F401772

General Info

Members Datasets Scaffolds Average Seq Length
312 169 624 209

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10000321|Ga0316575_100003215
Length 222
Sequence VLAGPTRLAGWRNKLFIMGFYSKFLLPKAVHFLCSTKLIRKQREKVVPLAAGRVLEIGIGSGLNLPLYDSGKVQQVWGLDPSMELWALAKETVARVEFNLEFIKGDAETIPLDDSSADSVLVTYTLCTVSSVVPVLEEIRRVLKPNGQLIFCEHGAAPDAAVRRWQNWLNPIWKRFGGGCNLNLPIPSLLEQSGFKIRGMDAMYLPGWKPATFNYWGTACSF

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
126 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 0
Rhizoplane 2.56
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 16.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10000321 3300031665 Bacteria 13515
2 SwRhRL2b_contig_706375 2162886007 Unclassified 2430
3 Ga0065704_10092703 3300005289 Bacteria 2638
4 Ga0065712_10351575 3300005290 Bacteria 787
5 Ga0065707_10107164 3300005295 Bacteria 2566
6 Ga0070676_10364134 3300005328 Bacteria 997
7 Ga0070690_100222215 3300005330 Bacteria 1324
8 Ga0070690_100535679 3300005330 Bacteria 881
9 Ga0068869_100045128 3300005334 Bacteria 3172
10 Ga0070687_100035218 3300005343 Bacteria 2484
11 Ga0070661_100410361 3300005344 Bacteria 1072
12 Ga0070692_10472692 3300005345 Unclassified 807
13 Ga0070668_100129263 3300005347 Bacteria 2026
14 Ga0070674_100030152 3300005356 Bacteria 3581
15 Ga0070703_10005936 3300005406 Bacteria 3420
16 Ga0070703_10032399 3300005406 Bacteria 1587
17 Ga0070709_10025187 3300005434 Unclassified 3512
18 Ga0070709_10123142 3300005434 Unclassified 1761
19 Ga0070714_100031378 3300005435 Unclassified 4433
20 Ga0070714_100267436 3300005435 Bacteria 1585
21 Ga0070714_100561295 3300005435 Unclassified 1094
22 Ga0070713_100002782 3300005436 Bacteria 11434
23 Ga0070713_100044914 3300005436 Bacteria 3618
24 Ga0070701_10032035 3300005438 Bacteria 2614
25 Ga0070705_100209198 3300005440 Bacteria 1343
26 Ga0070705_100260741 3300005440 Bacteria 1222
27 Ga0070705_100464342 3300005440 Bacteria 953
28 Ga0070700_100031522 3300005441 Bacteria 3178
29 Ga0070700_100052059 3300005441 Bacteria 2551
30 Ga0070694_100155436 3300005444 Bacteria 1674
31 Ga0070694_100347178 3300005444 Bacteria 1149
32 Ga0070694_100498148 3300005444 Unclassified 969
33 Ga0070694_100715322 3300005444 Unclassified 815
34 Ga0070708_100045353 3300005445 Bacteria 3872
35 Ga0070708_100058840 3300005445 Bacteria 3425
36 Ga0070708_100230457 3300005445 Bacteria 1738
37 Ga0070708_100751466 3300005445 Bacteria 917
38 Ga0070678_100296813 3300005456 Bacteria 1372
39 Ga0070662_100107218 3300005457 Bacteria 2123
40 Ga0070706_100004322 3300005467 Bacteria 13759
41 Ga0070706_100017516 3300005467 Bacteria 6612
42 Ga0070706_100081357 3300005467 Bacteria 2999
43 Ga0070706_100085446 3300005467 Unclassified 2924
44 Ga0070706_100177133 3300005467 Bacteria 1991
45 Ga0070707_100004652 3300005468 Bacteria 12846
46 Ga0070707_100032861 3300005468 Bacteria 4944
47 Ga0070707_100122496 3300005468 Unclassified 2525
48 Ga0070707_100149904 3300005468 Bacteria 2271
49 Ga0070707_100192613 3300005468 Bacteria 1988
50 Ga0070707_100255076 3300005468 Bacteria 1707
51 Ga0070707_100426089 3300005468 Unclassified 1287
52 Ga0070698_100017088 3300005471 Bacteria 7647
53 Ga0070698_100028153 3300005471 Bacteria 5839
54 Ga0070698_100047279 3300005471 Unclassified 4399
55 Ga0070698_100110792 3300005471 Unclassified 2709
56 Ga0070698_100660355 3300005471 Bacteria 987
57 Ga0070699_100028172 3300005518 Bacteria 4844
58 Ga0070699_100037883 3300005518 Bacteria 4174
59 Ga0070699_100044835 3300005518 Bacteria 3828
60 Ga0070699_100055453 3300005518 Bacteria 3431
61 Ga0070699_100122211 3300005518 Bacteria 2290
62 Ga0070699_100171678 3300005518 Bacteria 1921
63 Ga0070697_100009751 3300005536 Bacteria 7490
64 Ga0070697_100018927 3300005536 Bacteria 5434
65 Ga0070686_100069936 3300005544 Bacteria 2294
66 Ga0070696_100257596 3300005546 Bacteria 1322
67 Ga0070704_100057356 3300005549 Bacteria 2769
68 Ga0070704_100101714 3300005549 Bacteria 2167
69 Ga0070704_100169228 3300005549 Bacteria 1736
70 Ga0068856_100250910 3300005614 Bacteria 1785
71 Ga0068859_100151158 3300005617 Bacteria 2397
72 Ga0068859_100306034 3300005617 Bacteria 1683
73 Ga0068861_100068505 3300005719 Bacteria 2742
74 Ga0068870_10134204 3300005840 Bacteria 1441
75 Ga0068863_101351035 3300005841 Unclassified 720
76 Ga0068858_100652833 3300005842 Bacteria 1022
77 Ga0068860_100005190 3300005843 Bacteria 13240
78 Ga0068862_100009307 3300005844 Bacteria 8133
79 Ga0068862_100063086 3300005844 Bacteria 3189
80 Ga0068862_100076620 3300005844 Bacteria 2894
81 Ga0068862_100376836 3300005844 Unclassified 1322
82 Ga0070717_10045870 3300006028 Unclassified 3574
83 Ga0070717_10110683 3300006028 Unclassified 2342
84 Ga0070717_10126133 3300006028 Unclassified 2198
85 Ga0075365_10029379 3300006038 Bacteria 3513
86 Ga0075368_10034858 3300006042 Bacteria 1963
87 Ga0075364_10038032 3300006051 Bacteria 3118
88 Ga0075364_10054303 3300006051 Bacteria 2620
89 Ga0070716_100241729 3300006173 Unclassified 1225
90 Ga0070712_100044782 3300006175 Bacteria 3052
91 Ga0075362_10012176 3300006177 Bacteria 3410
92 Ga0075362_10012246 3300006177 Bacteria 3403
93 Ga0075367_10013101 3300006178 Bacteria 4444
94 Ga0075366_10001704 3300006195 Bacteria 11042
95 Ga0075370_10038597 3300006353 Bacteria 2688
96 Ga0068871_100030257 3300006358 Unclassified 4261
97 Ga0068871_100384100 3300006358 Bacteria 1248
98 Ga0075428_100292181 3300006844 Bacteria 1753
99 Ga0075430_100139605 3300006846 Bacteria 2018
100 Ga0075431_100001538 3300006847 Bacteria 21366
101 Ga0075431_100307116 3300006847 Bacteria 1602
102 Ga0075431_100413320 3300006847 Bacteria 1349
103 Ga0075433_10077146 3300006852 Unclassified 2935
104 Ga0075433_10094709 3300006852 Bacteria 2643
105 Ga0075429_100002969 3300006880 Bacteria 14385
106 Ga0075429_100085188 3300006880 Bacteria 2755
107 Ga0068865_100338305 3300006881 Unclassified 1216
108 Ga0075436_100003364 3300006914 Bacteria 10945
109 Ga0075436_100021715 3300006914 Bacteria 4405
110 Ga0097620_100151145 3300006931 Bacteria 2397
111 Ga0097620_100306034 3300006931 Bacteria 1683
112 Ga0097620_101410152 3300006931 Unclassified 768
113 Ga0075435_100276617 3300007076 Bacteria 1433
114 Ga0075435_100635513 3300007076 Bacteria 926
115 Ga0099794_10004090 3300007265 Bacteria 5675
116 Ga0099794_10004346 3300007265 Bacteria 5550
117 Ga0099794_10014796 3300007265 Bacteria 3428
118 Ga0099794_10039772 3300007265 Bacteria 2233
119 Ga0099794_10079855 3300007265 Unclassified 1612
120 Ga0105240_10478867 3300009093 Bacteria 1388
121 Ga0105240_10997917 3300009093 Bacteria 896
122 Ga0111539_10112902 3300009094 Bacteria 3187
123 Ga0114129_10007047 3300009147 Bacteria 16003
124 Ga0114129_10083315 3300009147 Bacteria 4443
125 Ga0114129_10307779 3300009147 Unclassified 2110
126 Ga0114129_10547646 3300009147 Bacteria 1505
127 Ga0114129_11196343 3300009147 Unclassified 947
128 Ga0114129_11653115 3300009147 Bacteria 783
129 Ga0105243_10099253 3300009148 Bacteria 2413
130 Ga0105243_10697085 3300009148 Bacteria 989
131 Ga0105242_10100248 3300009176 Bacteria 2453
132 Ga0105242_10523019 3300009176 Unclassified 1132
133 Ga0105242_10788240 3300009176 Bacteria 939
134 Ga0105248_10102617 3300009177 Bacteria 3224
135 Ga0105249_10128848 3300009553 Bacteria 2413
136 Ga0105249_10613005 3300009553 Bacteria 1144
137 Ga0105249_11085436 3300009553 Unclassified 870
138 Ga0105246_10012249 3300011119 Bacteria 5345
139 Ga0105246_10105935 3300011119 Bacteria 2056
140 Ga0157369_10321235 3300013105 Bacteria 1609
141 Ga0157378_10036633 3300013297 Bacteria 4341
142 Ga0163162_10002384 3300013306 Bacteria 17661
143 Ga0157372_10713137 3300013307 Bacteria 1167
144 Ga0157375_10025905 3300013308 Bacteria 5457
145 Ga0157375_10730347 3300013308 Bacteria 1143
146 Ga0163163_10310864 3300014325 Bacteria 1629
147 Ga0163163_10617297 3300014325 Unclassified 1148
148 Ga0157379_10114937 3300014968 Bacteria 2419
149 Ga0157379_11256165 3300014968 Bacteria 714
150 Ga0157376_10080660 3300014969 Bacteria 2792
151 Ga0163161_10200099 3300017792 Bacteria 1539
152 Ga0207653_10010265 3300025885 Bacteria 2921
153 Ga0207684_10002758 3300025910 Bacteria 17502
154 Ga0207684_10005280 3300025910 Bacteria 11978
155 Ga0207684_10007501 3300025910 Bacteria 9817
156 Ga0207684_10017704 3300025910 Bacteria 6113
157 Ga0207684_10026184 3300025910 Bacteria 4971
158 Ga0207684_10090995 3300025910 Bacteria 2600
159 Ga0207684_10100114 3300025910 Bacteria 2476
160 Ga0207693_10001215 3300025915 Bacteria 22979
161 Ga0207693_10550466 3300025915 Bacteria 900
162 Ga0207662_10003449 3300025918 Bacteria 8140
163 Ga0207649_10739346 3300025920 Bacteria 765
164 Ga0207646_10003789 3300025922 Bacteria 16834
165 Ga0207646_10021549 3300025922 Bacteria 5954
166 Ga0207646_10060870 3300025922 Bacteria 3371
167 Ga0207646_10147781 3300025922 Bacteria 2118
168 Ga0207646_10179369 3300025922 Bacteria 1913
169 Ga0207646_10187207 3300025922 Bacteria 1870
170 Ga0207646_10260052 3300025922 Bacteria 1569
171 Ga0207700_10087853 3300025928 Bacteria 2446
172 Ga0207664_10047833 3300025929 Bacteria 3362
173 Ga0207664_10175530 3300025929 Bacteria 1837
174 Ga0207706_10616036 3300025933 Bacteria 931
175 Ga0207686_10057757 3300025934 Bacteria 2444
176 Ga0207709_10206745 3300025935 Bacteria 1406
177 Ga0207665_10082301 3300025939 Unclassified 2218
178 Ga0207689_10054013 3300025942 Bacteria 3309
179 Ga0207651_10326800 3300025960 Bacteria 1284
180 Ga0207712_10043376 3300025961 Unclassified 3102
181 Ga0207712_10496531 3300025961 Bacteria 1042
182 Ga0207712_10608790 3300025961 Unclassified 946
183 Ga0207712_10745653 3300025961 Unclassified 858
184 Ga0207703_10088716 3300026035 Bacteria 2596
185 Ga0207708_10015639 3300026075 Bacteria 5691
186 Ga0207702_10506360 3300026078 Bacteria 1177
187 Ga0207676_10516512 3300026095 Bacteria 1136
188 Ga0207675_100030518 3300026118 Bacteria 5022
189 Ga0207675_100223135 3300026118 Bacteria 1816
190 Ga0209588_1002352 3300027671 Bacteria 5126
191 Ga0209588_1010253 3300027671 Bacteria 2814
192 Ga0209588_1024859 3300027671 Unclassified 1892
193 Ga0209588_1025278 3300027671 Bacteria 1878
194 Ga0209588_1047588 3300027671 Bacteria 1387
195 Ga0209813_10038873 3300027866 Bacteria 1440
196 Ga0207428_10000595 3300027907 Bacteria 42731
197 Ga0268266_11376265 3300028379 Unclassified 681
198 Ga0268265_10169906 3300028380 Bacteria 1862
199 Ga0268265_10346645 3300028380 Bacteria 1354
200 Ga0268265_10661326 3300028380 Bacteria 1005
201 Ga0268264_10018340 3300028381 Bacteria 5722
202 Ga0268264_10125906 3300028381 Bacteria 2264
203 Ga0316575_10109999 3300031665 Bacteria 1124
204 Ga0316579_10013926 3300031691 Bacteria 3469
205 Ga0316576_10051096 3300031727 Bacteria 3008
206 Ga0316576_10233635 3300031727 Bacteria 1382
207 Ga0316578_10000816 3300031728 Bacteria 11574
208 Ga0316578_10020707 3300031728 Bacteria 3639
209 Ga0316578_10154993 3300031728 Bacteria 1381
210 Ga0316578_10241275 3300031728 Bacteria 1085
211 Ga0307405_10337064 3300031731 Bacteria 1158
212 Ga0307405_10457771 3300031731 Unclassified 1013
213 Ga0307406_10522863 3300031901 Unclassified 966
214 Ga0307412_10494732 3300031911 Bacteria 1017
215 Ga0307416_100271282 3300032002 Bacteria 1666
216 Ga0307415_100033274 3300032126 Bacteria 3346
217 Ga0316583_10134177 3300032133 Unclassified 862
218 Ga0373956_0298686 3300035119 Unclassified 767
219 Ga0316574_0002085 3300035398 Bacteria 9891
220 Ga0316574_0005892 3300035398 Bacteria 6577
221 Ga0316574_0036760 3300035398 Bacteria 2999
222 Ga0316574_0072031 3300035398 Bacteria 2183
223 Ga0316574_0188946 3300035398 Unclassified 1325
224 Ga0316574_0358129 3300035398 Unclassified 922
225 Ga0373931_0090738 3300035691 Bacteria 1702
226 Ga0373927_0007172 3300035695 Bacteria 7563
227 Ga0373927_0120433 3300035695 Bacteria 1713
228 Ga0373937_1233760 3300036401 Unclassified 696
229 Ga0316582_0001480 3300036647 Bacteria 10355
230 Ga0316582_0342169 3300036647 Bacteria 1029
231 Ga0316582_0798713 3300036647 Unclassified 647
232 Ga0316584_0000395 3300036712 Bacteria 22676
233 Ga0316584_0063696 3300036712 Bacteria 2761
234 Ga0316584_0118896 3300036712 Bacteria 1976
235 Ga0316584_0362745 3300036712 Bacteria 1038
236 Ga0316584_0618915 3300036712 Unclassified 749
237 Ga0316584_0752960 3300036712 Unclassified 664
238 Ga0439465_0012570 3300041413 Bacteria 2647
239 Ga0451793_0091598 3300041452 Bacteria 2027
240 Ga0451833_0782041 3300041491 Bacteria 1356
241 Ga0451837_0543369 3300041494 Bacteria 2663
242 Ga0451839_0862822 3300041496 Bacteria 3447
243 Ga0451841_0619275 3300041498 Bacteria 1649
244 Ga0439432_011153 3300042006 Bacteria 3097
245 Ga0451577_0316020 3300042876 Bacteria 1416
246 Ga0453683_0057339 3300044673 Bacteria 2437
247 Ga0453683_0074551 3300044673 Bacteria 2124
248 Ga0453684_0115988 3300044712 Bacteria 3244
249 Ga0451576_0307533 3300045051 Bacteria 1658
250 Ga0495580_0149153 3300046472 Bacteria 1620
251 Ga0495580_0471042 3300046472 Bacteria 841
252 Ga0495609_0102553 3300046538 Bacteria 1239
253 Ga0495609_0164739 3300046538 Unclassified 938
254 Ga0495597_0013818 3300046542 Bacteria 3859
255 Ga0495625_0248607 3300046660 Bacteria 1155
256 Ga0495659_0216177 3300046664 Bacteria 790
257 Ga0495674_0160397 3300047319 Bacteria 1882
258 Ga0496100_0194055 3300048903 Bacteria 1476
259 Ga0496102_0000450 3300048905 Bacteria 46831
260 Ga0496103_0003151 3300048906 Bacteria 10134
261 Ga0496104_0004777 3300048907 Bacteria 11797
262 Ga0496106_0051784 3300048909 Unclassified 3096
263 Ga0496106_0117386 3300048909 Bacteria 2076
264 Ga0496112_0647233 3300048915 Bacteria 987
265 Ga0501047_0190801 3300049581 Bacteria 1913
266 Ga0501071_0394847 3300049587 Bacteria 1056
267 Ga0501072_0004658 3300049588 Bacteria 10444
268 Ga0501073_0044784 3300049589 Bacteria 3119
269 Ga0501076_0790633 3300049592 Bacteria 783
270 Ga0501077_0390489 3300049593 Bacteria 889
271 Ga0501080_0278142 3300049742 Bacteria 1522
272 Ga0501083_0044987 3300049744 Bacteria 2987
273 nmdc:mga03683_4038_c2 3300050489 Bacteria 3421
274 nmdc:mga03683_56483_c1 3300050489 Bacteria 1650
275 nmdc:mga00v17_119015_c1 3300050491 Bacteria 1681
276 nmdc:mga00v17_83744_c1 3300050491 Bacteria 1995
277 nmdc:mga0yw44_143970_c1 3300050492 Bacteria 1550
278 nmdc:mga0yw44_42197_c1 3300050492 Bacteria 2719
279 nmdc:mga06z11_15239_c1 3300050494 Bacteria 3427
280 nmdc:mga04h51_197562_c1 3300050495 Unclassified 789
281 nmdc:mga07m45_194171_c1 3300050496 Bacteria 1181
282 nmdc:mga05p37_172830_c2 3300050507 Bacteria 2307
283 nmdc:mga05p37_295280_c1 3300050507 Bacteria 1927
284 nmdc:mga05p37_6578_c1 3300050507 Bacteria 10663
285 nmdc:mga09592_1060_c1 3300050508 Bacteria 21814
286 nmdc:mga09592_119635_c1 3300050508 Bacteria 2262
287 nmdc:mga09592_163258_c1 3300050508 Bacteria 1925
288 nmdc:mga09592_174614_c1 3300050508 Bacteria 1858
289 nmdc:mga0qj67_111152_c1 3300050509 Bacteria 2212
290 nmdc:mga06r32_137578_c1 3300050510 Bacteria 2417
291 nmdc:mga06r32_319530_c1 3300050510 Bacteria 1538
292 nmdc:mga06r32_627568_c1 3300050510 Bacteria 1044
293 nmdc:mga06r32_763642_c1 3300050510 Bacteria 929
294 nmdc:mga06r32_8398_c1 3300050510 Bacteria 9303
295 nmdc:mga0n895_361857_c1 3300050512 Bacteria 1469
296 nmdc:mga0n895_555042_c1 3300050512 Bacteria 1154
297 nmdc:mga0n895_871657_c1 3300050512 Unclassified 887
298 nmdc:mga0rr50_13450_c1 3300050513 Bacteria 5328
299 nmdc:mga0rr50_293363_c1 3300050513 Bacteria 1359
300 nmdc:mga0rr50_61143_c1 3300050513 Bacteria 2837
301 nmdc:mga08x19_32570_c1 3300050514 Bacteria 3286
302 nmdc:mga08x19_50406_c1 3300050514 Bacteria 2672
303 nmdc:mga08x19_5559_c1 3300050514 Bacteria 7453
304 nmdc:mga0a205_179704_c1 3300050515 Bacteria 2010
305 nmdc:mga0a205_539969_c1 3300050515 Bacteria 1022
306 nmdc:mga0a205_70882_c1 3300050515 Unclassified 3365
307 Ga0500578_0066540 3300053086 Bacteria 2298
308 Ga0500569_014783 3300053109 Bacteria 1940
309 Ga0500658_0110124 3300053134 Bacteria 1211
310 Ga0501084_0005188 3300054114 Bacteria 10657
311 Ga0501084_0357266 3300054114 Unclassified 1234
312 Ga0501084_0775738 3300054114 Bacteria 808
313 Ga0316575_10000321
314 SwRhRL2b_contig_706375
315 Ga0065704_10092703
316 Ga0065712_10351575
317 Ga0065707_10107164
318 Ga0070676_10364134
319 Ga0070690_100222215
320 Ga0070690_100535679
321 Ga0068869_100045128
322 Ga0070687_100035218
323 Ga0070661_100410361
324 Ga0070692_10472692
325 Ga0070668_100129263
326 Ga0070674_100030152
327 Ga0070703_10005936
328 Ga0070703_10032399
329 Ga0070709_10025187
330 Ga0070709_10123142
331 Ga0070714_100031378
332 Ga0070714_100267436
333 Ga0070714_100561295
334 Ga0070713_100002782
335 Ga0070713_100044914
336 Ga0070701_10032035
337 Ga0070705_100209198
338 Ga0070705_100260741
339 Ga0070705_100464342
340 Ga0070700_100031522
341 Ga0070700_100052059
342 Ga0070694_100155436
343 Ga0070694_100347178
344 Ga0070694_100498148
345 Ga0070694_100715322
346 Ga0070708_100045353
347 Ga0070708_100058840
348 Ga0070708_100230457
349 Ga0070708_100751466
350 Ga0070678_100296813
351 Ga0070662_100107218
352 Ga0070706_100004322
353 Ga0070706_100017516
354 Ga0070706_100081357
355 Ga0070706_100085446
356 Ga0070706_100177133
357 Ga0070707_100004652
358 Ga0070707_100032861
359 Ga0070707_100122496
360 Ga0070707_100149904
361 Ga0070707_100192613
362 Ga0070707_100255076
363 Ga0070707_100426089
364 Ga0070698_100017088
365 Ga0070698_100028153
366 Ga0070698_100047279
367 Ga0070698_100110792
368 Ga0070698_100660355
369 Ga0070699_100028172
370 Ga0070699_100037883
371 Ga0070699_100044835
372 Ga0070699_100055453
373 Ga0070699_100122211
374 Ga0070699_100171678
375 Ga0070697_100009751
376 Ga0070697_100018927
377 Ga0070686_100069936
378 Ga0070696_100257596
379 Ga0070704_100057356
380 Ga0070704_100101714
381 Ga0070704_100169228
382 Ga0068856_100250910
383 Ga0068859_100151158
384 Ga0068859_100306034
385 Ga0068861_100068505
386 Ga0068870_10134204
387 Ga0068863_101351035
388 Ga0068858_100652833
389 Ga0068860_100005190
390 Ga0068862_100009307
391 Ga0068862_100063086
392 Ga0068862_100076620
393 Ga0068862_100376836
394 Ga0070717_10045870
395 Ga0070717_10110683
396 Ga0070717_10126133
397 Ga0075365_10029379
398 Ga0075368_10034858
399 Ga0075364_10038032
400 Ga0075364_10054303
401 Ga0070716_100241729
402 Ga0070712_100044782
403 Ga0075362_10012176
404 Ga0075362_10012246
405 Ga0075367_10013101
406 Ga0075366_10001704
407 Ga0075370_10038597
408 Ga0068871_100030257
409 Ga0068871_100384100
410 Ga0075428_100292181
411 Ga0075430_100139605
412 Ga0075431_100001538
413 Ga0075431_100307116
414 Ga0075431_100413320
415 Ga0075433_10077146
416 Ga0075433_10094709
417 Ga0075429_100002969
418 Ga0075429_100085188
419 Ga0068865_100338305
420 Ga0075436_100003364
421 Ga0075436_100021715
422 Ga0097620_100151145
423 Ga0097620_100306034
424 Ga0097620_101410152
425 Ga0075435_100276617
426 Ga0075435_100635513
427 Ga0099794_10004090
428 Ga0099794_10004346
429 Ga0099794_10014796
430 Ga0099794_10039772
431 Ga0099794_10079855
432 Ga0105240_10478867
433 Ga0105240_10997917
434 Ga0111539_10112902
435 Ga0114129_10007047
436 Ga0114129_10083315
437 Ga0114129_10307779
438 Ga0114129_10547646
439 Ga0114129_11196343
440 Ga0114129_11653115
441 Ga0105243_10099253
442 Ga0105243_10697085
443 Ga0105242_10100248
444 Ga0105242_10523019
445 Ga0105242_10788240
446 Ga0105248_10102617
447 Ga0105249_10128848
448 Ga0105249_10613005
449 Ga0105249_11085436
450 Ga0105246_10012249
451 Ga0105246_10105935
452 Ga0157369_10321235
453 Ga0157378_10036633
454 Ga0163162_10002384
455 Ga0157372_10713137
456 Ga0157375_10025905
457 Ga0157375_10730347
458 Ga0163163_10310864
459 Ga0163163_10617297
460 Ga0157379_10114937
461 Ga0157379_11256165
462 Ga0157376_10080660
463 Ga0163161_10200099
464 Ga0207653_10010265
465 Ga0207684_10002758
466 Ga0207684_10005280
467 Ga0207684_10007501
468 Ga0207684_10017704
469 Ga0207684_10026184
470 Ga0207684_10090995
471 Ga0207684_10100114
472 Ga0207693_10001215
473 Ga0207693_10550466
474 Ga0207662_10003449
475 Ga0207649_10739346
476 Ga0207646_10003789
477 Ga0207646_10021549
478 Ga0207646_10060870
479 Ga0207646_10147781
480 Ga0207646_10179369
481 Ga0207646_10187207
482 Ga0207646_10260052
483 Ga0207700_10087853
484 Ga0207664_10047833
485 Ga0207664_10175530
486 Ga0207706_10616036
487 Ga0207686_10057757
488 Ga0207709_10206745
489 Ga0207665_10082301
490 Ga0207689_10054013
491 Ga0207651_10326800
492 Ga0207712_10043376
493 Ga0207712_10496531
494 Ga0207712_10608790
495 Ga0207712_10745653
496 Ga0207703_10088716
497 Ga0207708_10015639
498 Ga0207702_10506360
499 Ga0207676_10516512
500 Ga0207675_100030518
501 Ga0207675_100223135
502 Ga0209588_1002352
503 Ga0209588_1010253
504 Ga0209588_1024859
505 Ga0209588_1025278
506 Ga0209588_1047588
507 Ga0209813_10038873
508 Ga0207428_10000595
509 Ga0268266_11376265
510 Ga0268265_10169906
511 Ga0268265_10346645
512 Ga0268265_10661326
513 Ga0268264_10018340
514 Ga0268264_10125906
515 Ga0316575_10109999
516 Ga0316579_10013926
517 Ga0316576_10051096
518 Ga0316576_10233635
519 Ga0316578_10000816
520 Ga0316578_10020707
521 Ga0316578_10154993
522 Ga0316578_10241275
523 Ga0307405_10337064
524 Ga0307405_10457771
525 Ga0307406_10522863
526 Ga0307412_10494732
527 Ga0307416_100271282
528 Ga0307415_100033274
529 Ga0316583_10134177
530 Ga0373956_0298686
531 Ga0316574_0002085
532 Ga0316574_0005892
533 Ga0316574_0036760
534 Ga0316574_0072031
535 Ga0316574_0188946
536 Ga0316574_0358129
537 Ga0373931_0090738
538 Ga0373927_0007172
539 Ga0373927_0120433
540 Ga0373937_1233760
541 Ga0316582_0001480
542 Ga0316582_0342169
543 Ga0316582_0798713
544 Ga0316584_0000395
545 Ga0316584_0063696
546 Ga0316584_0118896
547 Ga0316584_0362745
548 Ga0316584_0618915
549 Ga0316584_0752960
550 Ga0439465_0012570
551 Ga0451793_0091598
552 Ga0451833_0782041
553 Ga0451837_0543369
554 Ga0451839_0862822
555 Ga0451841_0619275
556 Ga0439432_011153
557 Ga0451577_0316020
558 Ga0453683_0057339
559 Ga0453683_0074551
560 Ga0453684_0115988
561 Ga0451576_0307533
562 Ga0495580_0149153
563 Ga0495580_0471042
564 Ga0495609_0102553
565 Ga0495609_0164739
566 Ga0495597_0013818
567 Ga0495625_0248607
568 Ga0495659_0216177
569 Ga0495674_0160397
570 Ga0496100_0194055
571 Ga0496102_0000450
572 Ga0496103_0003151
573 Ga0496104_0004777
574 Ga0496106_0051784
575 Ga0496106_0117386
576 Ga0496112_0647233
577 Ga0501047_0190801
578 Ga0501071_0394847
579 Ga0501072_0004658
580 Ga0501073_0044784
581 Ga0501076_0790633
582 Ga0501077_0390489
583 Ga0501080_0278142
584 Ga0501083_0044987
585 nmdc:mga03683_4038_c2
586 nmdc:mga03683_56483_c1
587 nmdc:mga00v17_119015_c1
588 nmdc:mga00v17_83744_c1
589 nmdc:mga0yw44_143970_c1
590 nmdc:mga0yw44_42197_c1
591 nmdc:mga06z11_15239_c1
592 nmdc:mga04h51_197562_c1
593 nmdc:mga07m45_194171_c1
594 nmdc:mga05p37_172830_c2
595 nmdc:mga05p37_295280_c1
596 nmdc:mga05p37_6578_c1
597 nmdc:mga09592_1060_c1
598 nmdc:mga09592_119635_c1
599 nmdc:mga09592_163258_c1
600 nmdc:mga09592_174614_c1
601 nmdc:mga0qj67_111152_c1
602 nmdc:mga06r32_137578_c1
603 nmdc:mga06r32_319530_c1
604 nmdc:mga06r32_627568_c1
605 nmdc:mga06r32_763642_c1
606 nmdc:mga06r32_8398_c1
607 nmdc:mga0n895_361857_c1
608 nmdc:mga0n895_555042_c1
609 nmdc:mga0n895_871657_c1
610 nmdc:mga0rr50_13450_c1
611 nmdc:mga0rr50_293363_c1
612 nmdc:mga0rr50_61143_c1
613 nmdc:mga08x19_32570_c1
614 nmdc:mga08x19_50406_c1
615 nmdc:mga08x19_5559_c1
616 nmdc:mga0a205_179704_c1
617 nmdc:mga0a205_539969_c1
618 nmdc:mga0a205_70882_c1
619 Ga0500578_0066540
620 Ga0500569_014783
621 Ga0500658_0110124
622 Ga0501084_0005188
623 Ga0501084_0357266
624 Ga0501084_0775738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

55

151

0.96

PF13649

Methyltransf_25

Methyltransferase domain

54

147

0.92

PF08242

Methyltransf_12

Methyltransferase domain

55

149

0.85

PF13847

Methyltransf_31

Methyltransferase domain

49

194

0.85

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

28

177

0.8

PF13489

Methyltransf_23

Methyltransferase domain

31

198

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ofk-assembly2.cif.gz_B crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 in complex with s-adenosyl-l-homocysteine (sah) 0.8128 15 205
3bus-assembly1.cif.gz_A crystal structure of rebm 0.7984 22 205
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.7966 24 206
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.7844 18 206
6zxw-assembly1.cif.gz_G structure of archaeoglobus fulgidus trm11-trm112 m2g10 trna methyltransferase complex bound to sinefungin 0.771 18 206
ID Description Score Start End Superfamily
af_A4HWZ1_308_486_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9382 86 208 3.40.50.150
af_O06547_23_200_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9205 16 191 3.40.50.150
af_Q4DRI7_264_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9176 78 208 3.40.50.150
af_Q4DS78_179_367_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9135 18 208 3.40.50.150
af_O06547_23_200_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8958 16 191 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V9Q758-F1-model_v4 SAM-dependent methyltransferase 0.9963 1 145 GO:0008757
GO:0032259
AF-A0A3N5LS72-F1-model_v4 Class I SAM-dependent methyltransferase 0.9926 1 128 GO:0008757
GO:0032259
AF-A0A2V9GCS0-F1-model_v4 SAM-dependent methyltransferase 0.9918 1 208 GO:0008757
GO:0032259
AF-A0A845QEQ4-F1-model_v4 Methyltransferase domain-containing protein 0.9857 1 205 GO:0008757
GO:0032259
AF-A0A3N5LS72-F1-model_v4 Class I SAM-dependent methyltransferase 0.9849 1 128 GO:0008757
GO:0032259

Map