F401642

General Info

Members Datasets Scaffolds Average Seq Length
312 181 624 309

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100013263|Ga0075363_1000132633
Length 327
Sequence MLASWYDDQGPAADVLRVGELPDPVAGPGEVRVRVTVSGVNPGDTKKRRGWLGSSMPYPRVIPHSDAAGVIDAAGEGVDARRVGQRVWVYGAQSYRPFGTAAQYTVVPDHQAAPLPDHLSDELGASLGIPGITAHRTVFADGPVEGQLVLVHGALGGVGSLAAQLAHWAGATVIATVRRTTDLDRVDPAVVSHAVALDTGDPAAAIRSYAPRGVDRIIEVALSANADLDNAVAAQGTVIAAYATSTDRTEIPFWPLLFNNVTLRLLGSDDFPAEAKRQAARDLTSAAAVGALTVAVGDRYPLDDIAKAHDDVDTGGGHGRIVVTIPQ

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
60 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
61 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
62 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
148 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
151 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
154 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
155 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
156 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
157 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
160 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
163 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
164 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
165 2558860280 Kutzneria sp. 744 Isolate Unclassified
166 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
167 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
168 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
169 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
170 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
173 2643221714 Streptomyces sp. Root264 Isolate Unclassified
174 2862574272 Streptomyces sp. AcE210 Isolate Nodule
175 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
176 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
177 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
178 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
179 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
180 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
181 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0.32
Rhizoplane 0.96
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100013263 3300006048 Bacteria 3989
2 Ga0070668_100008370 3300005347 Bacteria 7682
3 Ga0070709_10134289 3300005434 Bacteria 1693
4 Ga0070714_100365871 3300005435 Bacteria 1357
5 Ga0070714_100420010 3300005435 Bacteria 1267
6 Ga0070713_100110157 3300005436 Bacteria 2400
7 Ga0070705_100122905 3300005440 Bacteria 1679
8 Ga0070662_100154705 3300005457 Bacteria 1789
9 Ga0068853_100011451 3300005539 Bacteria 7208
10 Ga0081455_10001018 3300005937 Bacteria 35331
11 Ga0081455_10006133 3300005937 Bacteria 12987
12 Ga0081455_10011311 3300005937 Bacteria 8977
13 Ga0081455_10059169 3300005937 Bacteria 3237
14 Ga0081540_1003157 3300005983 Bacteria 13156
15 Ga0081539_10002671 3300005985 Bacteria 24259
16 Ga0075369_10001139 3300006186 Bacteria 8962
17 Ga0075370_10102067 3300006353 Unclassified 1661
18 Ga0075428_100008840 3300006844 Bacteria 11176
19 Ga0075428_100222978 3300006844 Bacteria 2035
20 Ga0075431_100009784 3300006847 Bacteria 9629
21 Ga0075433_10167981 3300006852 Bacteria 1952
22 Ga0075434_100023309 3300006871 Bacteria 6030
23 Ga0068865_100089764 3300006881 Bacteria 2227
24 Ga0075435_100066074 3300007076 Bacteria 2941
25 Ga0111539_10225489 3300009094 Bacteria 2183
26 Ga0114129_10003738 3300009147 Bacteria 21458
27 Ga0105243_10042332 3300009148 Bacteria 3566
28 Ga0105243_10644553 3300009148 Bacteria 1026
29 Ga0105239_10109684 3300010375 Bacteria 3059
30 Ga0105239_10508711 3300010375 Bacteria 1370
31 Ga0163162_10192676 3300013306 Bacteria 2166
32 Ga0207700_10106960 3300025928 Bacteria 2244
33 Ga0207664_10270807 3300025929 Bacteria 1488
34 Ga0207668_10003611 3300025972 Bacteria 9091
35 Ga0207639_10052401 3300026041 Bacteria 3109
36 Ga0207639_10354623 3300026041 Bacteria 1311
37 Ga0207641_10520792 3300026088 Unclassified 1157
38 Ga0207675_100025862 3300026118 Bacteria 5460
39 Ga0307517_10011484 3300028786 Bacteria 12270
40 Ga0307517_10072535 3300028786 Bacteria 3067
41 Ga0307515_10002359 3300028794 Bacteria 41195
42 Ga0307515_10113966 3300028794 Bacteria 3129
43 Ga0307511_10000883 3300030521 Bacteria 31708
44 Ga0307511_10007647 3300030521 Bacteria 10860
45 Ga0307512_10013706 3300030522 Bacteria 7584
46 Ga0307513_10122186 3300031456 Bacteria 2568
47 Ga0307513_10153115 3300031456 Bacteria 2211
48 Ga0307513_10161868 3300031456 Bacteria 2129
49 Ga0307509_10005017 3300031507 Bacteria 18663
50 Ga0307509_10013050 3300031507 Bacteria 9864
51 Ga0307509_10034415 3300031507 Bacteria 5566
52 Ga0307509_10084308 3300031507 Bacteria 3274
53 Ga0307509_10123306 3300031507 Bacteria 2564
54 Ga0307509_10219254 3300031507 Bacteria 1718
55 Ga0307408_100188173 3300031548 Bacteria 1661
56 Ga0307508_10031476 3300031616 Bacteria 4795
57 Ga0307508_10057341 3300031616 Bacteria 3446
58 Ga0307508_10057916 3300031616 Bacteria 3428
59 Ga0307508_10137485 3300031616 Bacteria 2046
60 Ga0307514_10001238 3300031649 Bacteria 33583
61 Ga0307514_10019005 3300031649 Bacteria 5626
62 Ga0307514_10059758 3300031649 Bacteria 2911
63 Ga0307514_10063266 3300031649 Bacteria 2810
64 Ga0307514_10112541 3300031649 Bacteria 1923
65 Ga0307516_10006123 3300031730 Bacteria 14180
66 Ga0307516_10015598 3300031730 Bacteria 7988
67 Ga0307518_10000560 3300031838 Bacteria 28288
68 Ga0307518_10019773 3300031838 Bacteria 4836
69 Ga0307410_10152690 3300031852 Bacteria 1721
70 Ga0307406_10019955 3300031901 Bacteria 3939
71 Ga0307406_10034035 3300031901 Unclassified 3123
72 Ga0307406_10135408 3300031901 Bacteria 1735
73 Ga0307407_10045758 3300031903 Bacteria 2475
74 Ga0307409_100330756 3300031995 Bacteria 1430
75 Ga0307409_100652320 3300031995 Bacteria 1046
76 Ga0307416_100038868 3300032002 Bacteria 3676
77 Ga0307414_10239823 3300032004 Bacteria 1500
78 Ga0307411_10127817 3300032005 Bacteria 1852
79 Ga0307415_100072033 3300032126 Bacteria 2432
80 Ga0307507_10006074 3300033179 Bacteria 18959
81 Ga0307507_10006862 3300033179 Bacteria 17004
82 Ga0307510_10005157 3300033180 Bacteria 15526
83 Ga0307510_10066639 3300033180 Bacteria 3633
84 Ga0307510_10085009 3300033180 Bacteria 3043
85 Ga0373951_0000084 3300035091 Bacteria 37175
86 Ga0373925_0000624 3300037068 Bacteria 33725
87 Ga0373925_0037406 3300037068 Bacteria 3584
88 Ga0373925_0293097 3300037068 Bacteria 1312
89 Ga0373925_0451406 3300037068 Bacteria 1053
90 Ga0395898_0050679 3300037466 Bacteria 4062
91 Ga0395905_0306690 3300037471 Unclassified 1476
92 Ga0395901_0475339 3300038443 Unclassified 1275
93 Ga0436363_1197067 3300039450 Bacteria 1332
94 Ga0451793_0825601 3300041452 Bacteria 1173
95 Ga0451800_0821205 3300041459 Bacteria 1495
96 Ga0451833_0920281 3300041491 Bacteria 1549
97 Ga0451841_1119912 3300041498 Bacteria 1174
98 Ga0439463_003214 3300042016 Bacteria 4148
99 Ga0466963_0020532 3300044694 Bacteria 4154
100 Ga0495617_039557 3300046452 Bacteria 1577
101 Ga0495627_063478 3300046453 Bacteria 1089
102 Ga0495592_0025962 3300046454 Bacteria 4444
103 Ga0495592_0032132 3300046454 Bacteria 3964
104 Ga0495592_0076992 3300046454 Bacteria 2419
105 Ga0495603_0002765 3300046455 Bacteria 10339
106 Ga0495603_0006684 3300046455 Bacteria 6919
107 Ga0495603_0021299 3300046455 Bacteria 3925
108 Ga0495603_0059754 3300046455 Bacteria 2253
109 Ga0495629_0012139 3300046459 Bacteria 6243
110 Ga0495629_0015805 3300046459 Bacteria 5420
111 Ga0495629_0032429 3300046459 Bacteria 3699
112 Ga0495629_0038154 3300046459 Bacteria 3385
113 Ga0495629_0194097 3300046459 Bacteria 1405
114 Ga0495638_0002466 3300046460 Bacteria 15063
115 Ga0495638_0075366 3300046460 Bacteria 2056
116 Ga0495641_0019920 3300046461 Bacteria 3418
117 Ga0495651_0002222 3300046462 Bacteria 14991
118 Ga0495651_0004974 3300046462 Bacteria 10154
119 Ga0495651_0007427 3300046462 Bacteria 8380
120 Ga0495651_0028217 3300046462 Bacteria 4374
121 Ga0495653_0004323 3300046463 Bacteria 11489
122 Ga0495653_0017053 3300046463 Bacteria 5908
123 Ga0495653_0104463 3300046463 Bacteria 2047
124 Ga0495580_0063906 3300046472 Bacteria 2580
125 Ga0495582_0022602 3300046473 Bacteria 3442
126 Ga0495582_0153145 3300046473 Bacteria 1309
127 Ga0495605_0008189 3300046474 Bacteria 5910
128 Ga0495605_0009487 3300046474 Bacteria 5465
129 Ga0495662_0000364 3300046476 Bacteria 19902
130 Ga0495662_0001795 3300046476 Bacteria 10744
131 Ga0495662_0050039 3300046476 Bacteria 2017
132 Ga0495664_0002613 3300046477 Bacteria 9690
133 Ga0495664_0003634 3300046477 Bacteria 8412
134 Ga0495664_0008351 3300046477 Bacteria 5774
135 Ga0495664_0088402 3300046477 Bacteria 1862
136 Ga0495594_0019802 3300046499 Bacteria 3578
137 Ga0495594_0030345 3300046499 Bacteria 2924
138 Ga0495594_0150598 3300046499 Bacteria 1321
139 Ga0495583_0007351 3300046506 Bacteria 6940
140 Ga0495606_0006356 3300046507 Bacteria 10922
141 Ga0495608_0006682 3300046511 Bacteria 8180
142 Ga0495610_0086039 3300046512 Bacteria 1433
143 Ga0495616_0024026 3300046513 Bacteria 3274
144 Ga0495618_0006682 3300046514 Bacteria 6990
145 Ga0495620_0003843 3300046515 Bacteria 8560
146 Ga0495620_0014033 3300046515 Bacteria 4085
147 Ga0495628_0017547 3300046516 Bacteria 5954
148 Ga0495628_0020378 3300046516 Bacteria 5470
149 Ga0495628_0078412 3300046516 Bacteria 2569
150 Ga0495628_0122119 3300046516 Bacteria 1997
151 Ga0495630_0029152 3300046517 Bacteria 4101
152 Ga0495632_0023884 3300046519 Bacteria 3258
153 Ga0495643_0012629 3300046522 Bacteria 5087
154 Ga0495643_0017335 3300046522 Bacteria 4211
155 Ga0495643_0055620 3300046522 Bacteria 2115
156 Ga0495648_0008601 3300046524 Bacteria 8010
157 Ga0495648_0086482 3300046524 Bacteria 1768
158 Ga0495666_0001499 3300046526 Bacteria 11413
159 Ga0495666_0024699 3300046526 Bacteria 2968
160 Ga0495666_0051158 3300046526 Bacteria 1985
161 Ga0495652_0006075 3300046529 Bacteria 11290
162 Ga0495652_0011055 3300046529 Bacteria 8181
163 Ga0495652_0076376 3300046529 Bacteria 2779
164 Ga0495665_0002262 3300046531 Bacteria 10432
165 Ga0495665_0012858 3300046531 Bacteria 4530
166 Ga0495640_0023835 3300046533 Bacteria 4453
167 Ga0495640_0134591 3300046533 Bacteria 1597
168 Ga0495586_0028062 3300046535 Bacteria 3011
169 Ga0495586_0080800 3300046535 Bacteria 1786
170 Ga0495587_0012492 3300046536 Bacteria 5341
171 Ga0495587_0017037 3300046536 Bacteria 4518
172 Ga0495597_0010038 3300046542 Bacteria 4646
173 Ga0495622_0003726 3300046557 Bacteria 7131
174 Ga0495633_0051035 3300046558 Bacteria 1949
175 Ga0495656_0174361 3300046615 Bacteria 1053
176 Ga0495668_0022894 3300046616 Bacteria 3568
177 Ga0495668_0065830 3300046616 Bacteria 1994
178 Ga0495634_0051850 3300046642 Bacteria 2752
179 Ga0495634_0055613 3300046642 Bacteria 2646
180 Ga0495611_0084061 3300046648 Bacteria 1467
181 Ga0495625_0006706 3300046660 Bacteria 10209
182 Ga0495625_0012160 3300046660 Bacteria 6984
183 Ga0495635_0002757 3300046663 Bacteria 12045
184 Ga0495635_0014963 3300046663 Bacteria 5427
185 Ga0495635_0027871 3300046663 Bacteria 3928
186 Ga0495588_0011925 3300046674 Bacteria 4093
187 Ga0495657_0005911 3300046675 Bacteria 9615
188 Ga0495657_0016422 3300046675 Bacteria 5395
189 Ga0495599_0092853 3300046678 Bacteria 1883
190 Ga0495623_0055010 3300046679 Bacteria 2510
191 Ga0495646_0007480 3300046680 Bacteria 6942
192 Ga0495646_0008191 3300046680 Bacteria 6642
193 Ga0495646_0021295 3300046680 Bacteria 4098
194 Ga0495658_0129512 3300046683 Bacteria 1534
195 Ga0495613_0003092 3300046689 Bacteria 12441
196 Ga0495613_0006319 3300046689 Bacteria 8861
197 Ga0495613_0006701 3300046689 Bacteria 8598
198 Ga0495613_0016812 3300046689 Bacteria 5447
199 Ga0495613_0024695 3300046689 Bacteria 4477
200 Ga0495613_0038463 3300046689 Bacteria 3546
201 Ga0495613_0040532 3300046689 Bacteria 3450
202 Ga0495613_0308338 3300046689 Bacteria 1094
203 Ga0495624_0028549 3300046690 Bacteria 3645
204 Ga0495624_0098285 3300046690 Bacteria 1803
205 Ga0495624_0099366 3300046690 Bacteria 1792
206 Ga0495624_0123877 3300046690 Bacteria 1587
207 Ga0495624_0127873 3300046690 Bacteria 1558
208 Ga0495670_0012482 3300046691 Bacteria 4180
209 Ga0495671_0035501 3300046692 Bacteria 2531
210 Ga0495649_0015263 3300046694 Bacteria 4373
211 Ga0495649_0048017 3300046694 Unclassified 2320
212 Ga0495589_0007638 3300046794 Bacteria 5662
213 Ga0495589_0011441 3300046794 Bacteria 4607
214 Ga0495589_0028747 3300046794 Bacteria 2805
215 Ga0495600_0033038 3300046809 Bacteria 3358
216 Ga0495581_0062109 3300047315 Bacteria 2158
217 Ga0495604_0000590 3300047317 Bacteria 31463
218 Ga0495604_0001143 3300047317 Bacteria 22009
219 Ga0495604_0004450 3300047317 Bacteria 11098
220 Ga0495604_0029354 3300047317 Bacteria 4374
221 Ga0495604_0070116 3300047317 Bacteria 2655
222 Ga0495636_0004636 3300047318 Bacteria 5391
223 Ga0495674_0015951 3300047319 Bacteria 7013
224 Ga0495674_0115065 3300047319 Bacteria 2277
225 Ga0495676_0003247 3300047321 Bacteria 14705
226 Ga0495676_0005241 3300047321 Bacteria 11862
227 Ga0495676_0020298 3300047321 Bacteria 5833
228 Ga0495676_0023066 3300047321 Bacteria 5405
229 Ga0495676_0041783 3300047321 Bacteria 3770
230 Ga0495676_0108693 3300047321 Bacteria 2039
231 Ga0495680_0020779 3300047322 Bacteria 5512
232 Ga0495683_0008473 3300047323 Bacteria 5498
233 Ga0495683_0061340 3300047323 Bacteria 1862
234 Ga0495687_006132 3300047443 Bacteria 7455
235 Ga0495687_007572 3300047443 Bacteria 6370
236 Ga0495687_010339 3300047443 Bacteria 5124
237 Ga0495687_014864 3300047443 Bacteria 3980
238 Ga0495675_0019532 3300047444 Bacteria 4304
239 Ga0495675_0131139 3300047444 Bacteria 1558
240 Ga0495685_000434 3300047447 Bacteria 13130
241 Ga0495685_000940 3300047447 Bacteria 8817
242 Ga0495685_017692 3300047447 Bacteria 2442
243 Ga0495685_021951 3300047447 Bacteria 2196
244 Ga0495685_043568 3300047447 Bacteria 1531
245 Ga0495681_0005012 3300047470 Bacteria 8927
246 Ga0495681_0071837 3300047470 Bacteria 1566
247 Ga0495684_0053084 3300047471 Bacteria 3092
248 Ga0495684_0080538 3300047471 Bacteria 2472
249 Ga0495686_0028701 3300047472 Bacteria 3623
250 Ga0495686_0070671 3300047472 Bacteria 2150
251 Ga0495593_0006021 3300047673 Bacteria 7136
252 Ga0495593_0019543 3300047673 Bacteria 3798
253 Ga0495593_0036976 3300047673 Bacteria 2644
254 Ga0495593_0041103 3300047673 Bacteria 2487
255 Ga0495602_0042170 3300048088 Bacteria 4160
256 Ga0495614_0007955 3300048089 Bacteria 4712
257 Ga0495614_0028098 3300048089 Bacteria 2424
258 Ga0495626_0024658 3300048091 Bacteria 2947
259 Ga0495626_0050548 3300048091 Bacteria 1920
260 Ga0495626_0128131 3300048091 Bacteria 1086
261 Ga0496108_0619544 3300048911 Bacteria 942
262 Ga0495678_048711 3300049459 Bacteria 1651
263 Ga0501034_0112030 3300049571 Bacteria 2719
264 Ga0501047_0010242 3300049581 Bacteria 8867
265 nmdc:mga05p37_49227_c1 3300050507 Bacteria 5183
266 nmdc:mga08y16_443012_c1 3300050511 Bacteria 1325
267 nmdc:mga08y16_57439_c1 3300050511 Bacteria 4067
268 nmdc:mga0rr50_95948_c1 3300050513 Bacteria 2319
269 nmdc:mga0a205_96716_c1 3300050515 Bacteria 2852
270 nmdc:mga0sz30_1330_c1 3300050516 Bacteria 8804
271 Ga0495601_0002791 3300053077 Bacteria 9920
272 Ga0495601_0025665 3300053077 Bacteria 3635
273 Ga0495612_0006703 3300053078 Bacteria 4718
274 Ga0500610_0064494 3300053079 Bacteria 1911
275 Ga0500578_0020263 3300053086 Bacteria 4273
276 Ga0500644_0009996 3300053088 Bacteria 2555
277 Ga0500566_0007880 3300053094 Bacteria 6307
278 Ga0500640_045522 3300053095 Bacteria 1924
279 Ga0500641_0021266 3300053096 Bacteria 2471
280 Ga0500641_0030375 3300053096 Bacteria 2123
281 Ga0500654_051340 3300053099 Bacteria 2216
282 Ga0500553_071938 3300053101 Bacteria 1585
283 Ga0500560_000535 3300053107 Bacteria 5390
284 Ga0500628_002536 3300053129 Bacteria 3013
285 Ga0500652_000879 3300053131 Bacteria 9955
286 Ga0500652_015185 3300053131 Bacteria 2773
287 Ga0500658_0007458 3300053134 Bacteria 4043
288 Ga0500561_0000356 3300053137 Bacteria 7608
289 Ga0500600_0007640 3300053149 Bacteria 6506
290 Ga0500616_0021361 3300053153 Bacteria 3631
291 Ga0500633_0001098 3300053160 Bacteria 4864
292 Ga0500634_0001409 3300053161 Bacteria 9311
293 Ga0500587_000710 3300053739 Bacteria 4260
294 2559422620 2558860280 Bacteria 11429938
295 2585307960 2582581313 Bacteria 10042643
296 2585309824 2582581313 Bacteria 10042643
297 2585318085 2582581314 Bacteria 11452267
298 2616696093 2616644814 Bacteria 11555299
299 2644016760 2643221601 Bacteria 7493239
300 2644178223 2643221631 Bacteria 8168043
301 2644268453 2643221647 Bacteria 10741251
302 2644440487 2643221678 Bacteria 9540101
303 2644441293 2643221678 Bacteria 9540101
304 2644626189 2643221714 Bacteria 9015452
305 2862582392 2862574272 Bacteria 10567477
306 2919476042 2919468124 Bacteria 9133025
307 2935395363 2935390628 Bacteria 7043367
308 2946067958 2946064051 Bacteria 8957905
309 2946080196 2946072368 Bacteria 8999607
310 2947231319 2947224130 Bacteria 9938529
311 2954701049 2954691527 Bacteria 10720516
312 2954706286 2954701450 Bacteria 10834262
313 Ga0075363_100013263
314 Ga0070668_100008370
315 Ga0070709_10134289
316 Ga0070714_100365871
317 Ga0070714_100420010
318 Ga0070713_100110157
319 Ga0070705_100122905
320 Ga0070662_100154705
321 Ga0068853_100011451
322 Ga0081455_10001018
323 Ga0081455_10006133
324 Ga0081455_10011311
325 Ga0081455_10059169
326 Ga0081540_1003157
327 Ga0081539_10002671
328 Ga0075369_10001139
329 Ga0075370_10102067
330 Ga0075428_100008840
331 Ga0075428_100222978
332 Ga0075431_100009784
333 Ga0075433_10167981
334 Ga0075434_100023309
335 Ga0068865_100089764
336 Ga0075435_100066074
337 Ga0111539_10225489
338 Ga0114129_10003738
339 Ga0105243_10042332
340 Ga0105243_10644553
341 Ga0105239_10109684
342 Ga0105239_10508711
343 Ga0163162_10192676
344 Ga0207700_10106960
345 Ga0207664_10270807
346 Ga0207668_10003611
347 Ga0207639_10052401
348 Ga0207639_10354623
349 Ga0207641_10520792
350 Ga0207675_100025862
351 Ga0307517_10011484
352 Ga0307517_10072535
353 Ga0307515_10002359
354 Ga0307515_10113966
355 Ga0307511_10000883
356 Ga0307511_10007647
357 Ga0307512_10013706
358 Ga0307513_10122186
359 Ga0307513_10153115
360 Ga0307513_10161868
361 Ga0307509_10005017
362 Ga0307509_10013050
363 Ga0307509_10034415
364 Ga0307509_10084308
365 Ga0307509_10123306
366 Ga0307509_10219254
367 Ga0307408_100188173
368 Ga0307508_10031476
369 Ga0307508_10057341
370 Ga0307508_10057916
371 Ga0307508_10137485
372 Ga0307514_10001238
373 Ga0307514_10019005
374 Ga0307514_10059758
375 Ga0307514_10063266
376 Ga0307514_10112541
377 Ga0307516_10006123
378 Ga0307516_10015598
379 Ga0307518_10000560
380 Ga0307518_10019773
381 Ga0307410_10152690
382 Ga0307406_10019955
383 Ga0307406_10034035
384 Ga0307406_10135408
385 Ga0307407_10045758
386 Ga0307409_100330756
387 Ga0307409_100652320
388 Ga0307416_100038868
389 Ga0307414_10239823
390 Ga0307411_10127817
391 Ga0307415_100072033
392 Ga0307507_10006074
393 Ga0307507_10006862
394 Ga0307510_10005157
395 Ga0307510_10066639
396 Ga0307510_10085009
397 Ga0373951_0000084
398 Ga0373925_0000624
399 Ga0373925_0037406
400 Ga0373925_0293097
401 Ga0373925_0451406
402 Ga0395898_0050679
403 Ga0395905_0306690
404 Ga0395901_0475339
405 Ga0436363_1197067
406 Ga0451793_0825601
407 Ga0451800_0821205
408 Ga0451833_0920281
409 Ga0451841_1119912
410 Ga0439463_003214
411 Ga0466963_0020532
412 Ga0495617_039557
413 Ga0495627_063478
414 Ga0495592_0025962
415 Ga0495592_0032132
416 Ga0495592_0076992
417 Ga0495603_0002765
418 Ga0495603_0006684
419 Ga0495603_0021299
420 Ga0495603_0059754
421 Ga0495629_0012139
422 Ga0495629_0015805
423 Ga0495629_0032429
424 Ga0495629_0038154
425 Ga0495629_0194097
426 Ga0495638_0002466
427 Ga0495638_0075366
428 Ga0495641_0019920
429 Ga0495651_0002222
430 Ga0495651_0004974
431 Ga0495651_0007427
432 Ga0495651_0028217
433 Ga0495653_0004323
434 Ga0495653_0017053
435 Ga0495653_0104463
436 Ga0495580_0063906
437 Ga0495582_0022602
438 Ga0495582_0153145
439 Ga0495605_0008189
440 Ga0495605_0009487
441 Ga0495662_0000364
442 Ga0495662_0001795
443 Ga0495662_0050039
444 Ga0495664_0002613
445 Ga0495664_0003634
446 Ga0495664_0008351
447 Ga0495664_0088402
448 Ga0495594_0019802
449 Ga0495594_0030345
450 Ga0495594_0150598
451 Ga0495583_0007351
452 Ga0495606_0006356
453 Ga0495608_0006682
454 Ga0495610_0086039
455 Ga0495616_0024026
456 Ga0495618_0006682
457 Ga0495620_0003843
458 Ga0495620_0014033
459 Ga0495628_0017547
460 Ga0495628_0020378
461 Ga0495628_0078412
462 Ga0495628_0122119
463 Ga0495630_0029152
464 Ga0495632_0023884
465 Ga0495643_0012629
466 Ga0495643_0017335
467 Ga0495643_0055620
468 Ga0495648_0008601
469 Ga0495648_0086482
470 Ga0495666_0001499
471 Ga0495666_0024699
472 Ga0495666_0051158
473 Ga0495652_0006075
474 Ga0495652_0011055
475 Ga0495652_0076376
476 Ga0495665_0002262
477 Ga0495665_0012858
478 Ga0495640_0023835
479 Ga0495640_0134591
480 Ga0495586_0028062
481 Ga0495586_0080800
482 Ga0495587_0012492
483 Ga0495587_0017037
484 Ga0495597_0010038
485 Ga0495622_0003726
486 Ga0495633_0051035
487 Ga0495656_0174361
488 Ga0495668_0022894
489 Ga0495668_0065830
490 Ga0495634_0051850
491 Ga0495634_0055613
492 Ga0495611_0084061
493 Ga0495625_0006706
494 Ga0495625_0012160
495 Ga0495635_0002757
496 Ga0495635_0014963
497 Ga0495635_0027871
498 Ga0495588_0011925
499 Ga0495657_0005911
500 Ga0495657_0016422
501 Ga0495599_0092853
502 Ga0495623_0055010
503 Ga0495646_0007480
504 Ga0495646_0008191
505 Ga0495646_0021295
506 Ga0495658_0129512
507 Ga0495613_0003092
508 Ga0495613_0006319
509 Ga0495613_0006701
510 Ga0495613_0016812
511 Ga0495613_0024695
512 Ga0495613_0038463
513 Ga0495613_0040532
514 Ga0495613_0308338
515 Ga0495624_0028549
516 Ga0495624_0098285
517 Ga0495624_0099366
518 Ga0495624_0123877
519 Ga0495624_0127873
520 Ga0495670_0012482
521 Ga0495671_0035501
522 Ga0495649_0015263
523 Ga0495649_0048017
524 Ga0495589_0007638
525 Ga0495589_0011441
526 Ga0495589_0028747
527 Ga0495600_0033038
528 Ga0495581_0062109
529 Ga0495604_0000590
530 Ga0495604_0001143
531 Ga0495604_0004450
532 Ga0495604_0029354
533 Ga0495604_0070116
534 Ga0495636_0004636
535 Ga0495674_0015951
536 Ga0495674_0115065
537 Ga0495676_0003247
538 Ga0495676_0005241
539 Ga0495676_0020298
540 Ga0495676_0023066
541 Ga0495676_0041783
542 Ga0495676_0108693
543 Ga0495680_0020779
544 Ga0495683_0008473
545 Ga0495683_0061340
546 Ga0495687_006132
547 Ga0495687_007572
548 Ga0495687_010339
549 Ga0495687_014864
550 Ga0495675_0019532
551 Ga0495675_0131139
552 Ga0495685_000434
553 Ga0495685_000940
554 Ga0495685_017692
555 Ga0495685_021951
556 Ga0495685_043568
557 Ga0495681_0005012
558 Ga0495681_0071837
559 Ga0495684_0053084
560 Ga0495684_0080538
561 Ga0495686_0028701
562 Ga0495686_0070671
563 Ga0495593_0006021
564 Ga0495593_0019543
565 Ga0495593_0036976
566 Ga0495593_0041103
567 Ga0495602_0042170
568 Ga0495614_0007955
569 Ga0495614_0028098
570 Ga0495626_0024658
571 Ga0495626_0050548
572 Ga0495626_0128131
573 Ga0496108_0619544
574 Ga0495678_048711
575 Ga0501034_0112030
576 Ga0501047_0010242
577 nmdc:mga05p37_49227_c1
578 nmdc:mga08y16_443012_c1
579 nmdc:mga08y16_57439_c1
580 nmdc:mga0rr50_95948_c1
581 nmdc:mga0a205_96716_c1
582 nmdc:mga0sz30_1330_c1
583 Ga0495601_0002791
584 Ga0495601_0025665
585 Ga0495612_0006703
586 Ga0500610_0064494
587 Ga0500578_0020263
588 Ga0500644_0009996
589 Ga0500566_0007880
590 Ga0500640_045522
591 Ga0500641_0021266
592 Ga0500641_0030375
593 Ga0500654_051340
594 Ga0500553_071938
595 Ga0500560_000535
596 Ga0500628_002536
597 Ga0500652_000879
598 Ga0500652_015185
599 Ga0500658_0007458
600 Ga0500561_0000356
601 Ga0500600_0007640
602 Ga0500616_0021361
603 Ga0500633_0001098
604 Ga0500634_0001409
605 Ga0500587_000710
606 2559422620
607 2585307960
608 2585309824
609 2585318085
610 2616696093
611 2644016760
612 2644178223
613 2644268453
614 2644440487
615 2644441293
616 2644626189
617 2862582392
618 2919476042
619 2935395363
620 2946067958
621 2946080196
622 2947231319
623 2954701049
624 2954706286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

157

282

0.88

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

27

117

0.87

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

169

323

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fn6-assembly1.cif.gz_B modifying region (dh-er-kr) of an insect fatty acid synthase (fas) 0.8464 70 295
8g7w-assembly2.cif.gz_B type i modpks reducing region 0.8314 51 294
2vz8-assembly1.cif.gz_A crystal structure of mammalian fatty acid synthase 0.8162 70 295
3i4c-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus adh(ssadh) double mutant (w95l,n249y) 0.8134 53 289
8eyk-assembly1.cif.gz_F atomic model of the core modifying region of human fatty acid synthase in complex with tvb-2640 0.8122 70 295
ID Description Score Start End Superfamily
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8888 114 262 3.40.50.720
af_Q54UL7_143_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8669 114 233 3.40.50.720
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8651 114 236 3.40.50.720
af_O45496_127_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.865 115 254 3.40.50.720
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8489 130 240 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0KTM4-F1-model_v4 deleted 0.9677 80 295
AF-A0A534PZL9-F1-model_v4 Zinc-binding dehydrogenase 0.9608 190 292
AF-A0A4D4LPP2-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9566 180 292
AF-A0A2W2C3Q0-F1-model_v4 NADPH:quinone reductase 0.9466 75 293
AF-A0A839DXW9-F1-model_v4 NADPH2:quinone reductase (EC 1.6.5.5) 0.9408 41 295 GO:0016491

Map