F401867

General Info

Members Datasets Scaffolds Average Seq Length
312 162 624 171

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0000445|Ga0496110_0000445_15193_15753
Length 186
Sequence MYSGDGSKERDLKQMEKAFNFKKWIDENRHLLKPPVGNKVVWKDREFMVMVVGGPNARTDFHVNQGEEFFYQLEGNMTLKVINEQGKMEDIPITAGDIFLLPPSTPHSPQREAGSIGLVIERRRREGEIDGLQWYCEDCGTKLYEEYFKLKNVETDFPPVFERYYNSEHTKCTQCGHVNGRKWANV

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
149 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
150 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
151 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
152 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
153 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
154 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
155 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
161 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0000445 3300048913 Bacteria 28115
2 Ga0065715_10214058 3300005293 Bacteria 1301
3 Ga0070658_10097255 3300005327 Bacteria 2431
4 Ga0070676_10170798 3300005328 Bacteria 1406
5 Ga0070676_10510512 3300005328 Bacteria 855
6 Ga0070670_100013293 3300005331 Bacteria 7052
7 Ga0070670_100171746 3300005331 Bacteria 1880
8 Ga0070670_100212438 3300005331 Bacteria 1682
9 Ga0070670_100953520 3300005331 Unclassified 779
10 Ga0070677_10410686 3300005333 Unclassified 716
11 Ga0070666_10456054 3300005335 Bacteria 923
12 Ga0068868_100002964 3300005338 Bacteria 11784
13 Ga0068868_100103172 3300005338 Bacteria 2310
14 Ga0070689_100220655 3300005340 Bacteria 1555
15 Ga0070687_100153665 3300005343 Bacteria 1353
16 Ga0070661_100055310 3300005344 Bacteria 2906
17 Ga0070668_100098579 3300005347 Bacteria 2313
18 Ga0070675_100206103 3300005354 Bacteria 1708
19 Ga0070675_100363418 3300005354 Bacteria 1286
20 Ga0070675_100818524 3300005354 Unclassified 852
21 Ga0070671_100003430 3300005355 Bacteria 12374
22 Ga0070671_100767843 3300005355 Bacteria 838
23 Ga0070674_100082762 3300005356 Bacteria 2297
24 Ga0070673_100160635 3300005364 Bacteria 1911
25 Ga0070673_100353848 3300005364 Bacteria 1304
26 Ga0070688_100155447 3300005365 Bacteria 1567
27 Ga0070688_100500780 3300005365 Bacteria 916
28 Ga0070659_100013722 3300005366 Bacteria 6040
29 Ga0070667_100006628 3300005367 Bacteria 9627
30 Ga0070667_100691104 3300005367 Bacteria 944
31 Ga0070708_100117393 3300005445 Bacteria 2450
32 Ga0070708_100338726 3300005445 Bacteria 1417
33 Ga0070663_100814943 3300005455 Bacteria 801
34 Ga0070678_100472141 3300005456 Bacteria 1102
35 Ga0070662_100624207 3300005457 Bacteria 908
36 Ga0070681_10033955 3300005458 Bacteria 5122
37 Ga0070681_10046182 3300005458 Bacteria 4355
38 Ga0070681_10151593 3300005458 Bacteria 2244
39 Ga0070681_10257400 3300005458 Bacteria 1657
40 Ga0068867_100066494 3300005459 Bacteria 2685
41 Ga0070685_10404186 3300005466 Unclassified 946
42 Ga0070707_100805105 3300005468 Bacteria 903
43 Ga0070698_100213878 3300005471 Bacteria 1862
44 Ga0070699_100150467 3300005518 Bacteria 2058
45 Ga0070679_100170154 3300005530 Bacteria 2152
46 Ga0070697_100594330 3300005536 Bacteria 972
47 Ga0068853_100020356 3300005539 Bacteria 5517
48 Ga0068853_100073335 3300005539 Bacteria 2984
49 Ga0068853_100088091 3300005539 Bacteria 2724
50 Ga0068853_101512716 3300005539 Bacteria 650
51 Ga0070672_100059347 3300005543 Bacteria 3010
52 Ga0070672_100103477 3300005543 Bacteria 2313
53 Ga0070672_100313906 3300005543 Bacteria 1331
54 Ga0070704_100000581 3300005549 Bacteria 17577
55 Ga0068855_100056804 3300005563 Bacteria 4590
56 Ga0068855_100317104 3300005563 Bacteria 1724
57 Ga0068855_101752088 3300005563 Unclassified 632
58 Ga0070664_100220531 3300005564 Bacteria 1697
59 Ga0070664_100481437 3300005564 Bacteria 1142
60 Ga0068857_100329927 3300005577 Bacteria 1410
61 Ga0068854_100114760 3300005578 Bacteria 2037
62 Ga0068854_100847309 3300005578 Bacteria 800
63 Ga0068856_100208696 3300005614 Bacteria 1968
64 Ga0068852_100292282 3300005616 Bacteria 1574
65 Ga0068852_101091339 3300005616 Bacteria 818
66 Ga0068859_100006848 3300005617 Bacteria 11576
67 Ga0068859_100065550 3300005617 Unclassified 3665
68 Ga0068859_100640053 3300005617 Bacteria 1155
69 Ga0068859_100918860 3300005617 Unclassified 959
70 Ga0068864_100096095 3300005618 Unclassified 2622
71 Ga0068864_100108078 3300005618 Bacteria 2475
72 Ga0068864_100424427 3300005618 Bacteria 1267
73 Ga0068864_100484496 3300005618 Bacteria 1188
74 Ga0068861_101141437 3300005719 Bacteria 751
75 Ga0068870_10150178 3300005840 Bacteria 1372
76 Ga0068863_101732611 3300005841 Bacteria 634
77 Ga0068858_100057511 3300005842 Bacteria 3594
78 Ga0068858_100375226 3300005842 Bacteria 1364
79 Ga0068858_101334555 3300005842 Bacteria 706
80 Ga0068860_100020531 3300005843 Bacteria 6398
81 Ga0068860_100025165 3300005843 Bacteria 5744
82 Ga0068860_100134575 3300005843 Unclassified 2373
83 Ga0068862_100005955 3300005844 Bacteria 10155
84 Ga0068862_100229797 3300005844 Bacteria 1682
85 Ga0068862_101057618 3300005844 Bacteria 805
86 Ga0097621_100030223 3300006237 Bacteria 4286
87 Ga0068871_100019762 3300006358 Bacteria 5147
88 Ga0068865_100146163 3300006881 Bacteria 1788
89 Ga0097620_100006848 3300006931 Bacteria 11576
90 Ga0097620_100065549 3300006931 Unclassified 3665
91 Ga0097620_100640073 3300006931 Bacteria 1155
92 Ga0097620_100918900 3300006931 Unclassified 959
93 Ga0105245_10917944 3300009098 Bacteria 918
94 Ga0105247_10007408 3300009101 Bacteria 6736
95 Ga0105247_10018897 3300009101 Bacteria 4138
96 Ga0105247_10058071 3300009101 Bacteria 2393
97 Ga0105241_10874832 3300009174 Unclassified 833
98 Ga0105242_10353841 3300009176 Bacteria 1357
99 Ga0105248_10029287 3300009177 Bacteria 6141
100 Ga0105248_10579752 3300009177 Bacteria 1266
101 Ga0105248_11076778 3300009177 Unclassified 908
102 Ga0105237_10088612 3300009545 Bacteria 3084
103 Ga0105237_10145288 3300009545 Bacteria 2367
104 Ga0105249_10039237 3300009553 Bacteria 4299
105 Ga0105249_10058515 3300009553 Unclassified 3532
106 Ga0105249_10479240 3300009553 Bacteria 1287
107 Ga0105249_10613333 3300009553 Bacteria 1143
108 Ga0105249_10662764 3300009553 Bacteria 1102
109 Ga0105249_10865151 3300009553 Unclassified 970
110 Ga0105239_10249179 3300010375 Bacteria 1995
111 Ga0105239_10420803 3300010375 Bacteria 1513
112 Ga0105246_10372788 3300011119 Bacteria 1177
113 Ga0105246_10576289 3300011119 Bacteria 969
114 Ga0157373_10234475 3300013100 Bacteria 1296
115 Ga0157373_10276114 3300013100 Bacteria 1190
116 Ga0157369_10039346 3300013105 Bacteria 5168
117 Ga0157378_10012944 3300013297 Bacteria 7299
118 Ga0157378_10653716 3300013297 Bacteria 1067
119 Ga0163162_10111477 3300013306 Bacteria 2833
120 Ga0163162_10246077 3300013306 Bacteria 1920
121 Ga0163162_10541429 3300013306 Bacteria 1293
122 Ga0163162_10556826 3300013306 Unclassified 1274
123 Ga0163162_11318171 3300013306 Bacteria 820
124 Ga0157372_10094117 3300013307 Bacteria 3411
125 Ga0157372_10194557 3300013307 Unclassified 2349
126 Ga0157372_10511002 3300013307 Bacteria 1401
127 Ga0157372_11055691 3300013307 Bacteria 940
128 Ga0157372_11347072 3300013307 Bacteria 823
129 Ga0157375_10111385 3300013308 Bacteria 2836
130 Ga0157375_11217288 3300013308 Bacteria 884
131 Ga0163163_10020148 3300014325 Bacteria 6278
132 Ga0163163_10283188 3300014325 Unclassified 1709
133 Ga0163163_10769763 3300014325 Bacteria 1026
134 Ga0163163_10791082 3300014325 Bacteria 1012
135 Ga0157380_10133198 3300014326 Bacteria 2124
136 Ga0157380_10393275 3300014326 Bacteria 1312
137 Ga0157380_10950268 3300014326 Bacteria 889
138 Ga0157379_10067239 3300014968 Bacteria 3204
139 Ga0157379_11538356 3300014968 Bacteria 648
140 Ga0157376_10282665 3300014969 Bacteria 1563
141 Ga0163161_10000426 3300017792 Bacteria 35489
142 Ga0163161_10086860 3300017792 Unclassified 2309
143 Ga0163161_10111353 3300017792 Bacteria 2047
144 Ga0163161_10121428 3300017792 Bacteria 1964
145 Ga0163161_10859049 3300017792 Unclassified 766
146 Ga0163161_10896468 3300017792 Bacteria 751
147 Ga0207682_10132535 3300025893 Unclassified 1113
148 Ga0207710_10005688 3300025900 Bacteria 5361
149 Ga0207710_10294546 3300025900 Unclassified 819
150 Ga0207680_10105889 3300025903 Bacteria 1815
151 Ga0207645_10523949 3300025907 Unclassified 803
152 Ga0207645_10602432 3300025907 Bacteria 746
153 Ga0207643_10104982 3300025908 Bacteria 1660
154 Ga0207705_10332309 3300025909 Bacteria 1169
155 Ga0207654_10233324 3300025911 Bacteria 1226
156 Ga0207654_10583506 3300025911 Unclassified 796
157 Ga0207707_10007448 3300025912 Bacteria 9536
158 Ga0207707_10059588 3300025912 Unclassified 3321
159 Ga0207707_10144449 3300025912 Bacteria 2080
160 Ga0207695_10506741 3300025913 Bacteria 1089
161 Ga0207671_10056590 3300025914 Bacteria 2906
162 Ga0207662_10219098 3300025918 Bacteria 1238
163 Ga0207649_10465519 3300025920 Bacteria 956
164 Ga0207652_10309199 3300025921 Bacteria 1426
165 Ga0207646_10092290 3300025922 Bacteria 2710
166 Ga0207650_10086525 3300025925 Bacteria 2386
167 Ga0207659_10405330 3300025926 Bacteria 1141
168 Ga0207644_10007793 3300025931 Bacteria 6994
169 Ga0207644_10271508 3300025931 Bacteria 1359
170 Ga0207644_10320619 3300025931 Bacteria 1253
171 Ga0207644_10409196 3300025931 Bacteria 1110
172 Ga0207690_10335910 3300025932 Bacteria 1191
173 Ga0207706_10091096 3300025933 Bacteria 2681
174 Ga0207706_10256358 3300025933 Bacteria 1527
175 Ga0207706_10313638 3300025933 Bacteria 1365
176 Ga0207686_10323246 3300025934 Bacteria 1153
177 Ga0207670_10471228 3300025936 Bacteria 1015
178 Ga0207669_10078843 3300025937 Bacteria 2100
179 Ga0207691_10080011 3300025940 Bacteria 2940
180 Ga0207691_10117842 3300025940 Bacteria 2356
181 Ga0207691_10264738 3300025940 Bacteria 1481
182 Ga0207691_10282345 3300025940 Bacteria 1428
183 Ga0207711_10002221 3300025941 Bacteria 17432
184 Ga0207711_10161210 3300025941 Bacteria 2030
185 Ga0207661_11204707 3300025944 Bacteria 697
186 Ga0207679_10017911 3300025945 Bacteria 4734
187 Ga0207679_10158960 3300025945 Bacteria 1848
188 Ga0207667_10067213 3300025949 Bacteria 3734
189 Ga0207651_10069671 3300025960 Unclassified 2485
190 Ga0207712_10015934 3300025961 Unclassified 4859
191 Ga0207712_10072312 3300025961 Bacteria 2483
192 Ga0207712_10094159 3300025961 Bacteria 2212
193 Ga0207712_10286788 3300025961 Bacteria 1346
194 Ga0207668_10400429 3300025972 Bacteria 1160
195 Ga0207640_11007664 3300025981 Bacteria 733
196 Ga0207658_10478941 3300025986 Bacteria 1106
197 Ga0207658_11320606 3300025986 Bacteria 659
198 Ga0207677_10040782 3300026023 Bacteria 3064
199 Ga0207703_10022917 3300026035 Bacteria 4904
200 Ga0207639_10006727 3300026041 Bacteria 7820
201 Ga0207639_10464190 3300026041 Bacteria 1152
202 Ga0207641_10227087 3300026088 Bacteria 1734
203 Ga0207641_10227104 3300026088 Bacteria 1733
204 Ga0207676_10014992 3300026095 Bacteria 5585
205 Ga0207676_10142432 3300026095 Unclassified 2054
206 Ga0207676_10168526 3300026095 Bacteria 1905
207 Ga0207676_10485695 3300026095 Bacteria 1170
208 Ga0207676_10562062 3300026095 Bacteria 1091
209 Ga0207674_10581968 3300026116 Bacteria 1081
210 Ga0207675_100890513 3300026118 Bacteria 906
211 Ga0207675_101018518 3300026118 Bacteria 847
212 Ga0207675_101435946 3300026118 Bacteria 711
213 Ga0207683_10230458 3300026121 Unclassified 1689
214 Ga0207683_10503530 3300026121 Bacteria 1119
215 Ga0207698_10065099 3300026142 Bacteria 2861
216 Ga0207698_10098864 3300026142 Bacteria 2412
217 Ga0207698_10113900 3300026142 Bacteria 2274
218 Ga0207698_10748067 3300026142 Unclassified 976
219 Ga0209974_10124426 3300027876 Unclassified 916
220 Ga0268265_10675464 3300028380 Bacteria 995
221 Ga0268265_10688467 3300028380 Bacteria 986
222 Ga0268264_10000447 3300028381 Bacteria 56371
223 Ga0268264_10024444 3300028381 Bacteria 4932
224 Ga0307408_100214153 3300031548 Bacteria 1568
225 Ga0307408_100707618 3300031548 Bacteria 906
226 Ga0307405_10010936 3300031731 Unclassified 4731
227 Ga0307405_10525393 3300031731 Bacteria 953
228 Ga0307413_10001986 3300031824 Bacteria 8122
229 Ga0307413_10024962 3300031824 Bacteria 3267
230 Ga0307413_10180430 3300031824 Bacteria 1505
231 Ga0307413_10418512 3300031824 Bacteria 1055
232 Ga0307410_10009777 3300031852 Bacteria 5398
233 Ga0307410_10167830 3300031852 Bacteria 1651
234 Ga0307410_10680759 3300031852 Bacteria 865
235 Ga0307410_10833866 3300031852 Bacteria 786
236 Ga0307410_11066434 3300031852 Bacteria 699
237 Ga0307406_10114202 3300031901 Bacteria 1865
238 Ga0307406_10131037 3300031901 Bacteria 1760
239 Ga0307406_10141301 3300031901 Unclassified 1704
240 Ga0307406_10229320 3300031901 Unclassified 1386
241 Ga0307406_10659720 3300031901 Bacteria 869
242 Ga0307407_10002157 3300031903 Bacteria 7569
243 Ga0307407_10095248 3300031903 Bacteria 1835
244 Ga0307407_10858126 3300031903 Bacteria 694
245 Ga0307412_10367447 3300031911 Bacteria 1161
246 Ga0307412_10703413 3300031911 Bacteria 868
247 Ga0307409_100001513 3300031995 Bacteria 11503
248 Ga0307409_100052752 3300031995 Bacteria 3120
249 Ga0307409_100162341 3300031995 Bacteria 1956
250 Ga0307409_100195523 3300031995 Bacteria 1804
251 Ga0307409_100242355 3300031995 Bacteria 1642
252 Ga0307409_100329779 3300031995 Bacteria 1432
253 Ga0307409_101229409 3300031995 Bacteria 773
254 Ga0307416_100021296 3300032002 Bacteria 4651
255 Ga0307416_100379378 3300032002 Unclassified 1443
256 Ga0307416_100521428 3300032002 Bacteria 1256
257 Ga0307416_101657727 3300032002 Bacteria 744
258 Ga0307414_10022567 3300032004 Bacteria 3974
259 Ga0307414_10292572 3300032004 Bacteria 1374
260 Ga0307414_10427975 3300032004 Bacteria 1156
261 Ga0307414_10658249 3300032004 Bacteria 945
262 Ga0307414_10723421 3300032004 Bacteria 903
263 Ga0307414_11289158 3300032004 Bacteria 678
264 Ga0307411_10004796 3300032005 Bacteria 6551
265 Ga0307411_10019581 3300032005 Bacteria 3913
266 Ga0307411_10036925 3300032005 Bacteria 3067
267 Ga0307411_10107321 3300032005 Bacteria 1989
268 Ga0307411_10425942 3300032005 Bacteria 1104
269 Ga0307415_100016841 3300032126 Bacteria 4368
270 Ga0307415_100020050 3300032126 Bacteria 4073
271 Ga0307415_100059028 3300032126 Bacteria 2644
272 Ga0307415_100065533 3300032126 Bacteria 2531
273 Ga0307415_100127660 3300032126 Bacteria 1919
274 Ga0307415_100180289 3300032126 Bacteria 1657
275 Ga0373943_0305497 3300035170 Bacteria 904
276 Ga0316574_0374545 3300035398 Unclassified 899
277 Ga0395900_0029153 3300037418 Bacteria 5661
278 Ga0395905_0000077 3300037471 Bacteria 162822
279 Ga0395905_0046423 3300037471 Bacteria 4073
280 Ga0451577_0249202 3300042876 Bacteria 1607
281 Ga0453684_0006635 3300044712 Bacteria 21875
282 Ga0453684_0529587 3300044712 Bacteria 1300
283 Ga0495629_0272167 3300046459 Bacteria 1163
284 Ga0495582_0097175 3300046473 Bacteria 1647
285 Ga0495598_0031662 3300046537 Bacteria 1489
286 Ga0495658_0284967 3300046683 Bacteria 1043
287 Ga0495680_0698622 3300047322 Bacteria 670
288 Ga0496101_0217526 3300048904 Bacteria 1482
289 Ga0496104_0256937 3300048907 Bacteria 1660
290 Ga0496105_0090857 3300048908 Bacteria 2522
291 Ga0496110_0719855 3300048913 Bacteria 900
292 Ga0496113_0381866 3300048916 Bacteria 1131
293 Ga0496122_0249546 3300048925 Bacteria 993
294 Ga0501047_0499789 3300049581 Bacteria 1043
295 Ga0501073_0824337 3300049589 Bacteria 639
296 Ga0501074_0415538 3300049590 Bacteria 954
297 Ga0501202_021705 3300049652 Bacteria 1285
298 Ga0501202_101892 3300049652 Bacteria 700
299 Ga0501214_009644 3300049659 Bacteria 1043
300 Ga0501228_015121 3300049666 Unclassified 821
301 Ga0501239_017675 3300049672 Bacteria 851
302 Ga0501247_003747 3300049677 Bacteria 1641
303 Ga0501252_008234 3300049682 Bacteria 1195
304 Ga0501253_115716 3300049683 Bacteria 644
305 Ga0501257_021982 3300049686 Bacteria 1507
306 Ga0501225_0056252 3300049705 Bacteria 1101
307 Ga0501263_015446 3300049760 Bacteria 986
308 Ga0501266_017547 3300049763 Bacteria 958
309 Ga0501268_000512 3300049765 Bacteria 4245
310 Ga0501270_001318 3300049767 Bacteria 2349
311 Ga0501274_020429 3300049771 Bacteria 685
312 Ga0495601_0546819 3300053077 Bacteria 745
313 Ga0496110_0000445
314 Ga0065715_10214058
315 Ga0070658_10097255
316 Ga0070676_10170798
317 Ga0070676_10510512
318 Ga0070670_100013293
319 Ga0070670_100171746
320 Ga0070670_100212438
321 Ga0070670_100953520
322 Ga0070677_10410686
323 Ga0070666_10456054
324 Ga0068868_100002964
325 Ga0068868_100103172
326 Ga0070689_100220655
327 Ga0070687_100153665
328 Ga0070661_100055310
329 Ga0070668_100098579
330 Ga0070675_100206103
331 Ga0070675_100363418
332 Ga0070675_100818524
333 Ga0070671_100003430
334 Ga0070671_100767843
335 Ga0070674_100082762
336 Ga0070673_100160635
337 Ga0070673_100353848
338 Ga0070688_100155447
339 Ga0070688_100500780
340 Ga0070659_100013722
341 Ga0070667_100006628
342 Ga0070667_100691104
343 Ga0070708_100117393
344 Ga0070708_100338726
345 Ga0070663_100814943
346 Ga0070678_100472141
347 Ga0070662_100624207
348 Ga0070681_10033955
349 Ga0070681_10046182
350 Ga0070681_10151593
351 Ga0070681_10257400
352 Ga0068867_100066494
353 Ga0070685_10404186
354 Ga0070707_100805105
355 Ga0070698_100213878
356 Ga0070699_100150467
357 Ga0070679_100170154
358 Ga0070697_100594330
359 Ga0068853_100020356
360 Ga0068853_100073335
361 Ga0068853_100088091
362 Ga0068853_101512716
363 Ga0070672_100059347
364 Ga0070672_100103477
365 Ga0070672_100313906
366 Ga0070704_100000581
367 Ga0068855_100056804
368 Ga0068855_100317104
369 Ga0068855_101752088
370 Ga0070664_100220531
371 Ga0070664_100481437
372 Ga0068857_100329927
373 Ga0068854_100114760
374 Ga0068854_100847309
375 Ga0068856_100208696
376 Ga0068852_100292282
377 Ga0068852_101091339
378 Ga0068859_100006848
379 Ga0068859_100065550
380 Ga0068859_100640053
381 Ga0068859_100918860
382 Ga0068864_100096095
383 Ga0068864_100108078
384 Ga0068864_100424427
385 Ga0068864_100484496
386 Ga0068861_101141437
387 Ga0068870_10150178
388 Ga0068863_101732611
389 Ga0068858_100057511
390 Ga0068858_100375226
391 Ga0068858_101334555
392 Ga0068860_100020531
393 Ga0068860_100025165
394 Ga0068860_100134575
395 Ga0068862_100005955
396 Ga0068862_100229797
397 Ga0068862_101057618
398 Ga0097621_100030223
399 Ga0068871_100019762
400 Ga0068865_100146163
401 Ga0097620_100006848
402 Ga0097620_100065549
403 Ga0097620_100640073
404 Ga0097620_100918900
405 Ga0105245_10917944
406 Ga0105247_10007408
407 Ga0105247_10018897
408 Ga0105247_10058071
409 Ga0105241_10874832
410 Ga0105242_10353841
411 Ga0105248_10029287
412 Ga0105248_10579752
413 Ga0105248_11076778
414 Ga0105237_10088612
415 Ga0105237_10145288
416 Ga0105249_10039237
417 Ga0105249_10058515
418 Ga0105249_10479240
419 Ga0105249_10613333
420 Ga0105249_10662764
421 Ga0105249_10865151
422 Ga0105239_10249179
423 Ga0105239_10420803
424 Ga0105246_10372788
425 Ga0105246_10576289
426 Ga0157373_10234475
427 Ga0157373_10276114
428 Ga0157369_10039346
429 Ga0157378_10012944
430 Ga0157378_10653716
431 Ga0163162_10111477
432 Ga0163162_10246077
433 Ga0163162_10541429
434 Ga0163162_10556826
435 Ga0163162_11318171
436 Ga0157372_10094117
437 Ga0157372_10194557
438 Ga0157372_10511002
439 Ga0157372_11055691
440 Ga0157372_11347072
441 Ga0157375_10111385
442 Ga0157375_11217288
443 Ga0163163_10020148
444 Ga0163163_10283188
445 Ga0163163_10769763
446 Ga0163163_10791082
447 Ga0157380_10133198
448 Ga0157380_10393275
449 Ga0157380_10950268
450 Ga0157379_10067239
451 Ga0157379_11538356
452 Ga0157376_10282665
453 Ga0163161_10000426
454 Ga0163161_10086860
455 Ga0163161_10111353
456 Ga0163161_10121428
457 Ga0163161_10859049
458 Ga0163161_10896468
459 Ga0207682_10132535
460 Ga0207710_10005688
461 Ga0207710_10294546
462 Ga0207680_10105889
463 Ga0207645_10523949
464 Ga0207645_10602432
465 Ga0207643_10104982
466 Ga0207705_10332309
467 Ga0207654_10233324
468 Ga0207654_10583506
469 Ga0207707_10007448
470 Ga0207707_10059588
471 Ga0207707_10144449
472 Ga0207695_10506741
473 Ga0207671_10056590
474 Ga0207662_10219098
475 Ga0207649_10465519
476 Ga0207652_10309199
477 Ga0207646_10092290
478 Ga0207650_10086525
479 Ga0207659_10405330
480 Ga0207644_10007793
481 Ga0207644_10271508
482 Ga0207644_10320619
483 Ga0207644_10409196
484 Ga0207690_10335910
485 Ga0207706_10091096
486 Ga0207706_10256358
487 Ga0207706_10313638
488 Ga0207686_10323246
489 Ga0207670_10471228
490 Ga0207669_10078843
491 Ga0207691_10080011
492 Ga0207691_10117842
493 Ga0207691_10264738
494 Ga0207691_10282345
495 Ga0207711_10002221
496 Ga0207711_10161210
497 Ga0207661_11204707
498 Ga0207679_10017911
499 Ga0207679_10158960
500 Ga0207667_10067213
501 Ga0207651_10069671
502 Ga0207712_10015934
503 Ga0207712_10072312
504 Ga0207712_10094159
505 Ga0207712_10286788
506 Ga0207668_10400429
507 Ga0207640_11007664
508 Ga0207658_10478941
509 Ga0207658_11320606
510 Ga0207677_10040782
511 Ga0207703_10022917
512 Ga0207639_10006727
513 Ga0207639_10464190
514 Ga0207641_10227087
515 Ga0207641_10227104
516 Ga0207676_10014992
517 Ga0207676_10142432
518 Ga0207676_10168526
519 Ga0207676_10485695
520 Ga0207676_10562062
521 Ga0207674_10581968
522 Ga0207675_100890513
523 Ga0207675_101018518
524 Ga0207675_101435946
525 Ga0207683_10230458
526 Ga0207683_10503530
527 Ga0207698_10065099
528 Ga0207698_10098864
529 Ga0207698_10113900
530 Ga0207698_10748067
531 Ga0209974_10124426
532 Ga0268265_10675464
533 Ga0268265_10688467
534 Ga0268264_10000447
535 Ga0268264_10024444
536 Ga0307408_100214153
537 Ga0307408_100707618
538 Ga0307405_10010936
539 Ga0307405_10525393
540 Ga0307413_10001986
541 Ga0307413_10024962
542 Ga0307413_10180430
543 Ga0307413_10418512
544 Ga0307410_10009777
545 Ga0307410_10167830
546 Ga0307410_10680759
547 Ga0307410_10833866
548 Ga0307410_11066434
549 Ga0307406_10114202
550 Ga0307406_10131037
551 Ga0307406_10141301
552 Ga0307406_10229320
553 Ga0307406_10659720
554 Ga0307407_10002157
555 Ga0307407_10095248
556 Ga0307407_10858126
557 Ga0307412_10367447
558 Ga0307412_10703413
559 Ga0307409_100001513
560 Ga0307409_100052752
561 Ga0307409_100162341
562 Ga0307409_100195523
563 Ga0307409_100242355
564 Ga0307409_100329779
565 Ga0307409_101229409
566 Ga0307416_100021296
567 Ga0307416_100379378
568 Ga0307416_100521428
569 Ga0307416_101657727
570 Ga0307414_10022567
571 Ga0307414_10292572
572 Ga0307414_10427975
573 Ga0307414_10658249
574 Ga0307414_10723421
575 Ga0307414_11289158
576 Ga0307411_10004796
577 Ga0307411_10019581
578 Ga0307411_10036925
579 Ga0307411_10107321
580 Ga0307411_10425942
581 Ga0307415_100016841
582 Ga0307415_100020050
583 Ga0307415_100059028
584 Ga0307415_100065533
585 Ga0307415_100127660
586 Ga0307415_100180289
587 Ga0373943_0305497
588 Ga0316574_0374545
589 Ga0395900_0029153
590 Ga0395905_0000077
591 Ga0395905_0046423
592 Ga0451577_0249202
593 Ga0453684_0006635
594 Ga0453684_0529587
595 Ga0495629_0272167
596 Ga0495582_0097175
597 Ga0495598_0031662
598 Ga0495658_0284967
599 Ga0495680_0698622
600 Ga0496101_0217526
601 Ga0496104_0256937
602 Ga0496105_0090857
603 Ga0496110_0719855
604 Ga0496113_0381866
605 Ga0496122_0249546
606 Ga0501047_0499789
607 Ga0501073_0824337
608 Ga0501074_0415538
609 Ga0501202_021705
610 Ga0501202_101892
611 Ga0501214_009644
612 Ga0501228_015121
613 Ga0501239_017675
614 Ga0501247_003747
615 Ga0501252_008234
616 Ga0501253_115716
617 Ga0501257_021982
618 Ga0501225_0056252
619 Ga0501263_015446
620 Ga0501266_017547
621 Ga0501268_000512
622 Ga0501270_001318
623 Ga0501274_020429
624 Ga0495601_0546819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06052

3-HAO

3-hydroxyanthranilic acid dioxygenase

14

165

0.96

PF07883

Cupin_2

Cupin domain

48

116

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v26-assembly1.cif.gz_A 1.78 angstrom crystal structure of p97h 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9537 3 167
4hvq-assembly1.cif.gz_A x-ray crystal structure of fecu reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9479 1 151
6bvp-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase n27a from cupriavidus metallidurans 0.945 3 165
5v28-assembly1.cif.gz_A 2.72 angstrom crystal structure of p97a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9353 3 171
5v27-assembly1.cif.gz_A 2.35 angstrom crystal structure of p97v 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.935 3 171
ID Description Score Start End Superfamily
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9626 3 170 2.60.120.10
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.957 3 170 2.60.120.10
4hvqA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9479 1 151 2.60.120.10
af_Q54S02_3_181_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9384 4 173 2.60.120.10
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9346 7 171 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6P7X5F2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase-like 0.9944 38 118 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A7W1FBJ5-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) 0.9918 26 151 GO:0000334
GO:0005506
GO:0019363
AF-A0A512AUE5-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9915 1 170 GO:0000334
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A7V1SBC2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9905 1 173 GO:0000334
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A7R9QZL7-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase 0.9893 35 103 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874

Map