F401864

General Info

Members Datasets Scaffolds Average Seq Length
312 179 624 184

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0448515|Ga0495602_0448515_244_867
Length 207
Sequence LCADVRRLDLYATGRTTMTMYVSHNPLEALKRDVRYLLDRTEILDCIARHARGCDRHDVDLITSAYHGDGVDEHGHAVNSGPDYGEWANHTHAETSRVHTHNITTHSCEIDGDTAHAESYVLVVLIGPDTKSAQFITGRYIDRLERRDGQWRIVVRRSTVEGMFIGDARVLQSPFFTEKGYLVGTRDRDDLSYERPLSIDTPAPARW

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
174 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
175 2687453737 Frankia sp. BMG5.36 Isolate Nodule
176 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
177 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
178 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
179 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.24
Nodule 0.32
Rhizoplane 7.69
Rhizosphere 57.69
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0448515 3300048088 Bacteria 911
2 JGI24750J21931_1023383 3300002070 Unclassified 877
3 JGI25406J46586_10076303 3300003203 Bacteria 1038
4 Ga0070658_10732030 3300005327 Unclassified 859
5 Ga0070683_100046557 3300005329 Bacteria 4008
6 Ga0070683_100331757 3300005329 Bacteria 1448
7 Ga0070670_100206456 3300005331 Bacteria 1708
8 Ga0070670_100265777 3300005331 Unclassified 1496
9 Ga0070682_100516714 3300005337 Bacteria 928
10 Ga0068868_100242690 3300005338 Bacteria 1514
11 Ga0070692_10681818 3300005345 Unclassified 689
12 Ga0070668_100000985 3300005347 Bacteria 19974
13 Ga0070668_100208217 3300005347 Bacteria 1608
14 Ga0070668_100279901 3300005347 Bacteria 1393
15 Ga0070669_100000585 3300005353 Bacteria 27148
16 Ga0070671_100007487 3300005355 Bacteria 8726
17 Ga0070674_100522685 3300005356 Unclassified 992
18 Ga0070673_100926734 3300005364 Unclassified 809
19 Ga0070688_100157962 3300005365 Bacteria 1556
20 Ga0070667_100009650 3300005367 Bacteria 8007
21 Ga0070713_100032107 3300005436 Bacteria 4190
22 Ga0070700_100085065 3300005441 Bacteria 2051
23 Ga0070685_10306197 3300005466 Bacteria 1072
24 Ga0070679_100648779 3300005530 Bacteria 998
25 Ga0070684_100284644 3300005535 Bacteria 1515
26 Ga0070684_100776284 3300005535 Bacteria 895
27 Ga0070686_100017713 3300005544 Bacteria 4168
28 Ga0070686_100065078 3300005544 Bacteria 2367
29 Ga0070665_100001066 3300005548 Bacteria 34204
30 Ga0070665_100014931 3300005548 Bacteria 7797
31 Ga0070664_101355985 3300005564 Bacteria 672
32 Ga0068857_100482000 3300005577 Bacteria 1162
33 Ga0068856_101016681 3300005614 Bacteria 847
34 Ga0070702_100555119 3300005615 Bacteria 853
35 Ga0068861_101116117 3300005719 Unclassified 759
36 Ga0068863_100024964 3300005841 Bacteria 5701
37 Ga0068863_100573721 3300005841 Bacteria 1115
38 Ga0068858_100061215 3300005842 Bacteria 3480
39 Ga0068858_100725786 3300005842 Bacteria 967
40 Ga0068858_101023310 3300005842 Bacteria 810
41 Ga0068860_100208003 3300005843 Bacteria 1898
42 Ga0068862_100032314 3300005844 Bacteria 4421
43 Ga0081539_10012841 3300005985 Bacteria 6388
44 Ga0075365_10005338 3300006038 Bacteria 6920
45 Ga0075365_10006341 3300006038 Bacteria 6498
46 Ga0075365_10040712 3300006038 Bacteria 3031
47 Ga0075365_10522656 3300006038 Bacteria 839
48 Ga0075368_10039977 3300006042 Bacteria 1840
49 Ga0075363_100000207 3300006048 Bacteria 16267
50 Ga0075363_100000409 3300006048 Bacteria 13240
51 Ga0075363_100001138 3300006048 Bacteria 9703
52 Ga0075363_100007548 3300006048 Bacteria 5008
53 Ga0075364_10000430 3300006051 Bacteria 21031
54 Ga0075364_10006729 3300006051 Bacteria 6776
55 Ga0075364_10010653 3300006051 Bacteria 5560
56 Ga0075364_10036667 3300006051 Bacteria 3170
57 Ga0075364_10655046 3300006051 Unclassified 717
58 Ga0075362_10021753 3300006177 Bacteria 2696
59 Ga0075362_10040565 3300006177 Bacteria 2050
60 Ga0075362_10295994 3300006177 Bacteria 802
61 Ga0075367_10023693 3300006178 Bacteria 3456
62 Ga0075367_10065001 3300006178 Bacteria 2183
63 Ga0075367_10113829 3300006178 Bacteria 1663
64 Ga0075367_10124884 3300006178 Bacteria 1588
65 Ga0075369_10005602 3300006186 Bacteria 4701
66 Ga0075369_10017794 3300006186 Bacteria 2887
67 Ga0075369_10047860 3300006186 Bacteria 1844
68 Ga0075369_10053805 3300006186 Bacteria 1747
69 Ga0075369_10064161 3300006186 Bacteria 1608
70 Ga0075369_10070435 3300006186 Bacteria 1539
71 Ga0075369_10075108 3300006186 Bacteria 1492
72 Ga0075369_10196178 3300006186 Bacteria 931
73 Ga0075369_10293647 3300006186 Bacteria 758
74 Ga0075366_10456768 3300006195 Bacteria 788
75 Ga0075370_10002302 3300006353 Bacteria 8809
76 Ga0075370_10002694 3300006353 Bacteria 8311
77 Ga0075370_10002721 3300006353 Bacteria 8271
78 Ga0075370_10020244 3300006353 Bacteria 3635
79 Ga0075370_10042142 3300006353 Bacteria 2579
80 Ga0075370_10080285 3300006353 Bacteria 1874
81 Ga0068871_100370066 3300006358 Bacteria 1271
82 Ga0075430_100100709 3300006846 Bacteria 2413
83 Ga0068865_100235164 3300006881 Bacteria 1439
84 Ga0111539_10816403 3300009094 Bacteria 1085
85 Ga0105245_10972962 3300009098 Bacteria 892
86 Ga0105247_10000046 3300009101 Bacteria 151843
87 Ga0105247_10000082 3300009101 Bacteria 106460
88 Ga0105247_10134307 3300009101 Bacteria 1615
89 Ga0105243_10022185 3300009148 Bacteria 4824
90 Ga0105243_10289123 3300009148 Bacteria 1480
91 Ga0105248_10132433 3300009177 Bacteria 2813
92 Ga0105248_11066208 3300009177 Unclassified 913
93 Ga0105238_10668378 3300009551 Unclassified 1050
94 Ga0105249_10026890 3300009553 Bacteria 5188
95 Ga0105249_10421335 3300009553 Unclassified 1369
96 Ga0105239_10029139 3300010375 Bacteria 6069
97 Ga0105239_10297589 3300010375 Bacteria 1817
98 Ga0105239_10836894 3300010375 Bacteria 1055
99 Ga0157369_10068368 3300013105 Bacteria 3816
100 Ga0157374_10909349 3300013296 Bacteria 898
101 Ga0163162_10089729 3300013306 Bacteria 3155
102 Ga0163162_10513130 3300013306 Unclassified 1329
103 Ga0157375_10018691 3300013308 Bacteria 6290
104 Ga0157375_11645999 3300013308 Bacteria 759
105 Ga0163163_10021493 3300014325 Bacteria 6091
106 Ga0163163_10252428 3300014325 Bacteria 1814
107 Ga0163163_10799748 3300014325 Bacteria 1006
108 Ga0157380_10199893 3300014326 Bacteria 1772
109 Ga0157380_11282107 3300014326 Unclassified 779
110 Ga0157379_10203156 3300014968 Bacteria 1792
111 Ga0163161_10046774 3300017792 Bacteria 3122
112 Ga0163161_10123943 3300017792 Bacteria 1944
113 Ga0207710_10000071 3300025900 Bacteria 151859
114 Ga0207710_10000194 3300025900 Bacteria 57908
115 Ga0207652_10654016 3300025921 Bacteria 940
116 Ga0207681_10001078 3300025923 Bacteria 17698
117 Ga0207681_10030439 3300025923 Bacteria 3519
118 Ga0207694_10499296 3300025924 Unclassified 1019
119 Ga0207650_10500827 3300025925 Bacteria 1015
120 Ga0207700_10028472 3300025928 Bacteria 3928
121 Ga0207664_10035567 3300025929 Bacteria 3844
122 Ga0207644_10034438 3300025931 Bacteria 3543
123 Ga0207669_10392838 3300025937 Bacteria 1084
124 Ga0207704_10702333 3300025938 Unclassified 837
125 Ga0207661_10290215 3300025944 Bacteria 1464
126 Ga0207661_10407906 3300025944 Bacteria 1233
127 Ga0207651_10980162 3300025960 Unclassified 755
128 Ga0207712_10339241 3300025961 Bacteria 1246
129 Ga0207712_10736274 3300025961 Bacteria 863
130 Ga0207668_10000699 3300025972 Bacteria 20558
131 Ga0207668_10115284 3300025972 Bacteria 2024
132 Ga0207668_10608394 3300025972 Bacteria 953
133 Ga0207658_10002701 3300025986 Bacteria 12799
134 Ga0207658_10007550 3300025986 Bacteria 7406
135 Ga0207658_10703011 3300025986 Bacteria 914
136 Ga0207677_10160539 3300026023 Bacteria 1746
137 Ga0207703_10047024 3300026035 Bacteria 3478
138 Ga0207703_10891410 3300026035 Unclassified 851
139 Ga0207678_10298416 3300026067 Bacteria 1384
140 Ga0207708_10036633 3300026075 Bacteria 3736
141 Ga0207641_10087937 3300026088 Bacteria 2712
142 Ga0209813_10092334 3300027866 Bacteria 1018
143 Ga0268266_10007966 3300028379 Bacteria 9474
144 Ga0268266_10010749 3300028379 Bacteria 7975
145 Ga0268265_10262444 3300028380 Bacteria 1536
146 Ga0268265_11172219 3300028380 Bacteria 765
147 Ga0265338_10003562 3300028800 Bacteria 21767
148 Ga0265338_10008464 3300028800 Bacteria 12487
149 Ga0307509_10000019 3300031507 Bacteria 256151
150 Ga0307508_10060758 3300031616 Bacteria 3341
151 Ga0307405_11393846 3300031731 Archaea 613
152 Ga0307413_10088118 3300031824 Bacteria 2013
153 Ga0307410_10002490 3300031852 Bacteria 8900
154 Ga0307416_100040612 3300032002 Bacteria 3616
155 Ga0307416_101555471 3300032002 Bacteria 767
156 Ga0307415_100011048 3300032126 Bacteria 5146
157 Ga0439461_0020244 3300041410 Bacteria 1315
158 Ga0439465_0002144 3300041413 Bacteria 6481
159 Ga0451793_0311084 3300041452 Bacteria 870
160 Ga0439431_0058175 3300041997 Bacteria 1013
161 Ga0439442_016781 3300042002 Bacteria 1510
162 Ga0439445_0034886 3300042004 Bacteria 1320
163 Ga0439434_0014850 3300042435 Bacteria 2318
164 Ga0466972_0023844 3300044658 Bacteria 3040
165 Ga0466972_0040139 3300044658 Bacteria 2281
166 Ga0466972_0073910 3300044658 Bacteria 1625
167 Ga0466965_0018363 3300044683 Bacteria 3352
168 Ga0466965_0048519 3300044683 Unclassified 2104
169 Ga0466965_0121796 3300044683 Bacteria 1348
170 Ga0466966_0011300 3300044684 Bacteria 5923
171 Ga0466961_0022690 3300044693 Bacteria 4037
172 Ga0466971_0036606 3300044719 Bacteria 2201
173 Ga0466968_0045308 3300044735 Bacteria 1866
174 Ga0466970_0001592 3300044765 Bacteria 10937
175 Ga0466957_0029019 3300044842 Bacteria 3296
176 Ga0466957_0042669 3300044842 Bacteria 2745
177 Ga0466957_0427660 3300044842 Bacteria 909
178 Ga0466957_0443921 3300044842 Bacteria 893
179 Ga0466960_0003597 3300044901 Bacteria 5980
180 Ga0466960_0044700 3300044901 Unclassified 2113
181 Ga0466960_0087104 3300044901 Bacteria 1585
182 Ga0466960_0191148 3300044901 Bacteria 1114
183 Ga0466959_0075911 3300045049 Bacteria 2427
184 Ga0466958_0007257 3300045836 Bacteria 6081
185 Ga0466958_0060717 3300045836 Bacteria 2301
186 Ga0466967_0037543 3300045976 Bacteria 4147
187 Ga0466967_0039812 3300045976 Bacteria 4043
188 Ga0466967_0054000 3300045976 Plasmid 3534
189 Ga0466967_0968808 3300045976 Unclassified 847
190 Ga0495638_0000703 3300046460 Bacteria 36244
191 Ga0495638_0000995 3300046460 Bacteria 28479
192 Ga0495638_0033345 3300046460 Bacteria 3294
193 Ga0495596_0155636 3300046500 Bacteria 888
194 Ga0495610_0000217 3300046512 Bacteria 62059
195 Ga0495616_0125434 3300046513 Bacteria 1181
196 Ga0495643_0000004 3300046522 Bacteria 519944
197 Ga0495643_0247170 3300046522 Bacteria 834
198 Ga0495654_0077074 3300046530 Bacteria 1570
199 Ga0495668_0374155 3300046616 Unclassified 782
200 Ga0495625_0000913 3300046660 Bacteria 39747
201 Ga0495625_0002009 3300046660 Bacteria 22930
202 Ga0495625_0034737 3300046660 Bacteria 3719
203 Ga0495670_0455857 3300046691 Bacteria 693
204 Ga0495674_0548245 3300047319 Bacteria 921
205 Ga0495687_066330 3300047443 Bacteria 1466
206 Ga0495615_0000028 3300048090 Bacteria 47805
207 Ga0495626_0132211 3300048091 Bacteria 1064
208 Ga0496100_0045087 3300048903 Bacteria 2828
209 Ga0496100_0190625 3300048903 Bacteria 1488
210 Ga0496101_0001446 3300048904 Bacteria 14183
211 Ga0496101_0009506 3300048904 Bacteria 6390
212 Ga0496101_0065393 3300048904 Bacteria 2651
213 Ga0496101_0352170 3300048904 Bacteria 1157
214 Ga0496102_0009714 3300048905 Bacteria 8272
215 Ga0496102_1073316 3300048905 Bacteria 725
216 Ga0496104_0009845 3300048907 Bacteria 8528
217 Ga0496104_0200810 3300048907 Bacteria 1906
218 Ga0496104_0655874 3300048907 Bacteria 958
219 Ga0496105_0046456 3300048908 Bacteria 3584
220 Ga0496108_0402233 3300048911 Bacteria 1196
221 Ga0496108_0731223 3300048911 Unclassified 857
222 Ga0496111_0271375 3300048914 Bacteria 1258
223 Ga0496112_0221615 3300048915 Bacteria 1847
224 Ga0496112_0246418 3300048915 Bacteria 1738
225 Ga0496112_0682372 3300048915 Bacteria 956
226 Ga0496112_0926858 3300048915 Bacteria 792
227 Ga0496113_0319550 3300048916 Bacteria 1244
228 Ga0496113_0567541 3300048916 Bacteria 910
229 Ga0496114_0585022 3300048917 Unclassified 985
230 Ga0496115_0102287 3300048918 Bacteria 2350
231 Ga0496117_0176392 3300048920 Bacteria 1234
232 Ga0496118_0129053 3300048921 Bacteria 1628
233 Ga0496119_0007047 3300048922 Bacteria 10229
234 Ga0496121_0001856 3300048924 Bacteria 33927
235 Ga0496121_0002149 3300048924 Bacteria 30900
236 Ga0496122_0003670 3300048925 Bacteria 19911
237 Ga0496123_0000610 3300048926 Bacteria 60240
238 Ga0496124_0022013 3300048927 Bacteria 5858
239 Ga0496124_0027204 3300048927 Bacteria 5140
240 Ga0496125_0002458 3300048928 Bacteria 24073
241 Ga0496125_0013097 3300048928 Bacteria 8177
242 Ga0496125_0031288 3300048928 Bacteria 4744
243 Ga0496126_0001953 3300048929 Bacteria 29245
244 Ga0496126_0015658 3300048929 Bacteria 7619
245 Ga0496126_0126332 3300048929 Bacteria 2213
246 Ga0496126_0841045 3300048929 Unclassified 701
247 Ga0501033_0121564 3300049570 Bacteria 1895
248 Ga0501043_0243424 3300049579 Bacteria 1387
249 Ga0501067_0380692 3300049583 Unclassified 787
250 Ga0501070_0460935 3300049586 Bacteria 1024
251 Ga0501072_0249759 3300049588 Bacteria 1412
252 Ga0501198_003114 3300049649 Bacteria 2254
253 Ga0501249_001277 3300049679 Bacteria 5270
254 Ga0501035_0960478 3300049822 Bacteria 674
255 Ga0501044_0001182 3300049823 Bacteria 30912
256 Ga0501204_000402 3300049850 Bacteria 3715
257 nmdc:mga03683_111834_c1 3300050489 Bacteria 1208
258 nmdc:mga03683_42347_c1 3300050489 Bacteria 1873
259 nmdc:mga03683_46672_c1 3300050489 Bacteria 1796
260 nmdc:mga03n38_1427_c1 3300050490 Bacteria 6826
261 nmdc:mga03n38_188977_c1 3300050490 Bacteria 1060
262 nmdc:mga03n38_246207_c1 3300050490 Bacteria 943
263 nmdc:mga03n38_335460_c1 3300050490 Bacteria 820
264 nmdc:mga00v17_122005_c1 3300050491 Bacteria 1660
265 nmdc:mga00v17_16600_c1 3300050491 Bacteria 4151
266 nmdc:mga00v17_212441_c1 3300050491 Bacteria 1252
267 nmdc:mga00v17_4489_c1 3300050491 Bacteria 7265
268 nmdc:mga00v17_5653_c1 3300050491 Bacteria 6596
269 nmdc:mga00v17_5781_c1 3300050491 Bacteria 6535
270 nmdc:mga00v17_624862_c1 3300050491 Unclassified 694
271 nmdc:mga00v17_69206_c1 3300050491 Bacteria 2184
272 nmdc:mga00v17_86918_c1 3300050491 Bacteria 1960
273 nmdc:mga0yw44_122845_c1 3300050492 Bacteria 1674
274 nmdc:mga0yw44_19834_c1 3300050492 Bacteria 3716
275 nmdc:mga0yw44_47157_c1 3300050492 Bacteria 2592
276 nmdc:mga0yw44_682710_c1 3300050492 Bacteria 698
277 nmdc:mga0yw44_7316_c1 3300050492 Bacteria 5421
278 nmdc:mga0k408_112412_c1 3300050493 Bacteria 1610
279 nmdc:mga0k408_475928_c1 3300050493 Bacteria 741
280 nmdc:mga06z11_28086_c2 3300050494 Bacteria 2137
281 nmdc:mga06z11_41331_c1 3300050494 Bacteria 2307
282 nmdc:mga06z11_89074_c1 3300050494 Bacteria 1672
283 nmdc:mga04h51_156225_c1 3300050495 Bacteria 875
284 nmdc:mga07m45_1104_c1 3300050496 Bacteria 12054
285 nmdc:mga07m45_15028_c1 3300050496 Bacteria 4134
286 nmdc:mga07m45_19380_c1 3300050496 Bacteria 3686
287 nmdc:mga07m45_52125_c1 3300050496 Bacteria 2309
288 nmdc:mga07m45_6806_c1 3300050496 Bacteria 5808
289 nmdc:mga07m45_72549_c1 3300050496 Bacteria 1960
290 nmdc:mga06r32_457063_c1 3300050510 Bacteria 1256
291 nmdc:mga0sz30_161572_c1 3300050516 Bacteria 992
292 nmdc:mga0sz30_309604_c1 3300050516 Bacteria 704
293 nmdc:mga0sz30_37896_c1 3300050516 Bacteria 2019
294 nmdc:mga0sz30_39899_c1 3300050516 Bacteria 1972
295 nmdc:mga0sz30_41125_c1 3300050516 Bacteria 1943
296 nmdc:mga0sz30_9265_c1 3300050516 Bacteria 3739
297 nmdc:mga0sz30_95629_c1 3300050516 Bacteria 1295
298 Ga0500643_007685 3300053087 Bacteria 4316
299 Ga0500562_024490 3300053108 Bacteria 1578
300 Ga0500595_023952 3300053119 Bacteria 2138
301 Ga0500604_0203329 3300053151 Unclassified 681
302 Ga0500616_0048447 3300053153 Bacteria 2253
303 Ga0500622_0001398 3300053156 Bacteria 19442
304 Ga0500645_000063 3300053730 Bacteria 85018
305 Ga0466962_0112783 3300061719 Bacteria 1309
306 2511126296 2510917021 Bacteria 5705459
307 2644636367 2643221715 Bacteria 6671032
308 2689964372 2687453737 Bacteria 11203906
309 2738707187 2738541274 Bacteria 6909446
310 2738890817 2738541308 Bacteria 7020677
311 2739333379 2738543028 Bacteria 6917070
312 8054304121 8054302542 Bacteria 5698134
313 Ga0495602_0448515
314 JGI24750J21931_1023383
315 JGI25406J46586_10076303
316 Ga0070658_10732030
317 Ga0070683_100046557
318 Ga0070683_100331757
319 Ga0070670_100206456
320 Ga0070670_100265777
321 Ga0070682_100516714
322 Ga0068868_100242690
323 Ga0070692_10681818
324 Ga0070668_100000985
325 Ga0070668_100208217
326 Ga0070668_100279901
327 Ga0070669_100000585
328 Ga0070671_100007487
329 Ga0070674_100522685
330 Ga0070673_100926734
331 Ga0070688_100157962
332 Ga0070667_100009650
333 Ga0070713_100032107
334 Ga0070700_100085065
335 Ga0070685_10306197
336 Ga0070679_100648779
337 Ga0070684_100284644
338 Ga0070684_100776284
339 Ga0070686_100017713
340 Ga0070686_100065078
341 Ga0070665_100001066
342 Ga0070665_100014931
343 Ga0070664_101355985
344 Ga0068857_100482000
345 Ga0068856_101016681
346 Ga0070702_100555119
347 Ga0068861_101116117
348 Ga0068863_100024964
349 Ga0068863_100573721
350 Ga0068858_100061215
351 Ga0068858_100725786
352 Ga0068858_101023310
353 Ga0068860_100208003
354 Ga0068862_100032314
355 Ga0081539_10012841
356 Ga0075365_10005338
357 Ga0075365_10006341
358 Ga0075365_10040712
359 Ga0075365_10522656
360 Ga0075368_10039977
361 Ga0075363_100000207
362 Ga0075363_100000409
363 Ga0075363_100001138
364 Ga0075363_100007548
365 Ga0075364_10000430
366 Ga0075364_10006729
367 Ga0075364_10010653
368 Ga0075364_10036667
369 Ga0075364_10655046
370 Ga0075362_10021753
371 Ga0075362_10040565
372 Ga0075362_10295994
373 Ga0075367_10023693
374 Ga0075367_10065001
375 Ga0075367_10113829
376 Ga0075367_10124884
377 Ga0075369_10005602
378 Ga0075369_10017794
379 Ga0075369_10047860
380 Ga0075369_10053805
381 Ga0075369_10064161
382 Ga0075369_10070435
383 Ga0075369_10075108
384 Ga0075369_10196178
385 Ga0075369_10293647
386 Ga0075366_10456768
387 Ga0075370_10002302
388 Ga0075370_10002694
389 Ga0075370_10002721
390 Ga0075370_10020244
391 Ga0075370_10042142
392 Ga0075370_10080285
393 Ga0068871_100370066
394 Ga0075430_100100709
395 Ga0068865_100235164
396 Ga0111539_10816403
397 Ga0105245_10972962
398 Ga0105247_10000046
399 Ga0105247_10000082
400 Ga0105247_10134307
401 Ga0105243_10022185
402 Ga0105243_10289123
403 Ga0105248_10132433
404 Ga0105248_11066208
405 Ga0105238_10668378
406 Ga0105249_10026890
407 Ga0105249_10421335
408 Ga0105239_10029139
409 Ga0105239_10297589
410 Ga0105239_10836894
411 Ga0157369_10068368
412 Ga0157374_10909349
413 Ga0163162_10089729
414 Ga0163162_10513130
415 Ga0157375_10018691
416 Ga0157375_11645999
417 Ga0163163_10021493
418 Ga0163163_10252428
419 Ga0163163_10799748
420 Ga0157380_10199893
421 Ga0157380_11282107
422 Ga0157379_10203156
423 Ga0163161_10046774
424 Ga0163161_10123943
425 Ga0207710_10000071
426 Ga0207710_10000194
427 Ga0207652_10654016
428 Ga0207681_10001078
429 Ga0207681_10030439
430 Ga0207694_10499296
431 Ga0207650_10500827
432 Ga0207700_10028472
433 Ga0207664_10035567
434 Ga0207644_10034438
435 Ga0207669_10392838
436 Ga0207704_10702333
437 Ga0207661_10290215
438 Ga0207661_10407906
439 Ga0207651_10980162
440 Ga0207712_10339241
441 Ga0207712_10736274
442 Ga0207668_10000699
443 Ga0207668_10115284
444 Ga0207668_10608394
445 Ga0207658_10002701
446 Ga0207658_10007550
447 Ga0207658_10703011
448 Ga0207677_10160539
449 Ga0207703_10047024
450 Ga0207703_10891410
451 Ga0207678_10298416
452 Ga0207708_10036633
453 Ga0207641_10087937
454 Ga0209813_10092334
455 Ga0268266_10007966
456 Ga0268266_10010749
457 Ga0268265_10262444
458 Ga0268265_11172219
459 Ga0265338_10003562
460 Ga0265338_10008464
461 Ga0307509_10000019
462 Ga0307508_10060758
463 Ga0307405_11393846
464 Ga0307413_10088118
465 Ga0307410_10002490
466 Ga0307416_100040612
467 Ga0307416_101555471
468 Ga0307415_100011048
469 Ga0439461_0020244
470 Ga0439465_0002144
471 Ga0451793_0311084
472 Ga0439431_0058175
473 Ga0439442_016781
474 Ga0439445_0034886
475 Ga0439434_0014850
476 Ga0466972_0023844
477 Ga0466972_0040139
478 Ga0466972_0073910
479 Ga0466965_0018363
480 Ga0466965_0048519
481 Ga0466965_0121796
482 Ga0466966_0011300
483 Ga0466961_0022690
484 Ga0466971_0036606
485 Ga0466968_0045308
486 Ga0466970_0001592
487 Ga0466957_0029019
488 Ga0466957_0042669
489 Ga0466957_0427660
490 Ga0466957_0443921
491 Ga0466960_0003597
492 Ga0466960_0044700
493 Ga0466960_0087104
494 Ga0466960_0191148
495 Ga0466959_0075911
496 Ga0466958_0007257
497 Ga0466958_0060717
498 Ga0466967_0037543
499 Ga0466967_0039812
500 Ga0466967_0054000
501 Ga0466967_0968808
502 Ga0495638_0000703
503 Ga0495638_0000995
504 Ga0495638_0033345
505 Ga0495596_0155636
506 Ga0495610_0000217
507 Ga0495616_0125434
508 Ga0495643_0000004
509 Ga0495643_0247170
510 Ga0495654_0077074
511 Ga0495668_0374155
512 Ga0495625_0000913
513 Ga0495625_0002009
514 Ga0495625_0034737
515 Ga0495670_0455857
516 Ga0495674_0548245
517 Ga0495687_066330
518 Ga0495615_0000028
519 Ga0495626_0132211
520 Ga0496100_0045087
521 Ga0496100_0190625
522 Ga0496101_0001446
523 Ga0496101_0009506
524 Ga0496101_0065393
525 Ga0496101_0352170
526 Ga0496102_0009714
527 Ga0496102_1073316
528 Ga0496104_0009845
529 Ga0496104_0200810
530 Ga0496104_0655874
531 Ga0496105_0046456
532 Ga0496108_0402233
533 Ga0496108_0731223
534 Ga0496111_0271375
535 Ga0496112_0221615
536 Ga0496112_0246418
537 Ga0496112_0682372
538 Ga0496112_0926858
539 Ga0496113_0319550
540 Ga0496113_0567541
541 Ga0496114_0585022
542 Ga0496115_0102287
543 Ga0496117_0176392
544 Ga0496118_0129053
545 Ga0496119_0007047
546 Ga0496121_0001856
547 Ga0496121_0002149
548 Ga0496122_0003670
549 Ga0496123_0000610
550 Ga0496124_0022013
551 Ga0496124_0027204
552 Ga0496125_0002458
553 Ga0496125_0013097
554 Ga0496125_0031288
555 Ga0496126_0001953
556 Ga0496126_0015658
557 Ga0496126_0126332
558 Ga0496126_0841045
559 Ga0501033_0121564
560 Ga0501043_0243424
561 Ga0501067_0380692
562 Ga0501070_0460935
563 Ga0501072_0249759
564 Ga0501198_003114
565 Ga0501249_001277
566 Ga0501035_0960478
567 Ga0501044_0001182
568 Ga0501204_000402
569 nmdc:mga03683_111834_c1
570 nmdc:mga03683_42347_c1
571 nmdc:mga03683_46672_c1
572 nmdc:mga03n38_1427_c1
573 nmdc:mga03n38_188977_c1
574 nmdc:mga03n38_246207_c1
575 nmdc:mga03n38_335460_c1
576 nmdc:mga00v17_122005_c1
577 nmdc:mga00v17_16600_c1
578 nmdc:mga00v17_212441_c1
579 nmdc:mga00v17_4489_c1
580 nmdc:mga00v17_5653_c1
581 nmdc:mga00v17_5781_c1
582 nmdc:mga00v17_624862_c1
583 nmdc:mga00v17_69206_c1
584 nmdc:mga00v17_86918_c1
585 nmdc:mga0yw44_122845_c1
586 nmdc:mga0yw44_19834_c1
587 nmdc:mga0yw44_47157_c1
588 nmdc:mga0yw44_682710_c1
589 nmdc:mga0yw44_7316_c1
590 nmdc:mga0k408_112412_c1
591 nmdc:mga0k408_475928_c1
592 nmdc:mga06z11_28086_c2
593 nmdc:mga06z11_41331_c1
594 nmdc:mga06z11_89074_c1
595 nmdc:mga04h51_156225_c1
596 nmdc:mga07m45_1104_c1
597 nmdc:mga07m45_15028_c1
598 nmdc:mga07m45_19380_c1
599 nmdc:mga07m45_52125_c1
600 nmdc:mga07m45_6806_c1
601 nmdc:mga07m45_72549_c1
602 nmdc:mga06r32_457063_c1
603 nmdc:mga0sz30_161572_c1
604 nmdc:mga0sz30_309604_c1
605 nmdc:mga0sz30_37896_c1
606 nmdc:mga0sz30_39899_c1
607 nmdc:mga0sz30_41125_c1
608 nmdc:mga0sz30_9265_c1
609 nmdc:mga0sz30_95629_c1
610 Ga0500643_007685
611 Ga0500562_024490
612 Ga0500595_023952
613 Ga0500604_0203329
614 Ga0500616_0048447
615 Ga0500622_0001398
616 Ga0500645_000063
617 Ga0466962_0112783
618 2511126296
619 2644636367
620 2689964372
621 2738707187
622 2738890817
623 2739333379
624 8054304121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

35

157

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a76-assembly1.cif.gz_A the crystal structure of lina 0.9075 13 141
3s5c-assembly1.cif.gz_B crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2 0.8993 13 144
5kvb-assembly1.cif.gz_A the crystal structure of hexachlorocyclohexane dehydrochlorinase lina-type3 from novosphingobium barchaimii ll02 0.8915 13 144
8abt-assembly2.cif.gz_B crystal structure of naldpa in complex with the product analog resveratrol 0.873 4 141
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.8688 1 145
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9228 14 142 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9075 13 141 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8772 14 142 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8718 16 139 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8594 18 151 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A0S4QJW6-F1-model_v4 SnoaL-like domain-containing protein 0.9884 2 185
AF-A0A419ZGS5-F1-model_v4 deleted 0.982 7 185
AF-A0A0S4QJW6-F1-model_v4 SnoaL-like domain-containing protein 0.9778 2 185
AF-A0R6P5-F1-model_v4 SnoaL-like domain-containing protein 0.9731 1 185
AF-A0A1V2I4Z3-F1-model_v4 SnoaL-like domain-containing protein 0.9617 37 185

Map