F401919

General Info

Members Datasets Scaffolds Average Seq Length
312 190 312 248

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0045701|Ga0500556_0045701_426_1349
Length 299
Sequence MDPVRTTQPGLASCSVAEALAQVTEASRRRSDHSPSINLSSFTLFCILFYKINSITMALFKSGNPALSEKAFAKSISVPYGEAMTVNGTLNKFGILFLLTMATAGYAWKMFYSGVDVTTYIGIALVIAFKMEWSAYLAPIYALVKGFAIGAISAFYNFAFEKIAPDIITQAVALTFGVAISMFLLYKFNIIKATPTFKKIIITATMGIAVFYLIAIGLHFVNIDIPFLHEGSTFGIIFSLVVVGLAAMNLILDFDMIENGAKAGAPKYMEWYGAFGLLVTIVWLYLEILRLLSKFASRK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0
Rhizoplane 1.92
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10116967 3300003316 Bacteria 1596
2 rootH1_10116967 3300003323 Bacteria 1426
3 rootH2_10162261 3300003320 Bacteria 1671
4 rootL2_10112692 3300003322 Bacteria 1815
5 rootL2_10215964 3300003322 Bacteria 1826
6 rootL2_10328238 3300003322 Unclassified 1652
7 Ga0065714_10178606 3300005288 Bacteria 972
8 Ga0065712_10260751 3300005290 Bacteria 937
9 Ga0070658_10000626 3300005327 Bacteria 30535
10 Ga0070658_10110297 3300005327 Bacteria 2279
11 Ga0070676_10004792 3300005328 Bacteria 7156
12 Ga0070676_10052730 3300005328 Bacteria 2393
13 Ga0070690_100019327 3300005330 Bacteria 4132
14 Ga0070670_100176326 3300005331 Bacteria 1855
15 Ga0070677_10187989 3300005333 Unclassified 988
16 Ga0068869_100007191 3300005334 Bacteria 7097
17 Ga0070666_10000039 3300005335 Bacteria 115360
18 Ga0070666_10000584 3300005335 Bacteria 22009
19 Ga0070680_100002533 3300005336 Bacteria 13539
20 Ga0070682_100000019 3300005337 Bacteria 220844
21 Ga0070682_100000300 3300005337 Bacteria 34454
22 Ga0070682_100045715 3300005337 Bacteria 2715
23 Ga0068868_100000280 3300005338 Bacteria 34319
24 Ga0068868_100179672 3300005338 Bacteria 1755
25 Ga0068868_100724853 3300005338 Unclassified 891
26 Ga0070660_100310738 3300005339 Bacteria 1293
27 Ga0070689_100128964 3300005340 Bacteria 2027
28 Ga0070691_10009046 3300005341 Unclassified 4556
29 Ga0070668_100000267 3300005347 Bacteria 34430
30 Ga0070668_100140583 3300005347 Bacteria 1945
31 Ga0070669_100498691 3300005353 Bacteria 1010
32 Ga0070675_100039357 3300005354 Bacteria 3858
33 Ga0070675_100243516 3300005354 Bacteria 1572
34 Ga0070671_100126045 3300005355 Bacteria 2156
35 Ga0070674_100071496 3300005356 Bacteria 2454
36 Ga0070674_100111663 3300005356 Bacteria 2008
37 Ga0070674_100305746 3300005356 Bacteria 1269
38 Ga0070673_100000422 3300005364 Bacteria 22381
39 Ga0070673_100042045 3300005364 Bacteria 3521
40 Ga0070673_100089473 3300005364 Bacteria 2513
41 Ga0070688_100154768 3300005365 Bacteria 1570
42 Ga0070667_100001041 3300005367 Bacteria 25338
43 Ga0070667_100063663 3300005367 Bacteria 3126
44 Ga0070667_100134572 3300005367 Bacteria 2160
45 Ga0070709_10453681 3300005434 Unclassified 966
46 Ga0070713_100159747 3300005436 Unclassified 2011
47 Ga0070678_100051508 3300005456 Bacteria 2985
48 Ga0070678_100631161 3300005456 Bacteria 959
49 Ga0070662_100006142 3300005457 Bacteria 7724
50 Ga0070662_100291221 3300005457 Bacteria 1324
51 Ga0070681_10193977 3300005458 Unclassified 1950
52 Ga0068867_100003004 3300005459 Bacteria 11885
53 Ga0068867_100006240 3300005459 Bacteria 8439
54 Ga0068867_100192849 3300005459 Bacteria 1627
55 Ga0070679_100014769 3300005530 Bacteria 7503
56 Ga0068853_100012761 3300005539 Bacteria 6841
57 Ga0068853_100037915 3300005539 Bacteria 4104
58 Ga0068853_100075221 3300005539 Bacteria 2947
59 Ga0068853_100698801 3300005539 Unclassified 967
60 Ga0068853_100709172 3300005539 Unclassified 960
61 Ga0070672_100000310 3300005543 Bacteria 27579
62 Ga0070672_100044059 3300005543 Bacteria 3445
63 Ga0070672_100632690 3300005543 Bacteria 934
64 Ga0070693_100030155 3300005547 Bacteria 2964
65 Ga0070665_100000916 3300005548 Bacteria 37835
66 Ga0070704_100395836 3300005549 Bacteria 1177
67 Ga0068855_100010676 3300005563 Bacteria 11082
68 Ga0068855_100031414 3300005563 Bacteria 6342
69 Ga0068855_100045306 3300005563 Bacteria 5202
70 Ga0070664_100214322 3300005564 Bacteria 1721
71 Ga0068857_100011134 3300005577 Bacteria 7822
72 Ga0068856_100051939 3300005614 Bacteria 4042
73 Ga0068852_100019700 3300005616 Bacteria 5347
74 Ga0068852_100319117 3300005616 Bacteria 1508
75 Ga0068852_100376769 3300005616 Bacteria 1391
76 Ga0068859_100265261 3300005617 Bacteria 1809
77 Ga0068859_100317165 3300005617 Bacteria 1652
78 Ga0068864_100000239 3300005618 Bacteria 49175
79 Ga0068861_100016871 3300005719 Bacteria 5175
80 Ga0068861_100091955 3300005719 Bacteria 2396
81 Ga0068851_10000885 3300005834 Bacteria 12933
82 Ga0068851_10010917 3300005834 Bacteria 4248
83 Ga0068851_10033963 3300005834 Bacteria 2544
84 Ga0068851_10233920 3300005834 Unclassified 1037
85 Ga0068863_100002445 3300005841 Bacteria 18454
86 Ga0068863_100002733 3300005841 Bacteria 17442
87 Ga0068863_100013341 3300005841 Bacteria 7923
88 Ga0068858_100000453 3300005842 Bacteria 42983
89 Ga0068858_100070391 3300005842 Bacteria 3243
90 Ga0068860_100002296 3300005843 Bacteria 20099
91 Ga0068860_100014923 3300005843 Bacteria 7596
92 Ga0068862_100135941 3300005844 Bacteria 2178
93 Ga0081455_10426424 3300005937 Unclassified 913
94 Ga0070715_10235143 3300006163 Unclassified 950
95 Ga0075366_10121084 3300006195 Bacteria 1577
96 Ga0097621_100004880 3300006237 Bacteria 9402
97 Ga0097621_100005359 3300006237 Bacteria 9037
98 Ga0097621_100020731 3300006237 Bacteria 5070
99 Ga0068871_100007116 3300006358 Bacteria 7976
100 Ga0068871_100014364 3300006358 Bacteria 5903
101 Ga0075431_100459789 3300006847 Bacteria 1267
102 Ga0068865_100000806 3300006881 Bacteria 17617
103 Ga0097620_100265264 3300006931 Bacteria 1809
104 Ga0097620_100317184 3300006931 Bacteria 1652
105 Ga0105240_10029839 3300009093 Bacteria 7097
106 Ga0105240_10037401 3300009093 Bacteria 6239
107 Ga0105240_10053573 3300009093 Bacteria 5063
108 Ga0111539_10288760 3300009094 Bacteria 1909
109 Ga0105245_10512517 3300009098 Bacteria 1217
110 Ga0105247_10248943 3300009101 Bacteria 1214
111 Ga0114129_10016609 3300009147 Bacteria 10484
112 Ga0105243_10037945 3300009148 Bacteria 3748
113 Ga0105243_10259596 3300009148 Bacteria 1555
114 Ga0105241_10054669 3300009174 Bacteria 3057
115 Ga0105241_10423560 3300009174 Unclassified 1172
116 Ga0105242_10152387 3300009176 Unclassified 2017
117 Ga0105248_10000007 3300009177 Bacteria 471250
118 Ga0105248_10011927 3300009177 Bacteria 9585
119 Ga0105248_10023099 3300009177 Bacteria 6907
120 Ga0105237_10007492 3300009545 Bacteria 11935
121 Ga0105237_10103703 3300009545 Bacteria 2836
122 Ga0105237_10507488 3300009545 Bacteria 1213
123 Ga0105237_10567273 3300009545 Unclassified 1142
124 Ga0105238_10252250 3300009551 Bacteria 1743
125 Ga0105249_10032531 3300009553 Bacteria 4719
126 Ga0105239_10022857 3300010375 Bacteria 6894
127 Ga0105239_10054216 3300010375 Bacteria 4397
128 Ga0105246_10084158 3300011119 Unclassified 2274
129 Ga0105246_10345000 3300011119 Bacteria 1218
130 Ga0157370_10013306 3300013104 Bacteria 8476
131 Ga0157370_10189750 3300013104 Bacteria 1908
132 Ga0157370_10298029 3300013104 Bacteria 1489
133 Ga0157369_10650405 3300013105 Bacteria 1087
134 Ga0157374_10000168 3300013296 Bacteria 60649
135 Ga0157378_10019208 3300013297 Bacteria 6006
136 Ga0157378_10022348 3300013297 Bacteria 5567
137 Ga0157378_10738631 3300013297 Bacteria 1006
138 Ga0163162_10001104 3300013306 Bacteria 25036
139 Ga0163162_10010735 3300013306 Bacteria 8910
140 Ga0163162_10024216 3300013306 Bacteria 5990
141 Ga0163162_10162254 3300013306 Bacteria 2357
142 Ga0163162_10369862 3300013306 Bacteria 1567
143 Ga0157372_10031774 3300013307 Bacteria 5783
144 Ga0157372_10359101 3300013307 Bacteria 1697
145 Ga0157372_10570256 3300013307 Bacteria 1319
146 Ga0157372_10993629 3300013307 Unclassified 972
147 Ga0157375_10001148 3300013308 Bacteria 22891
148 Ga0157375_10018119 3300013308 Bacteria 6380
149 Ga0157375_10118677 3300013308 Bacteria 2752
150 Ga0163163_10000271 3300014325 Bacteria 52036
151 Ga0157380_10000588 3300014326 Bacteria 22425
152 Ga0157380_10012234 3300014326 Bacteria 6216
153 Ga0157380_10034242 3300014326 Bacteria 3916
154 Ga0157380_10037222 3300014326 Bacteria 3769
155 Ga0157380_10715697 3300014326 Bacteria 1008
156 Ga0157379_10000810 3300014968 Bacteria 25369
157 Ga0157379_10016526 3300014968 Bacteria 6491
158 Ga0157379_10029737 3300014968 Bacteria 4857
159 Ga0157379_10096983 3300014968 Bacteria 2646
160 Ga0157379_10291142 3300014968 Bacteria 1487
161 Ga0157376_10005679 3300014969 Bacteria 8738
162 Ga0157376_10007883 3300014969 Bacteria 7637
163 Ga0157376_10173865 3300014969 Bacteria 1963
164 Ga0157376_10196127 3300014969 Bacteria 1855
165 Ga0157376_10362850 3300014969 Bacteria 1390
166 Ga0163161_10034527 3300017792 Bacteria 3619
167 Ga0163161_10037684 3300017792 Bacteria 3467
168 Ga0163161_10179853 3300017792 Bacteria 1621
169 Ga0209646_1002869 3300025246 Bacteria 3598
170 Ga0207656_10001969 3300025321 Bacteria 6835
171 Ga0207656_10022161 3300025321 Bacteria 2546
172 Ga0207682_10010612 3300025893 Bacteria 3606
173 Ga0207680_10000149 3300025903 Bacteria 33836
174 Ga0207645_10037573 3300025907 Bacteria 3107
175 Ga0207705_10001456 3300025909 Bacteria 18884
176 Ga0207705_10109724 3300025909 Bacteria 2038
177 Ga0207654_10031268 3300025911 Bacteria 2931
178 Ga0207654_10191378 3300025911 Bacteria 1341
179 Ga0207707_10000353 3300025912 Bacteria 48229
180 Ga0207695_10040358 3300025913 Bacteria 5006
181 Ga0207695_10098979 3300025913 Bacteria 2914
182 Ga0207660_10025794 3300025917 Unclassified 3994
183 Ga0207657_10512100 3300025919 Bacteria 939
184 Ga0207652_10000925 3300025921 Bacteria 27608
185 Ga0207694_10249555 3300025924 Bacteria 1452
186 Ga0207659_10011506 3300025926 Bacteria 5591
187 Ga0207659_10033661 3300025926 Bacteria 3530
188 Ga0207644_10307293 3300025931 Bacteria 1279
189 Ga0207706_10029010 3300025933 Bacteria 4940
190 Ga0207709_10175826 3300025935 Bacteria 1507
191 Ga0207704_10003294 3300025938 Bacteria 7337
192 Ga0207665_10158026 3300025939 Bacteria 1628
193 Ga0207691_10000234 3300025940 Bacteria 54055
194 Ga0207691_10001372 3300025940 Bacteria 24295
195 Ga0207691_10019888 3300025940 Bacteria 6351
196 Ga0207691_10189979 3300025940 Bacteria 1791
197 Ga0207691_10397385 3300025940 Unclassified 1176
198 Ga0207711_10000014 3300025941 Bacteria 506753
199 Ga0207711_10021486 3300025941 Bacteria 5392
200 Ga0207711_10027850 3300025941 Bacteria 4750
201 Ga0207679_10029476 3300025945 Bacteria 3822
202 Ga0207667_10031292 3300025949 Bacteria 5745
203 Ga0207667_10102060 3300025949 Bacteria 2959
204 Ga0207667_10718006 3300025949 Unclassified 1001
205 Ga0207651_10007031 3300025960 Bacteria 5965
206 Ga0207712_10238012 3300025961 Bacteria 1465
207 Ga0207668_10428676 3300025972 Bacteria 1124
208 Ga0207658_10000950 3300025986 Bacteria 23916
209 Ga0207658_10104496 3300025986 Bacteria 2226
210 Ga0207677_10109398 3300026023 Bacteria 2055
211 Ga0207677_10398062 3300026023 Bacteria 1167
212 Ga0207703_10064758 3300026035 Bacteria 3001
213 Ga0207639_10015758 3300026041 Bacteria 5333
214 Ga0207639_10028109 3300026041 Bacteria 4103
215 Ga0207639_10113731 3300026041 Bacteria 2211
216 Ga0207639_10154863 3300026041 Bacteria 1924
217 Ga0207639_10308763 3300026041 Bacteria 1401
218 Ga0207639_10392239 3300026041 Unclassified 1249
219 Ga0207641_10001042 3300026088 Bacteria 28066
220 Ga0207641_10021211 3300026088 Bacteria 5340
221 Ga0207648_10002569 3300026089 Bacteria 19457
222 Ga0207648_10081487 3300026089 Bacteria 2823
223 Ga0207648_10155025 3300026089 Bacteria 2022
224 Ga0207648_10810648 3300026089 Bacteria 872
225 Ga0207676_10004399 3300026095 Bacteria 9965
226 Ga0207676_10325432 3300026095 Bacteria 1413
227 Ga0207674_10093071 3300026116 Bacteria 3003
228 Ga0207675_100023157 3300026118 Bacteria 5776
229 Ga0207683_10141899 3300026121 Bacteria 2165
230 Ga0207683_10643537 3300026121 Unclassified 982
231 Ga0207698_10012111 3300026142 Bacteria 5628
232 Ga0207698_10293646 3300026142 Bacteria 1510
233 Ga0268266_10003852 3300028379 Bacteria 14643
234 Ga0268264_10034514 3300028381 Bacteria 4162
235 Ga0307515_10000001 3300028794 Bacteria 4259510
236 Ga0307515_10000021 3300028794 Bacteria 406008
237 Ga0265324_10036938 3300029957 Bacteria 1698
238 Ga0307511_10000232 3300030521 Bacteria 56875
239 Ga0265327_10000013 3300031251 Bacteria 519549
240 Ga0307509_10067967 3300031507 Bacteria 3730
241 Ga0307516_10250948 3300031730 Bacteria 1464
242 Ga0307414_10450199 3300032004 Unclassified 1129
243 Ga0373955_0044312 3300035172 Bacteria 2396
244 Ga0373935_0286953 3300035692 Bacteria 1160
245 Ga0373937_0125430 3300036401 Bacteria 2395
246 Ga0451802_1520215 3300041460 Bacteria 1093
247 Ga0451804_1175346 3300041463 Unclassified 704
248 Ga0451841_0052136 3300041498 Bacteria 1525
249 Ga0451853_1796454 3300041512 Unclassified 938
250 Ga0451853_2178756 3300041512 Unclassified 1331
251 Ga0439433_0067554 3300041999 Unclassified 858
252 Ga0466969_0000545 3300044656 Bacteria 20641
253 Ga0466972_0000021 3300044658 Bacteria 196266
254 Ga0466972_0000243 3300044658 Bacteria 37165
255 Ga0466965_0099431 3300044683 Bacteria 1487
256 Ga0466966_0000022 3300044684 Bacteria 112729
257 Ga0466964_0030796 3300044706 Bacteria 2125
258 Ga0466970_0000973 3300044765 Bacteria 13781
259 Ga0466970_0195855 3300044765 Unclassified 1124
260 Ga0466957_0001395 3300044842 Bacteria 12603
261 Ga0466959_0000055 3300045049 Bacteria 78801
262 Ga0495629_0060756 3300046459 Bacteria 2641
263 Ga0495580_0166441 3300046472 Bacteria 1525
264 Ga0495582_0077566 3300046473 Bacteria 1843
265 Ga0495664_0096938 3300046477 Bacteria 1775
266 Ga0495608_0316939 3300046511 Bacteria 964
267 Ga0495586_0077853 3300046535 Bacteria 1819
268 Ga0495621_0096691 3300046539 Bacteria 1119
269 Ga0495645_0171613 3300046543 Bacteria 1493
270 Ga0495668_0000202 3300046616 Bacteria 87083
271 Ga0495658_0109620 3300046683 Bacteria 1658
272 Ga0495670_0170774 3300046691 Bacteria 1145
273 Ga0495581_0236379 3300047315 Bacteria 1069
274 Ga0495672_0048768 3300047320 Unclassified 2510
275 Ga0496103_0425973 3300048906 Bacteria 852
276 Ga0496104_0427219 3300048907 Bacteria 1237
277 Ga0496108_0078457 3300048911 Bacteria 2795
278 Ga0496108_0709113 3300048911 Unclassified 872
279 Ga0501034_0000004 3300049571 Bacteria 382255
280 Ga0501034_0085641 3300049571 Bacteria 3152
281 Ga0501034_0130522 3300049571 Bacteria 2496
282 Ga0501034_0282314 3300049571 Unclassified 1600
283 Ga0501042_0291025 3300049578 Bacteria 1180
284 Ga0501047_0030289 3300049581 Bacteria 5218
285 Ga0501047_0117139 3300049581 Bacteria 2545
286 Ga0501067_0024184 3300049583 Bacteria 3368
287 Ga0501068_0297758 3300049584 Unclassified 1032
288 Ga0501069_0056749 3300049585 Bacteria 2182
289 Ga0501073_0058420 3300049589 Bacteria 2695
290 Ga0501076_0294697 3300049592 Bacteria 1329
291 Ga0501257_070728 3300049686 Bacteria 891
292 Ga0501044_0099039 3300049823 Bacteria 2934
293 Ga0501044_0381675 3300049823 Unclassified 1324
294 Ga0501044_0598570 3300049823 Unclassified 996
295 nmdc:mga0k408_148358_c1 3300050493 Unclassified 1396
296 nmdc:mga0k408_365530_c1 3300050493 Unclassified 860
297 nmdc:mga05p37_11602_c1 3300050507 Bacteria 10500
298 Ga0500578_0147161 3300053086 Bacteria 1469
299 Ga0500583_0000011 3300053092 Bacteria 160380
300 Ga0500583_0000719 3300053092 Bacteria 9634
301 Ga0500556_0045701 3300053104 Bacteria 1564
302 Ga0500652_019418 3300053131 Bacteria 2525
303 Ga0500559_0031818 3300053136 Bacteria 2264
304 Ga0500588_0023833 3300053146 Bacteria 1683
305 Ga0500604_0054323 3300053151 Bacteria 1244
306 Ga0500622_0018973 3300053156 Bacteria 3654
307 Ga0500639_155091 3300053163 Unclassified 1050
308 Ga0500636_0116689 3300053177 Bacteria 1502
309 Ga0500637_0139991 3300053178 Bacteria 1401
310 Ga0501084_0244486 3300054114 Bacteria 1514
311 Ga0501082_0330274 3300060353 Bacteria 1329
312 Ga0466962_0122207 3300061719 Bacteria 1257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_1175346 Ga0451804_1175346_36_665 209
2 3300061719 Ga0466962_0122207 Ga0466962_0122207_480_1118 211
3 3300048906 Ga0496103_0425973 Ga0496103_0425973_28_699 215
4 3300041999 Ga0439433_0067554 Ga0439433_0067554_28_690 220
5 3300046539 Ga0495621_0096691 Ga0495621_0096691_28_693 221
6 3300005288 Ga0065714_10178606 Ga0065714_101786061 224
7 3300048911 Ga0496108_0709113 Ga0496108_0709113_53_751 231
8 3300046477 Ga0495664_0096938 Ga0495664_0096938_834_1589 232
9 3300005335 Ga0070666_10000039 Ga0070666_1000003920 234
10 3300005616 Ga0068852_100019700 Ga0068852_1000197003 234
11 3300005719 Ga0068861_100091955 Ga0068861_1000919552 234
12 3300005834 Ga0068851_10033963 Ga0068851_100339633 234
13 3300005841 Ga0068863_100002733 Ga0068863_10000273310 234
14 3300009148 Ga0105243_10037945 Ga0105243_100379453 234
15 3300009545 Ga0105237_10007492 Ga0105237_100074923 234
16 3300011119 Ga0105246_10084158 Ga0105246_100841581 234
17 3300025321 Ga0207656_10022161 Ga0207656_100221612 234
18 3300025903 Ga0207680_10000149 Ga0207680_100001497 234
19 3300026023 Ga0207677_10398062 Ga0207677_103980621 234
20 3300026089 Ga0207648_10155025 Ga0207648_101550252 234
21 3300026142 Ga0207698_10012111 Ga0207698_100121114 234
22 3300005333 Ga0070677_10187989 Ga0070677_101879891 236
23 3300005356 Ga0070674_100071496 Ga0070674_1000714962 236
24 3300014326 Ga0157380_10000588 Ga0157380_1000058815 236
25 3300005327 Ga0070658_10000626 Ga0070658_1000062610 238
26 3300005328 Ga0070676_10004792 Ga0070676_100047924 238
27 3300005334 Ga0068869_100007191 Ga0068869_1000071912 238
28 3300005335 Ga0070666_10000584 Ga0070666_1000058413 238
29 3300005338 Ga0068868_100000280 Ga0068868_10000028015 238
30 3300005347 Ga0070668_100000267 Ga0070668_10000026716 238
31 3300005364 Ga0070673_100000422 Ga0070673_10000042214 238
32 3300005367 Ga0070667_100001041 Ga0070667_1000010416 238
33 3300005457 Ga0070662_100006142 Ga0070662_1000061425 238
34 3300005539 Ga0068853_100037915 Ga0068853_1000379153 238
35 3300005543 Ga0070672_100000310 Ga0070672_1000003105 238
36 3300005548 Ga0070665_100000916 Ga0070665_1000009167 238
37 3300005563 Ga0068855_100045306 Ga0068855_1000453063 238
38 3300005564 Ga0070664_100214322 Ga0070664_1002143222 238
39 3300005617 Ga0068859_100265261 Ga0068859_1002652612 238
40 3300005618 Ga0068864_100000239 Ga0068864_10000023936 238
41 3300005719 Ga0068861_100016871 Ga0068861_1000168713 238
42 3300005834 Ga0068851_10000885 Ga0068851_100008855 238
43 3300005841 Ga0068863_100002445 Ga0068863_10000244515 238
44 3300005842 Ga0068858_100000453 Ga0068858_1000004533 238
45 3300005843 Ga0068860_100002296 Ga0068860_10000229614 238
46 3300006237 Ga0097621_100004880 Ga0097621_1000048804 238
47 3300006358 Ga0068871_100007116 Ga0068871_1000071164 238
48 3300006881 Ga0068865_100000806 Ga0068865_1000008065 238
49 3300006931 Ga0097620_100265264 Ga0097620_1002652642 238
50 3300025321 Ga0207656_10001969 Ga0207656_100019692 238
51 3300025907 Ga0207645_10037573 Ga0207645_100375733 238
52 3300025909 Ga0207705_10001456 Ga0207705_1000145610 238
53 3300025919 Ga0207657_10512100 Ga0207657_105121002 238
54 3300025938 Ga0207704_10003294 Ga0207704_100032945 238
55 3300025940 Ga0207691_10000234 Ga0207691_1000023419 238
56 3300025941 Ga0207711_10027850 Ga0207711_100278503 238
57 3300025961 Ga0207712_10238012 Ga0207712_102380122 238
58 3300025986 Ga0207658_10000950 Ga0207658_1000095015 238
59 3300026041 Ga0207639_10015758 Ga0207639_100157583 238
60 3300026088 Ga0207641_10001042 Ga0207641_1000104211 238
61 3300026089 Ga0207648_10002569 Ga0207648_1000256913 238
62 3300026095 Ga0207676_10004399 Ga0207676_100043998 238
63 3300026118 Ga0207675_100023157 Ga0207675_1000231573 238
64 3300028379 Ga0268266_10003852 Ga0268266_100038525 238
65 3300046472 Ga0495580_0166441 Ga0495580_0166441_782_1501 238
66 3300005338 Ga0068868_100724853 Ga0068868_1007248531 239
67 3300005834 Ga0068851_10233920 Ga0068851_102339201 239
68 3300009545 Ga0105237_10507488 Ga0105237_105074882 239
69 3300026121 Ga0207683_10643537 Ga0207683_106435371 239
70 3300035692 Ga0373935_0286953 Ga0373935_0286953_389_1144 239
71 3300005290 Ga0065712_10260751 Ga0065712_102607511 240
72 3300005331 Ga0070670_100176326 Ga0070670_1001763261 240
73 3300005347 Ga0070668_100140583 Ga0070668_1001405832 240
74 3300005354 Ga0070675_100039357 Ga0070675_1000393572 240
75 3300005364 Ga0070673_100042045 Ga0070673_1000420454 240
76 3300014326 Ga0157380_10034242 Ga0157380_100342423 240
77 3300025893 Ga0207682_10010612 Ga0207682_100106123 240
78 3300025926 Ga0207659_10033661 Ga0207659_100336612 240
79 3300025940 Ga0207691_10001372 Ga0207691_100013725 240
80 3300025972 Ga0207668_10428676 Ga0207668_104286762 240
81 3300026095 Ga0207676_10325432 Ga0207676_103254322 240
82 3300026121 Ga0207683_10141899 Ga0207683_101418992 240
83 3300009177 Ga0105248_10000007 Ga0105248_10000007367 241
84 3300014968 Ga0157379_10096983 Ga0157379_100969834 241
85 3300025941 Ga0207711_10000014 Ga0207711_1000001446 241
86 3300031507 Ga0307509_10067967 Ga0307509_100679673 243
87 3300053104 Ga0500556_0045701 Ga0500556_0045701_426_1349 243
88 3300053131 Ga0500652_019418 Ga0500652_019418_864_1787 243
89 3300025246 Ga0209646_1002869 Ga0209646_10028691 244
90 3300025940 Ga0207691_10397385 Ga0207691_103973851 245
91 3300026089 Ga0207648_10810648 Ga0207648_108106481 245
92 3300005436 Ga0070713_100159747 Ga0070713_1001597472 246
93 3300006847 Ga0075431_100459789 Ga0075431_1004597892 246
94 3300049578 Ga0501042_0291025 Ga0501042_0291025_122_865 246
95 3300049592 Ga0501076_0294697 Ga0501076_0294697_143_886 246
96 3300060353 Ga0501082_0330274 Ga0501082_0330274_178_921 246
97 3300005330 Ga0070690_100019327 Ga0070690_1000193273 247
98 3300005338 Ga0068868_100179672 Ga0068868_1001796721 247
99 3300005340 Ga0070689_100128964 Ga0070689_1001289642 247
100 3300005355 Ga0070671_100126045 Ga0070671_1001260452 247
101 3300005365 Ga0070688_100154768 Ga0070688_1001547682 247
102 3300005367 Ga0070667_100063663 Ga0070667_1000636632 247
103 3300005457 Ga0070662_100291221 Ga0070662_1002912212 247
104 3300005543 Ga0070672_100044059 Ga0070672_1000440592 247
105 3300005617 Ga0068859_100317165 Ga0068859_1003171652 247
106 3300005842 Ga0068858_100070391 Ga0068858_1000703911 247
107 3300005843 Ga0068860_100014923 Ga0068860_1000149236 247
108 3300006931 Ga0097620_100317184 Ga0097620_1003171842 247
109 3300009098 Ga0105245_10512517 Ga0105245_105125172 247
110 3300009177 Ga0105248_10023099 Ga0105248_100230997 247
111 3300013297 Ga0157378_10738631 Ga0157378_107386311 247
112 3300013306 Ga0163162_10024216 Ga0163162_100242165 247
113 3300013308 Ga0157375_10018119 Ga0157375_100181195 247
114 3300014968 Ga0157379_10029737 Ga0157379_100297371 247
115 3300014969 Ga0157376_10196127 Ga0157376_101961272 247
116 3300017792 Ga0163161_10034527 Ga0163161_100345275 247
117 3300025931 Ga0207644_10307293 Ga0207644_103072932 247
118 3300025940 Ga0207691_10019888 Ga0207691_100198884 247
119 3300025941 Ga0207711_10021486 Ga0207711_100214862 247
120 3300026023 Ga0207677_10109398 Ga0207677_101093982 247
121 3300028381 Ga0268264_10034514 Ga0268264_100345144 247
122 iso_pu_bacteria 2738541278 2738724794 247
123 3300005336 Ga0070680_100002533 Ga0070680_1000025336 248
124 3300005337 Ga0070682_100000300 Ga0070682_10000030032 248
125 3300005337 Ga0070682_100045715 Ga0070682_1000457152 248
126 3300005339 Ga0070660_100310738 Ga0070660_1003107382 248
127 3300005341 Ga0070691_10009046 Ga0070691_100090467 248
128 3300005456 Ga0070678_100051508 Ga0070678_1000515082 248
129 3300005456 Ga0070678_100631161 Ga0070678_1006311611 248
130 3300005458 Ga0070681_10193977 Ga0070681_101939772 248
131 3300005459 Ga0068867_100003004 Ga0068867_1000030045 248
132 3300005530 Ga0070679_100014769 Ga0070679_10001476911 248
133 3300005539 Ga0068853_100012761 Ga0068853_1000127617 248
134 3300005539 Ga0068853_100709172 Ga0068853_1007091721 248
135 3300005547 Ga0070693_100030155 Ga0070693_1000301552 248
136 3300005563 Ga0068855_100031414 Ga0068855_1000314149 248
137 3300005616 Ga0068852_100319117 Ga0068852_1003191172 248
138 3300005834 Ga0068851_10010917 Ga0068851_100109175 248
139 3300005844 Ga0068862_100135941 Ga0068862_1001359413 248
140 3300006237 Ga0097621_100005359 Ga0097621_1000053594 248
141 3300009093 Ga0105240_10029839 Ga0105240_100298398 248
142 3300009093 Ga0105240_10037401 Ga0105240_100374014 248
143 3300009101 Ga0105247_10248943 Ga0105247_102489432 248
144 3300009148 Ga0105243_10259596 Ga0105243_102595962 248
145 3300009174 Ga0105241_10054669 Ga0105241_100546692 248
146 3300009176 Ga0105242_10152387 Ga0105242_101523871 248
147 3300009177 Ga0105248_10011927 Ga0105248_100119276 248
148 3300009545 Ga0105237_10567273 Ga0105237_105672731 248
149 3300009551 Ga0105238_10252250 Ga0105238_102522502 248
150 3300009553 Ga0105249_10032531 Ga0105249_100325312 248
151 3300010375 Ga0105239_10054216 Ga0105239_100542163 248
152 3300011119 Ga0105246_10345000 Ga0105246_103450002 248
153 3300013104 Ga0157370_10013306 Ga0157370_100133062 248
154 3300013104 Ga0157370_10189750 Ga0157370_101897502 248
155 3300013105 Ga0157369_10650405 Ga0157369_106504051 248
156 3300013296 Ga0157374_10000168 Ga0157374_1000016838 248
157 3300013297 Ga0157378_10019208 Ga0157378_100192084 248
158 3300013306 Ga0163162_10001104 Ga0163162_100011046 248
159 3300013306 Ga0163162_10010735 Ga0163162_100107353 248
160 3300013306 Ga0163162_10369862 Ga0163162_103698622 248
161 3300013307 Ga0157372_10031774 Ga0157372_100317743 248
162 3300013307 Ga0157372_10359101 Ga0157372_103591012 248
163 3300013308 Ga0157375_10001148 Ga0157375_100011482 248
164 3300013308 Ga0157375_10118677 Ga0157375_101186773 248
165 3300014325 Ga0163163_10000271 Ga0163163_1000027142 248
166 3300014968 Ga0157379_10000810 Ga0157379_1000081019 248
167 3300014968 Ga0157379_10291142 Ga0157379_102911422 248
168 3300014969 Ga0157376_10005679 Ga0157376_100056794 248
169 3300014969 Ga0157376_10007883 Ga0157376_100078833 248
170 3300014969 Ga0157376_10173865 Ga0157376_101738652 248
171 3300025911 Ga0207654_10031268 Ga0207654_100312684 248
172 3300025912 Ga0207707_10000353 Ga0207707_1000035312 248
173 3300025913 Ga0207695_10040358 Ga0207695_100403587 248
174 3300025917 Ga0207660_10025794 Ga0207660_100257945 248
175 3300025921 Ga0207652_10000925 Ga0207652_1000092510 248
176 3300025924 Ga0207694_10249555 Ga0207694_102495552 248
177 3300025933 Ga0207706_10029010 Ga0207706_100290103 248
178 3300025935 Ga0207709_10175826 Ga0207709_101758262 248
179 3300025939 Ga0207665_10158026 Ga0207665_101580262 248
180 3300025945 Ga0207679_10029476 Ga0207679_100294763 248
181 3300025949 Ga0207667_10031292 Ga0207667_100312929 248
182 3300025949 Ga0207667_10102060 Ga0207667_101020602 248
183 3300025960 Ga0207651_10007031 Ga0207651_100070316 248
184 3300026035 Ga0207703_10064758 Ga0207703_100647583 248
185 3300026041 Ga0207639_10028109 Ga0207639_100281093 248
186 3300026041 Ga0207639_10113731 Ga0207639_101137312 248
187 3300026142 Ga0207698_10293646 Ga0207698_102936462 248
188 3300035172 Ga0373955_0044312 Ga0373955_0044312_582_1331 248
189 3300036401 Ga0373937_0125430 Ga0373937_0125430_785_1534 248
190 3300046459 Ga0495629_0060756 Ga0495629_0060756_580_1329 248
191 3300046473 Ga0495582_0077566 Ga0495582_0077566_95_844 248
192 3300046511 Ga0495608_0316939 Ga0495608_0316939_167_916 248
193 3300046535 Ga0495586_0077853 Ga0495586_0077853_997_1746 248
194 3300046543 Ga0495645_0171613 Ga0495645_0171613_343_1092 248
195 3300046616 Ga0495668_0000202 Ga0495668_0000202_17413_18198 248
196 3300046683 Ga0495658_0109620 Ga0495658_0109620_580_1329 248
197 3300046691 Ga0495670_0170774 Ga0495670_0170774_49_798 248
198 3300047315 Ga0495581_0236379 Ga0495581_0236379_142_891 248
199 3300048911 Ga0496108_0078457 Ga0496108_0078457_340_1089 248
200 3300049571 Ga0501034_0130522 Ga0501034_0130522_198_995 248
201 3300049583 Ga0501067_0024184 Ga0501067_0024184_2156_2953 248
202 3300049584 Ga0501068_0297758 Ga0501068_0297758_144_941 248
203 3300049585 Ga0501069_0056749 Ga0501069_0056749_71_820 248
204 3300049589 Ga0501073_0058420 Ga0501073_0058420_1057_1854 248
205 3300049823 Ga0501044_0381675 Ga0501044_0381675_428_1225 248
206 3300054114 Ga0501084_0244486 Ga0501084_0244486_263_1060 248
207 3300005459 Ga0068867_100006240 Ga0068867_1000062404 249
208 3300031730 Ga0307516_10250948 Ga0307516_102509482 249
209 3300049571 Ga0501034_0000004 Ga0501034_0000004_293661_294425 249
210 3300003322 rootL2_10328238 rootL2_103282381 250
211 3300005327 Ga0070658_10110297 Ga0070658_101102972 250
212 3300005328 Ga0070676_10052730 Ga0070676_100527302 250
213 3300005337 Ga0070682_100000019 Ga0070682_100000019124 250
214 3300005353 Ga0070669_100498691 Ga0070669_1004986911 250
215 3300005354 Ga0070675_100243516 Ga0070675_1002435162 250
216 3300005356 Ga0070674_100111663 Ga0070674_1001116631 250
217 3300005356 Ga0070674_100305746 Ga0070674_1003057462 250
218 3300005364 Ga0070673_100089473 Ga0070673_1000894732 250
219 3300005367 Ga0070667_100134572 Ga0070667_1001345722 250
220 3300005434 Ga0070709_10453681 Ga0070709_104536811 250
221 3300005459 Ga0068867_100192849 Ga0068867_1001928492 250
222 3300005539 Ga0068853_100075221 Ga0068853_1000752211 250
223 3300005539 Ga0068853_100698801 Ga0068853_1006988011 250
224 3300005543 Ga0070672_100632690 Ga0070672_1006326901 250
225 3300005549 Ga0070704_100395836 Ga0070704_1003958361 250
226 3300005563 Ga0068855_100010676 Ga0068855_1000106761 250
227 3300005577 Ga0068857_100011134 Ga0068857_1000111344 250
228 3300005614 Ga0068856_100051939 Ga0068856_1000519392 250
229 3300005841 Ga0068863_100013341 Ga0068863_1000133417 250
230 3300005937 Ga0081455_10426424 Ga0081455_104264241 250
231 3300006163 Ga0070715_10235143 Ga0070715_102351431 250
232 3300006195 Ga0075366_10121084 Ga0075366_101210841 250
233 3300006237 Ga0097621_100020731 Ga0097621_1000207314 250
234 3300006358 Ga0068871_100014364 Ga0068871_1000143646 250
235 3300009093 Ga0105240_10053573 Ga0105240_100535734 250
236 3300009094 Ga0111539_10288760 Ga0111539_102887602 250
237 3300009147 Ga0114129_10016609 Ga0114129_100166098 250
238 3300009174 Ga0105241_10423560 Ga0105241_104235602 250
239 3300009545 Ga0105237_10103703 Ga0105237_101037033 250
240 3300010375 Ga0105239_10022857 Ga0105239_100228573 250
241 3300013297 Ga0157378_10022348 Ga0157378_100223483 250
242 3300013306 Ga0163162_10162254 Ga0163162_101622542 250
243 3300013307 Ga0157372_10570256 Ga0157372_105702562 250
244 3300013307 Ga0157372_10993629 Ga0157372_109936291 250
245 3300014326 Ga0157380_10012234 Ga0157380_100122344 250
246 3300014326 Ga0157380_10037222 Ga0157380_100372224 250
247 3300014326 Ga0157380_10715697 Ga0157380_107156971 250
248 3300014968 Ga0157379_10016526 Ga0157379_100165266 250
249 3300014969 Ga0157376_10362850 Ga0157376_103628502 250
250 3300017792 Ga0163161_10037684 Ga0163161_100376842 250
251 3300017792 Ga0163161_10179853 Ga0163161_101798532 250
252 3300025909 Ga0207705_10109724 Ga0207705_101097243 250
253 3300025911 Ga0207654_10191378 Ga0207654_101913781 250
254 3300025913 Ga0207695_10098979 Ga0207695_100989791 250
255 3300025926 Ga0207659_10011506 Ga0207659_100115064 250
256 3300025940 Ga0207691_10189979 Ga0207691_101899792 250
257 3300025949 Ga0207667_10718006 Ga0207667_107180061 250
258 3300025986 Ga0207658_10104496 Ga0207658_101044964 250
259 3300026041 Ga0207639_10154863 Ga0207639_101548632 250
260 3300026041 Ga0207639_10308763 Ga0207639_103087632 250
261 3300026041 Ga0207639_10392239 Ga0207639_103922391 250
262 3300026088 Ga0207641_10021211 Ga0207641_100212114 250
263 3300026089 Ga0207648_10081487 Ga0207648_100814872 250
264 3300026116 Ga0207674_10093071 Ga0207674_100930712 250
265 3300028794 Ga0307515_10000001 Ga0307515_100000012329 250
266 3300028794 Ga0307515_10000021 Ga0307515_1000002175 250
267 3300029957 Ga0265324_10036938 Ga0265324_100369382 250
268 3300030521 Ga0307511_10000232 Ga0307511_1000023243 250
269 3300031251 Ga0265327_10000013 Ga0265327_10000013264 250
270 3300032004 Ga0307414_10450199 Ga0307414_104501992 250
271 3300044656 Ga0466969_0000545 Ga0466969_0000545_19635_20393 250
272 3300044658 Ga0466972_0000021 Ga0466972_0000021_108295_109059 250
273 3300044683 Ga0466965_0099431 Ga0466965_0099431_457_1218 250
274 3300044684 Ga0466966_0000022 Ga0466966_0000022_53323_54081 250
275 3300044706 Ga0466964_0030796 Ga0466964_0030796_1087_1842 250
276 3300044765 Ga0466970_0000973 Ga0466970_0000973_3341_4105 250
277 3300044765 Ga0466970_0195855 Ga0466970_0195855_229_984 250
278 3300044842 Ga0466957_0001395 Ga0466957_0001395_9566_10321 250
279 3300045049 Ga0466959_0000055 Ga0466959_0000055_53001_53759 250
280 3300047320 Ga0495672_0048768 Ga0495672_0048768_1718_2473 250
281 3300048907 Ga0496104_0427219 Ga0496104_0427219_28_783 250
282 3300049571 Ga0501034_0085641 Ga0501034_0085641_1050_1805 250
283 3300049823 Ga0501044_0598570 Ga0501044_0598570_137_892 250
284 3300050493 nmdc:mga0k408_365530_c1 nmdc:mga0k408_365530_c1_35_790 250
285 3300050507 nmdc:mga05p37_11602_c1 nmdc:mga05p37_11602_c1_3957_4712 250
286 3300053178 Ga0500637_0139991 Ga0500637_0139991_106_861 250
287 3300003320 rootH2_10162261 rootH2_101622611 251
288 3300003322 rootL2_10215964 rootL2_102159642 251
289 3300005616 Ga0068852_100376769 Ga0068852_1003767692 251
290 3300013104 Ga0157370_10298029 Ga0157370_102980291 251
291 3300041460 Ga0451802_1520215 Ga0451802_1520215_166_921 251
292 3300041498 Ga0451841_0052136 Ga0451841_0052136_689_1444 251
293 3300041512 Ga0451853_1796454 Ga0451853_1796454_107_862 251
294 3300041512 Ga0451853_2178756 Ga0451853_2178756_348_1103 251
295 3300044658 Ga0466972_0000243 Ga0466972_0000243_13018_13773 251
296 3300049571 Ga0501034_0282314 Ga0501034_0282314_505_1260 251
297 3300049581 Ga0501047_0030289 Ga0501047_0030289_1972_2727 251
298 3300049581 Ga0501047_0117139 Ga0501047_0117139_17_772 251
299 3300049686 Ga0501257_070728 Ga0501257_070728_73_828 251
300 3300049823 Ga0501044_0099039 Ga0501044_0099039_1133_1888 251
301 3300050493 nmdc:mga0k408_148358_c1 nmdc:mga0k408_148358_c1_406_1161 251
302 3300053086 Ga0500578_0147161 Ga0500578_0147161_191_946 251
303 3300053092 Ga0500583_0000011 Ga0500583_0000011_19387_20142 251
304 3300053092 Ga0500583_0000719 Ga0500583_0000719_193_948 251
305 3300053136 Ga0500559_0031818 Ga0500559_0031818_1074_1829 251
306 3300053146 Ga0500588_0023833 Ga0500588_0023833_635_1390 251
307 3300053151 Ga0500604_0054323 Ga0500604_0054323_440_1195 251
308 3300053156 Ga0500622_0018973 Ga0500622_0018973_2436_3191 251
309 3300053163 Ga0500639_155091 Ga0500639_155091_162_917 251
310 3300053177 Ga0500636_0116689 Ga0500636_0116689_667_1428 251
311 3300003316 rootH1_10116967 rootH1_101169672 253
312 3300003322 rootL2_10112692 rootL2_101126922 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12811

BaxI_1

Bax inhibitor 1 like

64

297

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8486 29 247
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8447 29 247
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8291 29 249
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8218 29 249
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8067 29 249
ID Description Score Start End Superfamily
af_O53420_6_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8584 1 248 1.20.1250.20
af_O53420_6_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8391 1 248 1.20.1250.20
af_Q9VSH3_28_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7994 31 241 1.20.1250.20
af_B7F9F6_1_249_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7867 30 251 1.20.1250.20
af_P0AAC6_18_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7857 31 242 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1J5T923-F1-model_v4 Bax inhibitor 1 like protein 0.9748 28 253 GO:0016020
AF-X1GVX1-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9722 61 253 GO:0016020
AF-B7IZA6-F1-model_v4 Bax inhibitor-1/YccA family protein 0.972 62 243 GO:0016020
AF-C3G2C1-F1-model_v4 deleted 0.971 27 253
AF-A0A7U6QPK7-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9685 93 247 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.9 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map