 | 3300005937 | Ga0081455_10200526 | Ga0081455_102005262 | 212 |
| 68 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021431 | 212 |
| 69 | 3300049823 | Ga0501044_0008915 | Ga0501044_0008915_1659_2465 | 212 |
| 70 | 3300009147 | Ga0114129_10022243 | Ga0114129_100222438 | 213 |
| 71 | 3300025986 | Ga0207658_10003803 | Ga0207658_1000380310 | 213 |
| 72 | 3300044694 | Ga0466963_0298418 | Ga0466963_0298418_95_877 | 213 |
| 73 | 3300044842 | Ga0466957_0091988 | Ga0466957_0091988_433_1215 | 213 |
| 74 | 3300048091 | Ga0495626_0052034 | Ga0495626_0052034_838_1623 | 213 |
| 75 | 3300050507 | nmdc:mga05p37_44599_c1 | nmdc:mga05p37_44599_c1_2309_3064 | 213 |
| 76 | 3300050509 | nmdc:mga0qj67_95786_c1 | nmdc:mga0qj67_95786_c1_113_868 | 213 |
| 77 | 3300050510 | nmdc:mga06r32_56173_c1 | nmdc:mga06r32_56173_c1_2207_2962 | 213 |
| 78 | 3300025914 | Ga0207671_10229929 | Ga0207671_102299292 | 214 |
| 79 | 3300044683 | Ga0466965_0004743 | Ga0466965_0004743_1212_2057 | 214 |
| 80 | 3300044901 | Ga0466960_0000659 | Ga0466960_0000659_2967_3812 | 214 |
| 81 | 3300049569 | Ga0501032_0018538 | Ga0501032_0018538_414_1181 | 214 |
| 82 | 3300049579 | Ga0501043_0186606 | Ga0501043_0186606_330_1043 | 214 |
| 83 | 3300005355 | Ga0070671_100132841 | Ga0070671_1001328412 | 215 |
| 84 | 3300005841 | Ga0068863_100074720 | Ga0068863_1000747202 | 215 |
| 85 | 3300009553 | Ga0105249_10058315 | Ga0105249_100583152 | 215 |
| 86 | 3300014325 | Ga0163163_10068418 | Ga0163163_100684182 | 215 |
| 87 | 3300025931 | Ga0207644_10078678 | Ga0207644_100786782 | 215 |
| 88 | 3300025961 | Ga0207712_10008460 | Ga0207712_100084602 | 215 |
| 89 | 3300025986 | Ga0207658_10096822 | Ga0207658_100968221 | 215 |
| 90 | 3300026088 | Ga0207641_10102525 | Ga0207641_101025251 | 215 |
| 91 | 3300031251 | Ga0265327_10001624 | Ga0265327_100016247 | 215 |
| 92 | 3300044683 | Ga0466965_0039187 | Ga0466965_0039187_231_962 | 215 |
| 93 | 3300045976 | Ga0466967_0297389 | Ga0466967_0297389_156_887 | 215 |
| 94 | 3300048904 | Ga0496101_0036925 | Ga0496101_0036925_2602_3348 | 215 |
| 95 | 3300048907 | Ga0496104_0050052 | Ga0496104_0050052_1275_2021 | 215 |
| 96 | 3300048907 | Ga0496104_0102740 | Ga0496104_0102740_1413_2171 | 215 |
| 97 | 3300048911 | Ga0496108_0048173 | Ga0496108_0048173_1305_2063 | 215 |
| 98 | 3300048913 | Ga0496110_0373475 | Ga0496110_0373475_18_764 | 215 |
| 99 | 3300048915 | Ga0496112_0003265 | Ga0496112_0003265_7171_7929 | 215 |
| 100 | 3300048916 | Ga0496113_0011220 | Ga0496113_0011220_4484_5242 | 215 |
| 101 | 3300026035 | Ga0207703_10482207 | Ga0207703_104822072 | 216 |
| 102 | 3300048903 | Ga0496100_0000011 | Ga0496100_0000011_122277_123008 | 216 |
| 103 | 3300048904 | Ga0496101_0000017 | Ga0496101_0000017_224406_225137 | 216 |
| 104 | 3300048906 | Ga0496103_0000981 | Ga0496103_0000981_6183_6914 | 216 |
| 105 | 3300048909 | Ga0496106_0093917 | Ga0496106_0093917_1338_2069 | 216 |
| 106 | 3300048910 | Ga0496107_0003846 | Ga0496107_0003846_5656_6387 | 216 |
| 107 | 3300048911 | Ga0496108_0026459 | Ga0496108_0026459_1299_2030 | 216 |
| 108 | 3300048912 | Ga0496109_0000179 | Ga0496109_0000179_2756_3487 | 216 |
| 109 | 3300048913 | Ga0496110_0003036 | Ga0496110_0003036_3579_4310 | 216 |
| 110 | 3300048917 | Ga0496114_0008620 | Ga0496114_0008620_2724_3455 | 216 |
| 111 | 3300048918 | Ga0496115_0099398 | Ga0496115_0099398_226_957 | 216 |
| 112 | 3300048919 | Ga0496116_0011148 | Ga0496116_0011148_2118_2849 | 216 |
| 113 | 3300048920 | Ga0496117_0068898 | Ga0496117_0068898_1023_1754 | 216 |
| 114 | 3300048921 | Ga0496118_0120170 | Ga0496118_0120170_131_862 | 216 |
| 115 | 3300048922 | Ga0496119_0006519 | Ga0496119_0006519_5385_6116 | 216 |
| 116 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_376887_377618 | 216 |
| 117 | 3300048925 | Ga0496122_0000084 | Ga0496122_0000084_177638_178369 | 216 |
| 118 | 3300048927 | Ga0496124_0000019 | Ga0496124_0000019_376887_377618 | 216 |
| 119 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_376887_377618 | 216 |
| 120 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_233059_233790 | 216 |
| 121 | 3300009545 | Ga0105237_10022502 | Ga0105237_100225026 | 217 |
| 122 | 3300046460 | Ga0495638_0012805 | Ga0495638_0012805_2818_3582 | 217 |
| 123 | 3300053142 | Ga0500577_0136375 | Ga0500577_0136375_213_977 | 217 |
| 124 | 3300053151 | Ga0500604_0045391 | Ga0500604_0045391_505_1269 | 217 |
| 125 | 3300005367 | Ga0070667_100193328 | Ga0070667_1001933282 | 218 |
| 126 | 3300005435 | Ga0070714_100107706 | Ga0070714_1001077061 | 218 |
| 127 | 3300005548 | Ga0070665_100036049 | Ga0070665_1000360492 | 218 |
| 128 | 3300005841 | Ga0068863_100004304 | Ga0068863_10000430413 | 218 |
| 129 | 3300009092 | Ga0105250_10086200 | Ga0105250_100862002 | 218 |
| 130 | 3300025929 | Ga0207664_10063719 | Ga0207664_100637191 | 218 |
| 131 | 3300028379 | Ga0268266_10038623 | Ga0268266_100386232 | 218 |
| 132 | 3300036712 | Ga0316584_0253364 | Ga0316584_0253364_159_923 | 218 |
| 133 | 3300044658 | Ga0466972_0056046 | Ga0466972_0056046_78_881 | 218 |
| 134 | 3300044735 | Ga0466968_0073516 | Ga0466968_0073516_247_1050 | 218 |
| 135 | 3300050492 | nmdc:mga0yw44_29378_c1 | nmdc:mga0yw44_29378_c1_872_1648 | 218 |
| 136 | 3300005331 | Ga0070670_100128778 | Ga0070670_1001287782 | 219 |
| 137 | 3300005355 | Ga0070671_100003588 | Ga0070671_1000035882 | 219 |
| 138 | 3300025931 | Ga0207644_10018290 | Ga0207644_100182903 | 219 |
| 139 | iso_pu_bacteria | 2902799365 | 2902801088 | 219 |
| 140 | 3300048904 | Ga0496101_0182979 | Ga0496101_0182979_32_865 | 220 |
| 141 | 3300048915 | Ga0496112_0158714 | Ga0496112_0158714_302_1135 | 220 |
| 142 | 3300048916 | Ga0496113_0042037 | Ga0496113_0042037_678_1511 | 220 |
| 143 | 3300048923 | Ga0496120_0105767 | Ga0496120_0105767_231_1064 | 220 |
| 144 | 3300048928 | Ga0496125_0077586 | Ga0496125_0077586_717_1550 | 220 |
| 145 | 3300006028 | Ga0070717_10375151 | Ga0070717_103751512 | 221 |
| 146 | 3300025303 | Ga0209051_1011525 | Ga0209051_10115253 | 221 |
| 147 | 3300025929 | Ga0207664_10524273 | Ga0207664_105242731 | 221 |
| 148 | 3300026121 | Ga0207683_10296783 | Ga0207683_102967831 | 221 |
| 149 | 3300053130 | Ga0500642_0146501 | Ga0500642_0146501_385_1077 | 221 |
| 150 | 3300005353 | Ga0070669_100435927 | Ga0070669_1004359271 | 222 |
| 151 | 3300005354 | Ga0070675_100313469 | Ga0070675_1003134692 | 222 |
| 152 | 3300005440 | Ga0070705_100075477 | Ga0070705_1000754771 | 222 |
| 153 | 3300005459 | Ga0068867_100018541 | Ga0068867_1000185411 | 222 |
| 154 | 3300005466 | Ga0070685_10282671 | Ga0070685_102826712 | 222 |
| 155 | 3300005615 | Ga0070702_100056063 | Ga0070702_1000560633 | 222 |
| 156 | 3300005616 | Ga0068852_100042953 | Ga0068852_1000429535 | 222 |
| 157 | 3300005843 | Ga0068860_100240903 | Ga0068860_1002409032 | 222 |
| 158 | 3300005843 | Ga0068860_100403549 | Ga0068860_1004035492 | 222 |
| 159 | 3300006051 | Ga0075364_10132221 | Ga0075364_101322212 | 222 |
| 160 | 3300006173 | Ga0070716_100021805 | Ga0070716_1000218052 | 222 |
| 161 | 3300006186 | Ga0075369_10037114 | Ga0075369_100371142 | 222 |
| 162 | 3300009098 | Ga0105245_10380914 | Ga0105245_103809142 | 222 |
| 163 | 3300009101 | Ga0105247_10013640 | Ga0105247_100136403 | 222 |
| 164 | 3300009147 | Ga0114129_10333503 | Ga0114129_103335032 | 222 |
| 165 | 3300009148 | Ga0105243_10441627 | Ga0105243_104416271 | 222 |
| 166 | 3300009176 | Ga0105242_10230473 | Ga0105242_102304732 | 222 |
| 167 | 3300013296 | Ga0157374_10022545 | Ga0157374_100225455 | 222 |
| 168 | 3300013306 | Ga0163162_10842098 | Ga0163162_108420981 | 222 |
| 169 | 3300013308 | Ga0157375_10323038 | Ga0157375_103230381 | 222 |
| 170 | 3300014326 | Ga0157380_10153203 | Ga0157380_101532032 | 222 |
| 171 | 3300014745 | Ga0157377_10003499 | Ga0157377_100034997 | 222 |
| 172 | 3300017792 | Ga0163161_10084055 | Ga0163161_100840552 | 222 |
| 173 | 3300025711 | Ga0207696_1072413 | Ga0207696_10724131 | 222 |
| 174 | 3300026121 | Ga0207683_10060762 | Ga0207683_100607622 | 222 |
| 175 | 3300035691 | Ga0373931_0007637 | Ga0373931_0007637_2988_3734 | 222 |
| 176 | 3300048904 | Ga0496101_0109806 | Ga0496101_0109806_379_1125 | 222 |
| 177 | 3300048905 | Ga0496102_0062266 | Ga0496102_0062266_2476_3222 | 222 |
| 178 | 3300048909 | Ga0496106_0053079 | Ga0496106_0053079_899_1645 | 222 |
| 179 | 3300048910 | Ga0496107_0056867 | Ga0496107_0056867_189_935 | 222 |
| 180 | 3300048911 | Ga0496108_0002989 | Ga0496108_0002989_7448_8194 | 222 |
| 181 | 3300048912 | Ga0496109_0000883 | Ga0496109_0000883_22408_23154 | 222 |
| 182 | 3300048913 | Ga0496110_0013171 | Ga0496110_0013171_6048_6794 | 222 |
| 183 | 3300048915 | Ga0496112_0004789 | Ga0496112_0004789_4412_5158 | 222 |
| 184 | 3300048917 | Ga0496114_0061020 | Ga0496114_0061020_1618_2364 | 222 |
| 185 | 3300005578 | Ga0068854_100383385 | Ga0068854_1003833851 | 223 |
| 186 | 3300006048 | Ga0075363_100002541 | Ga0075363_1000025413 | 223 |
| 187 | 3300006051 | Ga0075364_10010922 | Ga0075364_100109227 | 223 |
| 188 | 3300006353 | Ga0075370_10130206 | Ga0075370_101302062 | 223 |
| 189 | 3300031901 | Ga0307406_10023302 | Ga0307406_100233022 | 223 |
| 190 | 3300042004 | Ga0439445_0019510 | Ga0439445_0019510_537_1364 | 223 |
| 191 | 3300042435 | Ga0439434_0003612 | Ga0439434_0003612_292_1119 | 223 |
| 192 | 3300050496 | nmdc:mga07m45_6872_c2 | nmdc:mga07m45_6872_c2_74_847 | 223 |
| 193 | 3300009094 | Ga0111539_11189303 | Ga0111539_111893031 | 224 |
| 194 | 3300048912 | Ga0496109_0063943 | Ga0496109_0063943_1370_2119 | 224 |
| 195 | 3300048915 | Ga0496112_0059663 | Ga0496112_0059663_1696_2445 | 224 |
| 196 | 3300050491 | nmdc:mga00v17_7351_c1 | nmdc:mga00v17_7351_c1_2163_2897 | 224 |
| 197 | 3300003792 | Ga0055540_1008357 | Ga0055540_10083571 | 225 |
| 198 | 3300005356 | Ga0070674_100017167 | Ga0070674_1000171673 | 225 |
| 199 | 3300005466 | Ga0070685_10118489 | Ga0070685_101184892 | 225 |
| 200 | 3300005548 | Ga0070665_100462211 | Ga0070665_1004622112 | 225 |
| 201 | 3300009176 | Ga0105242_10238158 | Ga0105242_102381582 | 225 |
| 202 | 3300009177 | Ga0105248_10024195 | Ga0105248_100241957 | 225 |
| 203 | 3300010375 | Ga0105239_10414579 | Ga0105239_104145792 | 225 |
| 204 | 3300025303 | Ga0209051_1001289 | Ga0209051_10012893 | 225 |
| 205 | 3300025934 | Ga0207686_10188337 | Ga0207686_101883372 | 225 |
| 206 | 3300025937 | Ga0207669_10007813 | Ga0207669_100078133 | 225 |
| 207 | 3300025941 | Ga0207711_10131956 | Ga0207711_101319562 | 225 |
| 208 | 3300025972 | Ga0207668_10119669 | Ga0207668_101196692 | 225 |
| 209 | 3300026118 | Ga0207675_100355463 | Ga0207675_1003554632 | 225 |
| 210 | 3300028379 | Ga0268266_10562573 | Ga0268266_105625731 | 225 |
| 211 | 3300044658 | Ga0466972_0031103 | Ga0466972_0031103_262_1017 | 225 |
| 212 | 3300044735 | Ga0466968_0071201 | Ga0466968_0071201_126_881 | 225 |
| 213 | 3300045836 | Ga0466958_0009251 | Ga0466958_0009251_1371_2126 | 225 |
| 214 | 3300048903 | Ga0496100_0000154 | Ga0496100_0000154_9634_10380 | 225 |
| 215 | 3300048904 | Ga0496101_0000184 | Ga0496101_0000184_21139_21885 | 225 |
| 216 | 3300048907 | Ga0496104_0030541 | Ga0496104_0030541_1459_2205 | 225 |
| 217 | 3300048908 | Ga0496105_0102511 | Ga0496105_0102511_533_1279 | 225 |
| 218 | 3300048909 | Ga0496106_0009098 | Ga0496106_0009098_4488_5234 | 225 |
| 219 | 3300048910 | Ga0496107_0002170 | Ga0496107_0002170_257_1003 | 225 |
| 220 | 3300048917 | Ga0496114_0004263 | Ga0496114_0004263_8339_9085 | 225 |
| 221 | 3300048918 | Ga0496115_0026818 | Ga0496115_0026818_2235_2981 | 225 |
| 222 | 3300061719 | Ga0466962_0033197 | Ga0466962_0033197_866_1621 | 225 |
| 223 | 3300005719 | Ga0068861_100034257 | Ga0068861_1000342574 | 226 |
| 224 | 3300009148 | Ga0105243_10008644 | Ga0105243_100086447 | 226 |
| 225 | 3300009176 | Ga0105242_10002910 | Ga0105242_100029103 | 226 |
| 226 | 3300009177 | Ga0105248_10180806 | Ga0105248_101808062 | 226 |
| 227 | 3300009545 | Ga0105237_10123676 | Ga0105237_101236763 | 226 |
| 228 | 3300009553 | Ga0105249_10007373 | Ga0105249_100073732 | 226 |
| 229 | 3300013297 | Ga0157378_10048936 | Ga0157378_100489363 | 226 |
| 230 | 3300013308 | Ga0157375_10002286 | Ga0157375_100022863 | 226 |
| 231 | 3300014968 | Ga0157379_10035879 | Ga0157379_100358793 | 226 |
| 232 | 3300021384 | Ga0213876_10000482 | Ga0213876_100004829 | 226 |
| 233 | 3300025900 | Ga0207710_10006088 | Ga0207710_100060884 | 226 |
| 234 | 3300025933 | Ga0207706_10031998 | Ga0207706_100319983 | 226 |
| 235 | 3300025934 | Ga0207686_10011595 | Ga0207686_100115953 | 226 |
| 236 | 3300025961 | Ga0207712_10018404 | Ga0207712_100184041 | 226 |
| 237 | 3300039437 | Ga0436365_1318799 | Ga0436365_1318799_12103_12882 | 226 |
| 238 | 3300048903 | Ga0496100_0004825 | Ga0496100_0004825_4874_5620 | 226 |
| 239 | 3300048904 | Ga0496101_0032830 | Ga0496101_0032830_1718_2464 | 226 |
| 240 | 3300048906 | Ga0496103_0007644 | Ga0496103_0007644_4334_5080 | 226 |
| 241 | 3300048909 | Ga0496106_0002366 | Ga0496106_0002366_3782_4528 | 226 |
| 242 | 3300048910 | Ga0496107_0002125 | Ga0496107_0002125_3738_4484 | 226 |
| 243 | 3300048918 | Ga0496115_0001737 | Ga0496115_0001737_8185_8931 | 226 |
| 244 | 3300048928 | Ga0496125_0179324 | Ga0496125_0179324_100_807 | 226 |
| 245 | iso_pu_bacteria | 2738541264 | 2738668185 | 226 |
| 246 | iso_pu_bacteria | 2738541356 | 2739147255 | 226 |
| 247 | 3300005455 | Ga0070663_100004363 | Ga0070663_1000043636 | 227 |
| 248 | 3300009098 | Ga0105245_10336621 | Ga0105245_103366212 | 227 |
| 249 | 3300013308 | Ga0157375_10151125 | Ga0157375_101511251 | 227 |
| 250 | 3300013308 | Ga0157375_10909512 | Ga0157375_109095122 | 227 |
| 251 | 3300025935 | Ga0207709_10150966 | Ga0207709_101509662 | 227 |
| 252 | 3300026067 | Ga0207678_10016783 | Ga0207678_100167834 | 227 |
| 253 | 3300039437 | Ga0436365_0243891 | Ga0436365_0243891_9065_9835 | 227 |
| 254 | 3300048907 | Ga0496104_0398897 | Ga0496104_0398897_245_1069 | 227 |
| 255 | 3300048911 | Ga0496108_0003435 | Ga0496108_0003435_11775_12599 | 227 |
| 256 | 3300048912 | Ga0496109_0005555 | Ga0496109_0005555_6898_7722 | 227 |
| 257 | 3300048913 | Ga0496110_0064224 | Ga0496110_0064224_268_1092 | 227 |
| 258 | 3300048915 | Ga0496112_0017299 | Ga0496112_0017299_154_978 | 227 |
| 259 | 3300048916 | Ga0496113_0041039 | Ga0496113_0041039_2036_2860 | 227 |
| 260 | 3300006186 | Ga0075369_10114103 | Ga0075369_101141032 | 228 |
| 261 | 3300048905 | Ga0496102_0159110 | Ga0496102_0159110_718_1464 | 228 |
| 262 | iso_pu_bacteria | 2902837492 | 2902840671 | 228 |
| 263 | 3300009098 | Ga0105245_10112640 | Ga0105245_101126401 | 229 |
| 264 | 3300026023 | Ga0207677_10009179 | Ga0207677_100091792 | 230 |
| 265 | 3300044683 | Ga0466965_0047554 | Ga0466965_0047554_305_1066 | 230 |
| 266 | 3300044684 | Ga0466966_0018474 | Ga0466966_0018474_3135_3896 | 230 |
| 267 | 3300044693 | Ga0466961_0006753 | Ga0466961_0006753_2658_3419 | 230 |
| 268 | 3300044735 | Ga0466968_0100037 | Ga0466968_0100037_470_1231 | 230 |
| 269 | 3300044765 | Ga0466970_0082233 | Ga0466970_0082233_498_1259 | 230 |
| 270 | 3300044842 | Ga0466957_0016353 | Ga0466957_0016353_340_1101 | 230 |
| 271 | 3300045049 | Ga0466959_0000906 | Ga0466959_0000906_5272_6033 | 230 |
| 272 | 3300045836 | Ga0466958_0001115 | Ga0466958_0001115_1734_2495 | 230 |
| 273 | 3300050516 | nmdc:mga0sz30_3388_c1 | nmdc:mga0sz30_3388_c1_4147_4890 | 230 |
| 274 | 3300005366 | Ga0070659_100059942 | Ga0070659_1000599424 | 231 |
| 275 | iso_pu_bacteria | 2902810491 | 2902814995 | 231 |
| 276 | 3300048911 | Ga0496108_0079873 | Ga0496108_0079873_1218_1970 | 232 |
| 277 | iso_pu_bacteria | 2738543028 | 2739332687 | 232 |
| 278 | 3300013306 | Ga0163162_10128207 | Ga0163162_101282074 | 233 |
| 279 | 3300031251 | Ga0265327_10000081 | Ga0265327_10000081118 | 233 |
| 280 | 3300031251 | Ga0265327_10051697 | Ga0265327_100516972 | 233 |
| 281 | 3300005436 | Ga0070713_100068207 | Ga0070713_1000682073 | 235 |
| 282 | 3300006028 | Ga0070717_10624592 | Ga0070717_106245921 | 235 |
| 283 | 3300025928 | Ga0207700_10075544 | Ga0207700_100755443 | 235 |
| 284 | iso_pu_bacteria | 2902792274 | 2902795947 | 235 |
| 285 | 3300039437 | Ga0436365_0564838 | Ga0436365_0564838_4525_5298 | 236 |
| 286 | 3300046455 | Ga0495603_0040966 | Ga0495603_0040966_1613_2353 | 237 |
| 287 | 3300046459 | Ga0495629_0085659 | Ga0495629_0085659_498_1238 | 237 |
| 288 | 3300046473 | Ga0495582_0048774 | Ga0495582_0048774_1073_1813 | 237 |
| 289 | 3300046517 | Ga0495630_0393719 | Ga0495630_0393719_24_764 | 237 |
| 290 | 3300046642 | Ga0495634_0281320 | Ga0495634_0281320_85_825 | 237 |
| 291 | 3300046681 | Ga0495647_0086493 | Ga0495647_0086493_194_934 | 237 |
| 292 | 3300046683 | Ga0495658_0037145 | Ga0495658_0037145_1243_1983 | 237 |
| 293 | 3300047319 | Ga0495674_0116825 | Ga0495674_0116825_1465_2205 | 237 |
| 294 | 3300047673 | Ga0495593_0003642 | Ga0495593_0003642_1780_2520 | 237 |
| 295 | 3300048089 | Ga0495614_0088370 | Ga0495614_0088370_273_1013 | 237 |
| 296 | 3300048909 | Ga0496106_0272632 | Ga0496106_0272632_506_1246 | 237 |
| 297 | 3300048921 | Ga0496118_0002742 | Ga0496118_0002742_5784_6554 | 238 |
| 298 | 3300049571 | Ga0501034_0373797 | Ga0501034_0373797_104_847 | 238 |
| 299 | 3300053104 | Ga0500556_0025849 | Ga0500556_0025849_113_877 | 238 |
| 300 | 3300053153 | Ga0500616_0057681 | Ga0500616_0057681_1184_1927 | 238 |
| 301 | 3300006051 | Ga0075364_10035598 | Ga0075364_100355983 | 239 |
| 302 | 3300006353 | Ga0075370_10008948 | Ga0075370_100089484 | 239 |
| 303 | 3300046694 | Ga0495649_0128163 | Ga0495649_0128163_306_1052 | 239 |
| 304 | 3300050496 | nmdc:mga07m45_92737_c1 | nmdc:mga07m45_92737_c1_857_1615 | 239 |
| 305 | 3300050516 | nmdc:mga0sz30_26490_c1 | nmdc:mga0sz30_26490_c1_812_1570 | 239 |
| 306 | 3300046690 | Ga0495624_0058514 | Ga0495624_0058514_804_1586 | 241 |
| 307 | 3300003320 | rootH2_10070522 | rootH2_100705226 | 243 |
| 308 | 3300044719 | Ga0466971_0027942 | Ga0466971_0027942_1108_1875 | 243 |
| 309 | 3300044901 | Ga0466960_0016639 | Ga0466960_0016639_327_1094 | 243 |
| 310 | 3300045836 | Ga0466958_0089304 | Ga0466958_0089304_422_1189 | 243 |
| 311 | 3300045976 | Ga0466967_0115839 | Ga0466967_0115839_1086_1853 | 243 |
| 312 | iso_pu_bacteria | 2939582691 | 2939585831 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar