F401750

General Info

Members Datasets Scaffolds Average Seq Length
312 219 272 324

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10362290|Ga0207679_103622902
Length 355
Sequence MDSDGEGSAGRPDRGASVAGTVTETLPHAMYRVRLEQGSLVTVLGGSGFLGRYAVRALAADGWRVRAACRRPDLAGHLQPMGAVGQIHPVQANLRYPDSVRQAVEGATAVVNLVGILAECRFCLSRSARQTFHAVHVAGARGAKTFVHVSAIGADRKYWATYARTKAAGEAAVLAEFPTAVIVRPSLVFGPEDQLFNRFAAMARLSPFLPLIGGGKTRFQPVYVGDVGAAIAAACAGKARPRTIYELGGPDIVTFRQLLDSVQEWSGRRRWYLRIPFWLAQIGAFLTAPLPHGLRPLTVDQVRMLMRPNVVDEAAVKEGRTLQGLGVTQPHAMAGIVPEYLERFRPQGQFASYRS

Samples

Sample ID Description Type Environment
1 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
2 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
3 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
4 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
5 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
6 2643221582 Rhizobium sp. Root651 Isolate Unclassified
7 2643221693 Rhizobium sp. Root491 Isolate Unclassified
8 2751185800 Brucella pituitosa AA2 Isolate Unclassified
9 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
10 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
11 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
12 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
13 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
14 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
15 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
16 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
17 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
18 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
19 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
20 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
21 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
22 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
23 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
24 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
25 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
26 2854911287 Brucella lupini LUP21 Isolate Unclassified
27 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
28 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
29 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
30 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
31 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
32 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
33 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
34 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
35 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
36 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
37 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
209 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
210 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
218 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
219 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.54
Metatranscriptomes 0.64
Isolates 12.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.82
Nodule 5.77
Rhizoplane 8.01
Rhizosphere 64.42
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1028881 3300003578 Bacteria 1130
2 Ga0055524_1002179 3300003775 Bacteria 10300
3 Ga0058692_1003204 3300003856 Bacteria 5147
4 Ga0070690_100095061 3300005330 Bacteria 1967
5 Ga0068869_100248417 3300005334 Bacteria 1420
6 Ga0070680_100044211 3300005336 Bacteria 3619
7 Ga0070680_100395325 3300005336 Bacteria 1178
8 Ga0070691_10005231 3300005341 Bacteria 5892
9 Ga0070687_100051566 3300005343 Bacteria 2131
10 Ga0070668_100284632 3300005347 Bacteria 1382
11 Ga0070703_10009986 3300005406 Bacteria 2678
12 Ga0070714_100318592 3300005435 Bacteria 1454
13 Ga0070701_10117079 3300005438 Bacteria 1496
14 Ga0070705_100000314 3300005440 Bacteria 28624
15 Ga0070700_100001078 3300005441 Bacteria 13553
16 Ga0070700_100027002 3300005441 Bacteria 3399
17 Ga0070694_100000340 3300005444 Bacteria 25019
18 Ga0070694_100074698 3300005444 Bacteria 2343
19 Ga0070708_100484322 3300005445 Bacteria 1167
20 Ga0070663_100164424 3300005455 Bacteria 1710
21 Ga0070707_100184351 3300005468 Bacteria 2035
22 Ga0070698_100131235 3300005471 Bacteria 2461
23 Ga0070699_100000401 3300005518 Bacteria 41864
24 Ga0070679_100072129 3300005530 Bacteria 3445
25 Ga0070679_100345882 3300005530 Bacteria 1435
26 Ga0070695_100008911 3300005545 Bacteria 5958
27 Ga0070695_100041803 3300005545 Bacteria 2907
28 Ga0070696_100005933 3300005546 Bacteria 8156
29 Ga0070665_100005496 3300005548 Bacteria 13057
30 Ga0070704_100256891 3300005549 Bacteria 1437
31 Ga0068857_100025533 3300005577 Bacteria 5202
32 Ga0068864_100025396 3300005618 Bacteria 4989
33 Ga0068861_100017187 3300005719 Bacteria 5129
34 Ga0068860_100044710 3300005843 Bacteria 4220
35 Ga0068860_100133682 3300005843 Bacteria 2382
36 Ga0068862_100001810 3300005844 Bacteria 19347
37 Ga0081455_10000028 3300005937 Bacteria 155778
38 Ga0081540_1000655 3300005983 Bacteria 32710
39 Ga0081539_10015092 3300005985 Bacteria 5655
40 Ga0075368_10000535 3300006042 Bacteria 11385
41 Ga0075368_10004966 3300006042 Unclassified 4542
42 Ga0075368_10006453 3300006042 Bacteria 4097
43 Ga0075363_100001467 3300006048 Bacteria 8962
44 Ga0075363_100016143 3300006048 Bacteria 3684
45 Ga0075363_100056849 3300006048 Bacteria 2098
46 Ga0075364_10001704 3300006051 Bacteria 12083
47 Ga0075364_10132795 3300006051 Bacteria 1671
48 Ga0070712_100194725 3300006175 Bacteria 1588
49 Ga0075362_10016064 3300006177 Bacteria 3058
50 Ga0075367_10001348 3300006178 Bacteria 10443
51 Ga0075367_10010645 3300006178 Bacteria 4838
52 Ga0075367_10030355 3300006178 Bacteria 3099
53 Ga0075367_10067371 3300006178 Bacteria 2146
54 Ga0075369_10032209 3300006186 Bacteria 2217
55 Ga0075370_10116378 3300006353 Bacteria 1554
56 Ga0075428_100151986 3300006844 Bacteria 2515
57 Ga0075428_100154796 3300006844 Bacteria 2490
58 Ga0075428_100245158 3300006844 Bacteria 1932
59 Ga0075430_100019378 3300006846 Bacteria 5786
60 Ga0075430_100034733 3300006846 Bacteria 4280
61 Ga0075430_100111355 3300006846 Bacteria 2282
62 Ga0075431_100002109 3300006847 Bacteria 18997
63 Ga0075431_100013057 3300006847 Bacteria 8388
64 Ga0075431_100274980 3300006847 Bacteria 1706
65 Ga0075433_10001356 3300006852 Bacteria 17970
66 Ga0075434_100001772 3300006871 Bacteria 18591
67 Ga0075434_100024429 3300006871 Bacteria 5908
68 Ga0075434_100412951 3300006871 Bacteria 1371
69 Ga0075429_100017000 3300006880 Bacteria 6290
70 Ga0075429_100168462 3300006880 Bacteria 1919
71 Ga0099826_10012836 3300006948 Bacteria 6313
72 Ga0099826_10045284 3300006948 Bacteria 3009
73 Ga0075435_100009748 3300007076 Bacteria 6983
74 Ga0075435_100265715 3300007076 Bacteria 1463
75 Ga0105244_10076854 3300009036 Bacteria 1657
76 Ga0111539_10015148 3300009094 Bacteria 9607
77 Ga0111539_10082644 3300009094 Bacteria 3778
78 Ga0111539_10232823 3300009094 Bacteria 2145
79 Ga0105245_10029031 3300009098 Bacteria 4885
80 Ga0114129_10064335 3300009147 Bacteria 5118
81 Ga0114129_10076075 3300009147 Bacteria 4673
82 Ga0114129_10220667 3300009147 Bacteria 2558
83 Ga0114129_10318911 3300009147 Bacteria 2066
84 Ga0105243_10013193 3300009148 Bacteria 6248
85 Ga0105249_10021453 3300009553 Bacteria 5782
86 Ga0105246_10045223 3300011119 Bacteria 2997
87 Ga0157373_10025437 3300013100 Bacteria 4281
88 Ga0157371_10000004 3300013102 Bacteria 512593
89 Ga0157370_10000165 3300013104 Bacteria 81259
90 Ga0157375_10413381 3300013308 Bacteria 1515
91 Ga0163163_10154224 3300014325 Bacteria 2340
92 Ga0213872_10086818 3300021361 Bacteria 1402
93 Ga0209025_1000060 3300025294 Bacteria 305017
94 Ga0207653_10011703 3300025885 Bacteria 2736
95 Ga0207660_10004477 3300025917 Bacteria 9112
96 Ga0207652_10050995 3300025921 Bacteria 3547
97 Ga0207646_10139929 3300025922 Bacteria 2179
98 Ga0207659_10100545 3300025926 Bacteria 2179
99 Ga0207706_10350629 3300025933 Bacteria 1283
100 Ga0207709_10076851 3300025935 Bacteria 2138
101 Ga0207679_10362290 3300025945 Bacteria 1266
102 Ga0207712_10019439 3300025961 Bacteria 4436
103 Ga0207668_10470615 3300025972 Bacteria 1076
104 Ga0207678_10025960 3300026067 Bacteria 5112
105 Ga0207708_10061612 3300026075 Bacteria 2865
106 Ga0207708_10074217 3300026075 Bacteria 2607
107 Ga0207676_10020605 3300026095 Bacteria 4827
108 Ga0207674_10008158 3300026116 Bacteria 12144
109 Ga0207675_100127779 3300026118 Bacteria 2409
110 Ga0207675_100168999 3300026118 Bacteria 2089
111 Ga0209282_1013347 3300027666 Bacteria 5232
112 Ga0209282_1049369 3300027666 Bacteria 2428
113 Ga0209813_10000431 3300027866 Bacteria 10251
114 Ga0209813_10002206 3300027866 Unclassified 4448
115 Ga0207428_10007607 3300027907 Bacteria 9870
116 Ga0207428_10207413 3300027907 Bacteria 1473
117 Ga0268266_10020177 3300028379 Bacteria 5680
118 Ga0268266_10262486 3300028379 Bacteria 1601
119 Ga0268265_10033627 3300028380 Bacteria 3729
120 Ga0268265_10099391 3300028380 Bacteria 2346
121 Ga0268264_10153673 3300028381 Bacteria 2066
122 Ga0268264_10310129 3300028381 Bacteria 1488
123 Ga0316181_1072623 3300030744 Bacteria 3503
124 Ga0307410_10257266 3300031852 Bacteria 1360
125 Ga0373930_0007730 3300034816 Bacteria 1859
126 Ga0373928_0028124 3300035084 Bacteria 1228
127 Ga0373940_0002958 3300035088 Bacteria 3395
128 Ga0373932_0010121 3300035112 Bacteria 2277
129 Ga0373941_0008173 3300035115 Bacteria 2591
130 Ga0373960_0005807 3300035121 Bacteria 2871
131 Ga0373960_0010094 3300035121 Bacteria 2301
132 Ga0373942_0026853 3300035207 Bacteria 1493
133 Ga0373962_0019569 3300035242 Bacteria 1772
134 Ga0373931_0003045 3300035691 Bacteria 7490
135 Ga0373927_0141256 3300035695 Bacteria 1575
136 Ga0316584_0003981 3300036712 Bacteria 9719
137 Ga0373925_0274134 3300037068 Bacteria 1358
138 Ga0436361_0538088 3300039447 Bacteria 13380
139 Ga0466960_0030402 3300044901 Bacteria 2485
140 Ga0495638_0218441 3300046460 Bacteria 1067
141 Ga0495584_0036245 3300046491 Bacteria 2492
142 Ga0495606_0000995 3300046507 Bacteria 41346
143 Ga0495633_0011487 3300046558 Bacteria 4770
144 Ga0495633_0011566 3300046558 Bacteria 4750
145 Ga0495667_0049936 3300046559 Bacteria 2762
146 Ga0495625_0123325 3300046660 Bacteria 1761
147 Ga0495588_0009254 3300046674 Bacteria 4550
148 Ga0495671_0054419 3300046692 Bacteria 1984
149 Ga0495604_0085548 3300047317 Bacteria 2353
150 Ga0495674_0371192 3300047319 Bacteria 1159
151 Ga0495681_0003404 3300047470 Bacteria 11070
152 Ga0495686_0000654 3300047472 Bacteria 47357
153 Ga0496100_0118832 3300048903 Bacteria 1847
154 Ga0496101_0052600 3300048904 Bacteria 2937
155 Ga0496101_0211346 3300048904 Bacteria 1503
156 Ga0496104_0000360 3300048907 Bacteria 40585
157 Ga0496104_0019092 3300048907 Bacteria 6266
158 Ga0496104_0137618 3300048907 Bacteria 2346
159 Ga0496105_0047878 3300048908 Bacteria 3528
160 Ga0496105_0175214 3300048908 Bacteria 1757
161 Ga0496106_0000979 3300048909 Bacteria 20824
162 Ga0496106_0078340 3300048909 Bacteria 2536
163 Ga0496107_0002825 3300048910 Bacteria 11457
164 Ga0496108_0017709 3300048911 Bacteria 5827
165 Ga0496108_0029237 3300048911 Bacteria 4562
166 Ga0496109_0059696 3300048912 Bacteria 3485
167 Ga0496109_0335607 3300048912 Bacteria 1427
168 Ga0496110_0003669 3300048913 Bacteria 11815
169 Ga0496110_0044293 3300048913 Bacteria 3886
170 Ga0496111_0000814 3300048914 Bacteria 16735
171 Ga0496112_0003551 3300048915 Bacteria 12952
172 Ga0496113_0011714 3300048916 Bacteria 5867
173 Ga0496113_0171144 3300048916 Bacteria 1720
174 Ga0496115_0051950 3300048918 Bacteria 3287
175 Ga0496115_0097866 3300048918 Bacteria 2403
176 Ga0496116_0035463 3300048919 Bacteria 3503
177 Ga0496117_0000002 3300048920 Bacteria 2483758
178 Ga0496117_0133574 3300048920 Bacteria 1499
179 Ga0496118_0001610 3300048921 Bacteria 33387
180 Ga0496119_0044878 3300048922 Bacteria 2777
181 Ga0496120_0000034 3300048923 Bacteria 215228
182 Ga0496120_0054077 3300048923 Bacteria 2278
183 Ga0496121_0021837 3300048924 Bacteria 6250
184 Ga0496122_0000001 3300048925 Bacteria 1827766
185 Ga0496123_0000001 3300048926 Bacteria 1831497
186 Ga0496124_0008074 3300048927 Bacteria 11065
187 Ga0496125_0008887 3300048928 Bacteria 10432
188 Ga0496126_0253763 3300048929 Bacteria 1464
189 Ga0496126_0511541 3300048929 Bacteria 958
190 Ga0501034_0002538 3300049571 Bacteria 21830
191 Ga0501034_0132846 3300049571 Bacteria 2472
192 Ga0501036_0091101 3300049572 Bacteria 2576
193 Ga0501037_0067220 3300049573 Bacteria 2610
194 Ga0501039_0039395 3300049575 Bacteria 3650
195 Ga0501039_0380830 3300049575 Bacteria 1108
196 Ga0501040_0093032 3300049576 Bacteria 2097
197 Ga0501040_0374400 3300049576 Bacteria 1021
198 Ga0501041_0113190 3300049577 Bacteria 1684
199 Ga0501042_0152798 3300049578 Bacteria 1665
200 Ga0501046_0043946 3300049580 Bacteria 3555
201 Ga0501046_0106381 3300049580 Bacteria 2147
202 Ga0501046_0112841 3300049580 Bacteria 2075
203 Ga0501048_0001214 3300049582 Bacteria 19520
204 Ga0501048_0196088 3300049582 Bacteria 1431
205 Ga0501070_0098122 3300049586 Bacteria 2423
206 Ga0501072_0065288 3300049588 Bacteria 2870
207 Ga0501072_0095875 3300049588 Bacteria 2358
208 Ga0501073_0033763 3300049589 Bacteria 3641
209 Ga0501073_0225117 3300049589 Bacteria 1296
210 Ga0501075_0033286 3300049591 Bacteria 3835
211 Ga0501075_0069817 3300049591 Bacteria 2655
212 Ga0501075_0177924 3300049591 Bacteria 1623
213 Ga0501075_0459285 3300049591 Bacteria 971
214 Ga0501077_0018462 3300049593 Bacteria 4413
215 Ga0501077_0096143 3300049593 Bacteria 1877
216 Ga0501079_0024117 3300049741 Bacteria 4668
217 Ga0501079_0035599 3300049741 Bacteria 3833
218 Ga0501079_0241905 3300049741 Bacteria 1410
219 Ga0501081_0021497 3300049743 Bacteria 4307
220 Ga0501081_0265067 3300049743 Bacteria 1256
221 nmdc:mga03n38_16586_c1 3300050490 Bacteria 2868
222 nmdc:mga03n38_57858_c1 3300050490 Bacteria 1754
223 nmdc:mga03n38_76304_c1 3300050490 Bacteria 1563
224 nmdc:mga00v17_2831_c1 3300050491 Bacteria 8910
225 nmdc:mga00v17_437_c1 3300050491 Bacteria 23413
226 nmdc:mga00v17_46492_c1 3300050491 Bacteria 2626
227 nmdc:mga00v17_47949_c1 3300050491 Bacteria 2588
228 nmdc:mga0yw44_1139_c1 3300050492 Bacteria 10277
229 nmdc:mga0k408_28704_c1 3300050493 Bacteria 3164
230 nmdc:mga06z11_17820_c1 3300050494 Bacteria 3233
231 nmdc:mga06z11_27352_c1 3300050494 Bacteria 2726
232 nmdc:mga06z11_49056_c1 3300050494 Bacteria 2152
233 nmdc:mga04h51_842_c1 3300050495 Bacteria 7090
234 nmdc:mga05p37_319514_c1 3300050507 Bacteria 1838
235 nmdc:mga05p37_389253_c1 3300050507 Bacteria 1631
236 nmdc:mga09592_339171_c1 3300050508 Bacteria 1301
237 nmdc:mga09592_92582_c1 3300050508 Bacteria 2584
238 nmdc:mga0qj67_16781_c1 3300050509 Bacteria 5561
239 nmdc:mga0qj67_40208_c1 3300050509 Bacteria 3675
240 nmdc:mga0qj67_65644_c1 3300050509 Bacteria 2889
241 nmdc:mga06r32_10008_c1 3300050510 Bacteria 8555
242 nmdc:mga06r32_149296_c1 3300050510 Bacteria 2315
243 nmdc:mga06r32_20799_c1 3300050510 Bacteria 6046
244 nmdc:mga06r32_5022_c1 3300050510 Bacteria 11908
245 nmdc:mga08y16_144826_c1 3300050511 Bacteria 2470
246 nmdc:mga08y16_244644_c1 3300050511 Bacteria 1854
247 nmdc:mga08y16_373251_c1 3300050511 Bacteria 1463
248 nmdc:mga08y16_55269_c1 3300050511 Bacteria 4149
249 nmdc:mga0n895_2473_c1 3300050512 Bacteria 5322
250 nmdc:mga0n895_406126_c1 3300050512 Bacteria 1377
251 nmdc:mga0n895_48461_c1 3300050512 Bacteria 4159
252 nmdc:mga0rr50_246620_c1 3300050513 Bacteria 1482
253 nmdc:mga0rr50_33137_c1 3300050513 Bacteria 3688
254 nmdc:mga0a205_211286_c1 3300050515 Bacteria 1828
255 nmdc:mga0a205_2268_c1 3300050515 Bacteria 16968
256 nmdc:mga0a205_333463_c1 3300050515 Bacteria 1386
257 nmdc:mga0sz30_392_c1 3300050516 Bacteria 16628
258 Ga0495601_0025436 3300053077 Bacteria 3650
259 Ga0495612_0009508 3300053078 Bacteria 3940
260 Ga0495619_0166501 3300053085 Bacteria 1523
261 Ga0500560_039214 3300053107 Bacteria 1477
262 Ga0500618_000415 3300053125 Bacteria 28810
263 Ga0500618_004578 3300053125 Bacteria 4368
264 Ga0500561_0000157 3300053137 Bacteria 12818
265 Ga0500573_0019202 3300053140 Bacteria 3910
266 Ga0500616_0031669 3300053153 Bacteria 2895
267 Ga0500624_001174 3300053157 Bacteria 4770
268 Ga0501084_0241765 3300054114 Bacteria 1524
269 Ga0587068_003352 3300059641 Bacteria 2038
270 Ga0501082_0052457 3300060353 Bacteria 3516
271 Ga0501082_0241641 3300060353 Bacteria 1571
272 Ga0501082_0387935 3300060353 Bacteria 1219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_319514_c1 nmdc:mga05p37_319514_c1_33_893 263
2 3300049591 Ga0501075_0069817 Ga0501075_0069817_1783_2643 265
3 3300053085 Ga0495619_0166501 Ga0495619_0166501_703_1509 266
4 3300035084 Ga0373928_0028124 Ga0373928_0028124_34_867 275
5 3300048916 Ga0496113_0171144 Ga0496113_0171144_13_846 275
6 3300050515 nmdc:mga0a205_211286_c1 nmdc:mga0a205_211286_c1_45_878 275
7 3300049576 Ga0501040_0374400 Ga0501040_0374400_98_943 277
8 3300049591 Ga0501075_0459285 Ga0501075_0459285_21_866 277
9 3300060353 Ga0501082_0387935 Ga0501082_0387935_44_925 282
10 3300048929 Ga0496126_0511541 Ga0496126_0511541_21_932 285
11 3300048914 Ga0496111_0000814 Ga0496111_0000814_10_891 291
12 3300050512 nmdc:mga0n895_406126_c1 nmdc:mga0n895_406126_c1_479_1360 291
13 3300009147 Ga0114129_10076075 Ga0114129_100760753 292
14 3300048928 Ga0496125_0008887 Ga0496125_0008887_53_958 301
15 3300049589 Ga0501073_0225117 Ga0501073_0225117_107_1090 303
16 3300005937 Ga0081455_10000028 Ga0081455_10000028134 304
17 3300006847 Ga0075431_100002109 Ga0075431_10000210911 306
18 3300006880 Ga0075429_100017000 Ga0075429_1000170005 306
19 3300049571 Ga0501034_0132846 Ga0501034_0132846_586_1569 306
20 3300050508 nmdc:mga09592_92582_c1 nmdc:mga09592_92582_c1_655_1659 306
21 3300050509 nmdc:mga0qj67_65644_c1 nmdc:mga0qj67_65644_c1_1595_2599 306
22 3300050510 nmdc:mga06r32_5022_c1 nmdc:mga06r32_5022_c1_9345_10349 306
23 3300009147 Ga0114129_10220667 Ga0114129_102206673 307
24 3300006846 Ga0075430_100111355 Ga0075430_1001113552 310
25 3300006844 Ga0075428_100151986 Ga0075428_1001519863 312
26 3300006846 Ga0075430_100034733 Ga0075430_1000347334 312
27 3300006847 Ga0075431_100013057 Ga0075431_1000130573 312
28 3300009147 Ga0114129_10318911 Ga0114129_103189111 312
29 3300050509 nmdc:mga0qj67_16781_c1 nmdc:mga0qj67_16781_c1_780_1790 312
30 3300050510 nmdc:mga06r32_10008_c1 nmdc:mga06r32_10008_c1_627_1637 312
31 3300005330 Ga0070690_100095061 Ga0070690_1000950613 313
32 3300005334 Ga0068869_100248417 Ga0068869_1002484172 313
33 3300005336 Ga0070680_100044211 Ga0070680_1000442114 313
34 3300005343 Ga0070687_100051566 Ga0070687_1000515662 313
35 3300005406 Ga0070703_10009986 Ga0070703_100099863 313
36 3300005438 Ga0070701_10117079 Ga0070701_101170791 313
37 3300005440 Ga0070705_100000314 Ga0070705_10000031415 313
38 3300005441 Ga0070700_100001078 Ga0070700_10000107814 313
39 3300005444 Ga0070694_100000340 Ga0070694_1000003409 313
40 3300005445 Ga0070708_100484322 Ga0070708_1004843221 313
41 3300005455 Ga0070663_100164424 Ga0070663_1001644243 313
42 3300005468 Ga0070707_100184351 Ga0070707_1001843512 313
43 3300005471 Ga0070698_100131235 Ga0070698_1001312353 313
44 3300005518 Ga0070699_100000401 Ga0070699_10000040130 313
45 3300005530 Ga0070679_100345882 Ga0070679_1003458821 313
46 3300005545 Ga0070695_100041803 Ga0070695_1000418032 313
47 3300005546 Ga0070696_100005933 Ga0070696_1000059332 313
48 3300005549 Ga0070704_100256891 Ga0070704_1002568912 313
49 3300005577 Ga0068857_100025533 Ga0068857_1000255336 313
50 3300005618 Ga0068864_100025396 Ga0068864_1000253963 313
51 3300005719 Ga0068861_100017187 Ga0068861_1000171877 313
52 3300005843 Ga0068860_100044710 Ga0068860_1000447103 313
53 3300005844 Ga0068862_100001810 Ga0068862_10000181014 313
54 3300009553 Ga0105249_10021453 Ga0105249_100214534 313
55 3300011119 Ga0105246_10045223 Ga0105246_100452233 313
56 3300025885 Ga0207653_10011703 Ga0207653_100117032 313
57 3300025917 Ga0207660_10004477 Ga0207660_100044779 313
58 3300025922 Ga0207646_10139929 Ga0207646_101399292 313
59 3300025926 Ga0207659_10100545 Ga0207659_101005452 313
60 3300025933 Ga0207706_10350629 Ga0207706_103506291 313
61 3300025961 Ga0207712_10019439 Ga0207712_100194393 313
62 3300025972 Ga0207668_10470615 Ga0207668_104706151 313
63 3300026067 Ga0207678_10025960 Ga0207678_100259607 313
64 3300026075 Ga0207708_10061612 Ga0207708_100616123 313
65 3300026095 Ga0207676_10020605 Ga0207676_100206056 313
66 3300026116 Ga0207674_10008158 Ga0207674_100081585 313
67 3300026118 Ga0207675_100168999 Ga0207675_1001689993 313
68 3300028380 Ga0268265_10033627 Ga0268265_100336273 313
69 3300048904 Ga0496101_0052600 Ga0496101_0052600_581_1585 313
70 3300048909 Ga0496106_0000979 Ga0496106_0000979_7413_8417 313
71 3300048910 Ga0496107_0002825 Ga0496107_0002825_5365_6369 313
72 3300049741 Ga0501079_0024117 Ga0501079_0024117_2995_4005 314
73 3300053125 Ga0500618_004578 Ga0500618_004578_82_1041 314
74 3300054114 Ga0501084_0241765 Ga0501084_0241765_155_1165 314
75 3300009094 Ga0111539_10082644 Ga0111539_100826442 315
76 3300009147 Ga0114129_10064335 Ga0114129_100643352 315
77 3300013308 Ga0157375_10413381 Ga0157375_104133812 315
78 3300025945 Ga0207679_10362290 Ga0207679_103622902 315
79 3300049588 Ga0501072_0065288 Ga0501072_0065288_114_1124 315
80 3300049591 Ga0501075_0177924 Ga0501075_0177924_293_1297 315
81 3300049593 Ga0501077_0018462 Ga0501077_0018462_248_1252 315
82 3300049743 Ga0501081_0021497 Ga0501081_0021497_507_1511 315
83 3300050507 nmdc:mga05p37_389253_c1 nmdc:mga05p37_389253_c1_258_1241 315
84 3300050510 nmdc:mga06r32_149296_c1 nmdc:mga06r32_149296_c1_988_1971 315
85 3300050511 nmdc:mga08y16_55269_c1 nmdc:mga08y16_55269_c1_2977_3960 315
86 3300021361 Ga0213872_10086818 Ga0213872_100868181 316
87 3300039447 Ga0436361_0538088 Ga0436361_0538088_2436_3392 316
88 3300048903 Ga0496100_0118832 Ga0496100_0118832_23_979 316
89 3300048911 Ga0496108_0029237 Ga0496108_0029237_13_969 316
90 3300049575 Ga0501039_0039395 Ga0501039_0039395_902_1912 316
91 3300005336 Ga0070680_100395325 Ga0070680_1003953251 317
92 3300005530 Ga0070679_100072129 Ga0070679_1000721292 317
93 3300025921 Ga0207652_10050995 Ga0207652_100509952 317
94 3300046491 Ga0495584_0036245 Ga0495584_0036245_791_1795 317
95 3300049575 Ga0501039_0380830 Ga0501039_0380830_33_1037 318
96 3300049576 Ga0501040_0093032 Ga0501040_0093032_812_1816 318
97 3300049580 Ga0501046_0106381 Ga0501046_0106381_953_1957 318
98 3300049582 Ga0501048_0196088 Ga0501048_0196088_63_1073 318
99 3300049741 Ga0501079_0035599 Ga0501079_0035599_2803_3807 318
100 3300035695 Ga0373927_0141256 Ga0373927_0141256_35_1015 319
101 iso_pu_bacteria 2837678835 2837680950 319
102 iso_pu_bacteria 2891048133 2891048224 319
103 iso_pu_bacteria 2995392953 2995395583 319
104 iso_pu_bacteria 8045864390 8045868893 319
105 iso_pu_bacteria 2751185800 2753360065 320
106 iso_pu_bacteria 2758568016 2758642388 320
107 iso_pu_bacteria 2854911287 2854912740 320
108 iso_pu_bacteria 2915650412 2915653449 320
109 3300005341 Ga0070691_10005231 Ga0070691_100052314 321
110 3300005444 Ga0070694_100074698 Ga0070694_1000746983 321
111 3300005545 Ga0070695_100008911 Ga0070695_1000089113 321
112 3300005983 Ga0081540_1000655 Ga0081540_100065516 321
113 3300006852 Ga0075433_10001356 Ga0075433_1000135614 321
114 3300006871 Ga0075434_100001772 Ga0075434_10000177215 321
115 3300007076 Ga0075435_100009748 Ga0075435_1000097489 321
116 3300026075 Ga0207708_10074217 Ga0207708_100742173 321
117 3300027907 Ga0207428_10207413 Ga0207428_102074132 321
118 3300035207 Ga0373942_0026853 Ga0373942_0026853_250_1230 321
119 3300035691 Ga0373931_0003045 Ga0373931_0003045_5704_6684 321
120 3300036712 Ga0316584_0003981 Ga0316584_0003981_5530_6501 321
121 3300049589 Ga0501073_0033763 Ga0501073_0033763_196_1167 321
122 3300049582 Ga0501048_0001214 Ga0501048_0001214_10647_11621 322
123 iso_pu_bacteria 2554235003 2554246326 322
124 iso_pu_bacteria 2558860242 2559293548 322
125 iso_pu_bacteria 2582581865 2585386111 322
126 iso_pu_bacteria 2600255279 2601609430 322
127 iso_pu_bacteria 2600255308 2601746205 322
128 iso_pu_bacteria 2643221582 2643920710 322
129 iso_pu_bacteria 2643221693 2644519485 322
130 iso_pu_bacteria 2808606387 2808986681 322
131 iso_pu_bacteria 2818991272 2819244426 322
132 iso_pu_bacteria 2838675328 2838677488 322
133 iso_pu_bacteria 2838714209 2838716377 322
134 iso_pu_bacteria 2838719591 2838719823 322
135 iso_pu_bacteria 2838724970 2838727128 322
136 iso_pu_bacteria 2841846520 2841846754 322
137 iso_pu_bacteria 2842124991 2842127217 322
138 iso_pu_bacteria 2842130223 2842132381 322
139 iso_pu_bacteria 2842152218 2842152450 322
140 iso_pu_bacteria 2842170452 2842172622 322
141 iso_pu_bacteria 2842175837 2842176069 322
142 iso_pu_bacteria 2842187318 2842189484 322
143 iso_pu_bacteria 2842211629 2842213798 322
144 iso_pu_bacteria 2842224351 2842224584 322
145 iso_pu_bacteria 2899845264 2899845836 322
146 iso_pu_bacteria 2919114240 2919116594 322
147 iso_pu_bacteria 2926754445 2926754602 322
148 iso_pu_bacteria 2926760298 2926761774 322
149 iso_pu_bacteria 2933006813 2933007097 322
150 iso_pu_bacteria 2933594066 2933594299 322
151 iso_pu_bacteria 2979089926 2979092961 322
152 iso_pu_bacteria 2979095461 2979099650 322
153 iso_pu_bacteria 650716007 650738786 322
154 iso_pu_bacteria 8003570095 8003572334 322
155 3300005435 Ga0070714_100318592 Ga0070714_1003185922 323
156 3300006175 Ga0070712_100194725 Ga0070712_1001947252 323
157 3300006871 Ga0075434_100412951 Ga0075434_1004129511 323
158 3300044901 Ga0466960_0030402 Ga0466960_0030402_1208_2194 323
159 3300047319 Ga0495674_0371192 Ga0495674_0371192_14_994 323
160 3300049571 Ga0501034_0002538 Ga0501034_0002538_16057_17031 323
161 3300049572 Ga0501036_0091101 Ga0501036_0091101_782_1756 323
162 3300049573 Ga0501037_0067220 Ga0501037_0067220_1209_2183 323
163 3300049578 Ga0501042_0152798 Ga0501042_0152798_29_1036 323
164 3300049580 Ga0501046_0043946 Ga0501046_0043946_842_1816 323
165 3300049586 Ga0501070_0098122 Ga0501070_0098122_237_1211 323
166 3300049743 Ga0501081_0265067 Ga0501081_0265067_236_1243 323
167 3300005347 Ga0070668_100284632 Ga0070668_1002846321 324
168 3300005441 Ga0070700_100027002 Ga0070700_1000270024 324
169 3300005843 Ga0068860_100133682 Ga0068860_1001336822 324
170 3300005985 Ga0081539_10015092 Ga0081539_100150924 324
171 3300006042 Ga0075368_10000535 Ga0075368_100005359 324
172 3300006048 Ga0075363_100001467 Ga0075363_10000146710 324
173 3300006051 Ga0075364_10001704 Ga0075364_100017048 324
174 3300006178 Ga0075367_10067371 Ga0075367_100673712 324
175 3300006844 Ga0075428_100154796 Ga0075428_1001547963 324
176 3300006844 Ga0075428_100245158 Ga0075428_1002451583 324
177 3300006846 Ga0075430_100019378 Ga0075430_1000193787 324
178 3300006847 Ga0075431_100274980 Ga0075431_1002749802 324
179 3300006871 Ga0075434_100024429 Ga0075434_1000244294 324
180 3300006880 Ga0075429_100168462 Ga0075429_1001684622 324
181 3300007076 Ga0075435_100265715 Ga0075435_1002657152 324
182 3300009094 Ga0111539_10015148 Ga0111539_100151482 324
183 3300009094 Ga0111539_10232823 Ga0111539_102328233 324
184 3300009098 Ga0105245_10029031 Ga0105245_100290316 324
185 3300014325 Ga0163163_10154224 Ga0163163_101542242 324
186 3300026118 Ga0207675_100127779 Ga0207675_1001277793 324
187 3300027866 Ga0209813_10000431 Ga0209813_100004316 324
188 3300027907 Ga0207428_10007607 Ga0207428_100076071 324
189 3300028379 Ga0268266_10262486 Ga0268266_102624861 324
190 3300028380 Ga0268265_10099391 Ga0268265_100993913 324
191 3300028381 Ga0268264_10153673 Ga0268264_101536732 324
192 3300028381 Ga0268264_10310129 Ga0268264_103101292 324
193 3300034816 Ga0373930_0007730 Ga0373930_0007730_639_1646 324
194 3300035088 Ga0373940_0002958 Ga0373940_0002958_1943_2974 324
195 3300035112 Ga0373932_0010121 Ga0373932_0010121_602_1633 324
196 3300035115 Ga0373941_0008173 Ga0373941_0008173_1027_2034 324
197 3300035121 Ga0373960_0005807 Ga0373960_0005807_889_1896 324
198 3300035121 Ga0373960_0010094 Ga0373960_0010094_871_1902 324
199 3300035242 Ga0373962_0019569 Ga0373962_0019569_645_1652 324
200 3300037068 Ga0373925_0274134 Ga0373925_0274134_143_1126 324
201 3300046460 Ga0495638_0218441 Ga0495638_0218441_48_1031 324
202 3300046559 Ga0495667_0049936 Ga0495667_0049936_897_1880 324
203 3300046660 Ga0495625_0123325 Ga0495625_0123325_601_1584 324
204 3300047317 Ga0495604_0085548 Ga0495604_0085548_631_1614 324
205 3300048904 Ga0496101_0211346 Ga0496101_0211346_314_1336 324
206 3300048907 Ga0496104_0000360 Ga0496104_0000360_12591_13574 324
207 3300048907 Ga0496104_0019092 Ga0496104_0019092_667_1689 324
208 3300048908 Ga0496105_0047878 Ga0496105_0047878_2382_3365 324
209 3300048908 Ga0496105_0175214 Ga0496105_0175214_180_1202 324
210 3300048909 Ga0496106_0078340 Ga0496106_0078340_1254_2276 324
211 3300048911 Ga0496108_0017709 Ga0496108_0017709_4446_5429 324
212 3300048912 Ga0496109_0059696 Ga0496109_0059696_2164_3147 324
213 3300048912 Ga0496109_0335607 Ga0496109_0335607_379_1401 324
214 3300048913 Ga0496110_0003669 Ga0496110_0003669_10246_11229 324
215 3300048913 Ga0496110_0044293 Ga0496110_0044293_857_1840 324
216 3300048915 Ga0496112_0003551 Ga0496112_0003551_10251_11234 324
217 3300048916 Ga0496113_0011714 Ga0496113_0011714_1043_2026 324
218 3300048918 Ga0496115_0051950 Ga0496115_0051950_2030_3052 324
219 3300048918 Ga0496115_0097866 Ga0496115_0097866_1102_2085 324
220 3300049577 Ga0501041_0113190 Ga0501041_0113190_640_1650 324
221 3300049580 Ga0501046_0112841 Ga0501046_0112841_880_1890 324
222 3300049591 Ga0501075_0033286 Ga0501075_0033286_1909_2919 324
223 3300049593 Ga0501077_0096143 Ga0501077_0096143_345_1355 324
224 3300049741 Ga0501079_0241905 Ga0501079_0241905_138_1148 324
225 3300050490 nmdc:mga03n38_16586_c1 nmdc:mga03n38_16586_c1_1221_2204 324
226 3300050490 nmdc:mga03n38_57858_c1 nmdc:mga03n38_57858_c1_432_1415 324
227 3300050490 nmdc:mga03n38_76304_c1 nmdc:mga03n38_76304_c1_197_1180 324
228 3300050491 nmdc:mga00v17_2831_c1 nmdc:mga00v17_2831_c1_3445_4428 324
229 3300050491 nmdc:mga00v17_46492_c1 nmdc:mga00v17_46492_c1_708_1769 324
230 3300050494 nmdc:mga06z11_27352_c1 nmdc:mga06z11_27352_c1_144_1127 324
231 3300050494 nmdc:mga06z11_49056_c1 nmdc:mga06z11_49056_c1_394_1377 324
232 3300050495 nmdc:mga04h51_842_c1 nmdc:mga04h51_842_c1_4832_5815 324
233 3300050508 nmdc:mga09592_339171_c1 nmdc:mga09592_339171_c1_84_1106 324
234 3300050509 nmdc:mga0qj67_40208_c1 nmdc:mga0qj67_40208_c1_2457_3479 324
235 3300050510 nmdc:mga06r32_20799_c1 nmdc:mga06r32_20799_c1_223_1245 324
236 3300050511 nmdc:mga08y16_144826_c1 nmdc:mga08y16_144826_c1_1153_2184 324
237 3300050511 nmdc:mga08y16_244644_c1 nmdc:mga08y16_244644_c1_35_1018 324
238 3300050511 nmdc:mga08y16_373251_c1 nmdc:mga08y16_373251_c1_370_1377 324
239 3300050512 nmdc:mga0n895_2473_c1 nmdc:mga0n895_2473_c1_2346_3329 324
240 3300050512 nmdc:mga0n895_48461_c1 nmdc:mga0n895_48461_c1_2725_3756 324
241 3300050513 nmdc:mga0rr50_246620_c1 nmdc:mga0rr50_246620_c1_193_1224 324
242 3300050513 nmdc:mga0rr50_33137_c1 nmdc:mga0rr50_33137_c1_2456_3439 324
243 3300050515 nmdc:mga0a205_2268_c1 nmdc:mga0a205_2268_c1_15107_16138 324
244 3300050515 nmdc:mga0a205_333463_c1 nmdc:mga0a205_333463_c1_245_1228 324
245 3300053077 Ga0495601_0025436 Ga0495601_0025436_1352_2335 324
246 3300053078 Ga0495612_0009508 Ga0495612_0009508_1527_2510 324
247 3300053153 Ga0500616_0031669 Ga0500616_0031669_1421_2404 324
248 3300060353 Ga0501082_0052457 Ga0501082_0052457_1842_2834 324
249 3300060353 Ga0501082_0241641 Ga0501082_0241641_83_1099 324
250 3300006042 Ga0075368_10004966 Ga0075368_100049664 325
251 3300006048 Ga0075363_100016143 Ga0075363_1000161434 325
252 3300006178 Ga0075367_10001348 Ga0075367_1000134810 325
253 3300027866 Ga0209813_10002206 Ga0209813_100022063 325
254 3300003578 Ga0006562J51391_1028881 Ga0006562J51391_10288811 326
255 3300003775 Ga0055524_1002179 Ga0055524_10021799 326
256 3300003856 Ga0058692_1003204 Ga0058692_10032044 326
257 3300005548 Ga0070665_100005496 Ga0070665_1000054966 326
258 3300006042 Ga0075368_10006453 Ga0075368_100064535 326
259 3300006048 Ga0075363_100056849 Ga0075363_1000568492 326
260 3300006051 Ga0075364_10132795 Ga0075364_101327953 326
261 3300006177 Ga0075362_10016064 Ga0075362_100160644 326
262 3300006178 Ga0075367_10010645 Ga0075367_100106456 326
263 3300006178 Ga0075367_10030355 Ga0075367_100303554 326
264 3300006186 Ga0075369_10032209 Ga0075369_100322093 326
265 3300006353 Ga0075370_10116378 Ga0075370_101163781 326
266 3300006948 Ga0099826_10012836 Ga0099826_100128363 326
267 3300006948 Ga0099826_10045284 Ga0099826_100452843 326
268 3300009036 Ga0105244_10076854 Ga0105244_100768541 326
269 3300009148 Ga0105243_10013193 Ga0105243_100131937 326
270 3300013100 Ga0157373_10025437 Ga0157373_100254376 326
271 3300013102 Ga0157371_10000004 Ga0157371_10000004227 326
272 3300013104 Ga0157370_10000165 Ga0157370_1000016558 326
273 3300025294 Ga0209025_1000060 Ga0209025_100006089 326
274 3300025935 Ga0207709_10076851 Ga0207709_100768512 326
275 3300027666 Ga0209282_1013347 Ga0209282_10133477 326
276 3300027666 Ga0209282_1049369 Ga0209282_10493693 326
277 3300028379 Ga0268266_10020177 Ga0268266_100201774 326
278 3300030744 Ga0316181_1072623 Ga0316181_10726234 326
279 3300031852 Ga0307410_10257266 Ga0307410_102572662 326
280 3300046507 Ga0495606_0000995 Ga0495606_0000995_3507_4487 326
281 3300046558 Ga0495633_0011487 Ga0495633_0011487_126_1106 326
282 3300046558 Ga0495633_0011566 Ga0495633_0011566_2252_3232 326
283 3300046674 Ga0495588_0009254 Ga0495588_0009254_1378_2358 326
284 3300046692 Ga0495671_0054419 Ga0495671_0054419_472_1452 326
285 3300047470 Ga0495681_0003404 Ga0495681_0003404_7530_8510 326
286 3300047472 Ga0495686_0000654 Ga0495686_0000654_25736_26716 326
287 3300048907 Ga0496104_0137618 Ga0496104_0137618_114_1094 326
288 3300048919 Ga0496116_0035463 Ga0496116_0035463_2484_3464 326
289 3300048920 Ga0496117_0000002 Ga0496117_0000002_2260015_2260995 326
290 3300048920 Ga0496117_0133574 Ga0496117_0133574_225_1205 326
291 3300048921 Ga0496118_0001610 Ga0496118_0001610_14641_15621 326
292 3300048922 Ga0496119_0044878 Ga0496119_0044878_404_1384 326
293 3300048923 Ga0496120_0000034 Ga0496120_0000034_166533_167513 326
294 3300048923 Ga0496120_0054077 Ga0496120_0054077_1257_2237 326
295 3300048924 Ga0496121_0021837 Ga0496121_0021837_2949_3929 326
296 3300048925 Ga0496122_0000001 Ga0496122_0000001_1604022_1605002 326
297 3300048926 Ga0496123_0000001 Ga0496123_0000001_1607753_1608733 326
298 3300048927 Ga0496124_0008074 Ga0496124_0008074_4508_5488 326
299 3300048929 Ga0496126_0253763 Ga0496126_0253763_468_1448 326
300 3300049588 Ga0501072_0095875 Ga0501072_0095875_410_1408 326
301 3300050491 nmdc:mga00v17_437_c1 nmdc:mga00v17_437_c1_12406_13386 326
302 3300050491 nmdc:mga00v17_47949_c1 nmdc:mga00v17_47949_c1_1457_2437 326
303 3300050492 nmdc:mga0yw44_1139_c1 nmdc:mga0yw44_1139_c1_2336_3316 326
304 3300050493 nmdc:mga0k408_28704_c1 nmdc:mga0k408_28704_c1_1197_2177 326
305 3300050494 nmdc:mga06z11_17820_c1 nmdc:mga06z11_17820_c1_995_1975 326
306 3300050516 nmdc:mga0sz30_392_c1 nmdc:mga0sz30_392_c1_12698_13678 326
307 3300053107 Ga0500560_039214 Ga0500560_039214_443_1423 326
308 3300053125 Ga0500618_000415 Ga0500618_000415_9800_10780 326
309 3300053137 Ga0500561_0000157 Ga0500561_0000157_3184_4164 326
310 3300053140 Ga0500573_0019202 Ga0500573_0019202_1138_2118 326
311 3300053157 Ga0500624_001174 Ga0500624_001174_2522_3502 326
312 3300059641 Ga0587068_003352 Ga0587068_003352_588_1568 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

41

248

0.87

PF05368

NmrA

NmrA-like family

41

167

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

45

195

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r4f-assembly1.cif.gz_P bovine complex i in the presence of im1761092, slack class i (composite map) 0.9459 8 315
7r47-assembly1.cif.gz_P bovine complex i in the presence of im1761092, deactive class iii (composite map) 0.9423 8 314
7r48-assembly1.cif.gz_P bovine complex i in the presence of im1761092, deactive class iv (composite map) 0.9415 8 315
7ak5-assembly1.cif.gz_P cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a 0.9415 8 317
7v2f-assembly1.cif.gz_J deactive state complex i from q10-nadh dataset 0.9391 8 317
ID Description Score Start End Superfamily
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 8 172 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 12 302 3.40.50.720
af_Q9DC69_47_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 8 214 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 12 302 3.40.50.720
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 11 264 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V3KSF4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9962 59 155 GO:0044877
GO:1901006
AF-A0A2N3CM24-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9917 7 150 GO:0044877
GO:1901006
AF-A0A258IZD6-F1-model_v4 deleted 0.98 6 256
AF-A0A4Q3YF92-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9796 7 240 GO:0044877
GO:1901006
AF-A0A4V3KSF4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9761 59 155 GO:0044877
GO:1901006

Feature Viewer

pLDDT pTM Quality
91.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map