F401588

General Info

Members Datasets Scaffolds Average Seq Length
312 205 624 173

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100434993|Ga0070708_1004349932
Length 191
Sequence VARSGRFRLARAHHGRDARAVQPAEVTNLDRYGNPVLPWGRAHDLLASGPKGPLAGFFLGTVRPDGRPHAAGIGAVWHDGDLYFTSGPGTRKARNLASNPACTISVKLADMDLTLDGEAARVTEPTILERVAGIYRDIGWPAEVSGDGFTAPYSAPSAGPPPWHLYRFTFHTVVGLSTAEPNGATRWRFDR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
205 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 4.81
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 6.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100434993 3300005445 Unclassified 1237
2 JGI25406J46586_10044656 3300003203 Unclassified 1532
3 JGI25406J46586_10086650 3300003203 Bacteria 951
4 rootL2_10310734 3300003322 Bacteria 2119
5 Ga0070683_100016178 3300005329 Bacteria 6569
6 Ga0068869_100037709 3300005334 Bacteria 3438
7 Ga0070682_100641165 3300005337 Bacteria 844
8 Ga0068868_100046608 3300005338 Bacteria 3394
9 Ga0070660_100061760 3300005339 Bacteria 2910
10 Ga0070689_100956353 3300005340 Bacteria 760
11 Ga0070691_10127750 3300005341 Bacteria 1285
12 Ga0070687_100013466 3300005343 Bacteria 3647
13 Ga0070687_100495665 3300005343 Bacteria 821
14 Ga0070661_100555557 3300005344 Bacteria 924
15 Ga0070692_10077808 3300005345 Bacteria 1780
16 Ga0070669_100024517 3300005353 Bacteria 4325
17 Ga0070669_100609623 3300005353 Bacteria 915
18 Ga0070675_100000917 3300005354 Bacteria 20968
19 Ga0070674_100059621 3300005356 Bacteria 2657
20 Ga0070659_100001292 3300005366 Bacteria 18146
21 Ga0070667_100606590 3300005367 Bacteria 1009
22 Ga0070714_100014324 3300005435 Bacteria 6368
23 Ga0070714_100931103 3300005435 Bacteria 844
24 Ga0070705_100107950 3300005440 Bacteria 1772
25 Ga0070700_100039764 3300005441 Bacteria 2875
26 Ga0070700_100199929 3300005441 Bacteria 1403
27 Ga0070708_100046434 3300005445 Bacteria 3832
28 Ga0070708_100097226 3300005445 Bacteria 2691
29 Ga0070663_100040391 3300005455 Bacteria 3266
30 Ga0070678_100007220 3300005456 Bacteria 6574
31 Ga0070662_100221078 3300005457 Bacteria 1511
32 Ga0070681_10640268 3300005458 Bacteria 978
33 Ga0070706_100047037 3300005467 Bacteria 3981
34 Ga0070706_100104970 3300005467 Bacteria 2629
35 Ga0070706_100700392 3300005467 Bacteria 939
36 Ga0070707_100002834 3300005468 Bacteria 16501
37 Ga0070707_100085257 3300005468 Bacteria 3053
38 Ga0070707_100242418 3300005468 Unclassified 1754
39 Ga0070698_100007057 3300005471 Bacteria 12165
40 Ga0070698_100806861 3300005471 Bacteria 883
41 Ga0070679_100672285 3300005530 Unclassified 978
42 Ga0070684_100004109 3300005535 Bacteria 11007
43 Ga0070684_100027680 3300005535 Bacteria 4787
44 Ga0070684_100155661 3300005535 Bacteria 2072
45 Ga0070697_100000151 3300005536 Bacteria 56722
46 Ga0068853_100335703 3300005539 Bacteria 1403
47 Ga0070693_100200314 3300005547 Bacteria 1296
48 Ga0070665_100059023 3300005548 Bacteria 3846
49 Ga0070665_100377675 3300005548 Bacteria 1424
50 Ga0068855_100048549 3300005563 Bacteria 5009
51 Ga0070664_100005561 3300005564 Bacteria 10125
52 Ga0068857_100012087 3300005577 Bacteria 7507
53 Ga0068857_100013682 3300005577 Bacteria 7070
54 Ga0068856_100026056 3300005614 Bacteria 5702
55 Ga0070702_100104572 3300005615 Bacteria 1743
56 Ga0068852_100055046 3300005616 Bacteria 3432
57 Ga0068852_100074635 3300005616 Bacteria 2988
58 Ga0068859_102063692 3300005617 Bacteria 629
59 Ga0068864_100008792 3300005618 Bacteria 8327
60 Ga0068864_100042591 3300005618 Bacteria 3885
61 Ga0068864_100115340 3300005618 Bacteria 2396
62 Ga0068861_100104145 3300005719 Bacteria 2263
63 Ga0068870_10751083 3300005840 Bacteria 677
64 Ga0068863_100000632 3300005841 Bacteria 35693
65 Ga0068863_101033995 3300005841 Bacteria 825
66 Ga0068858_100094712 3300005842 Bacteria 2782
67 Ga0068858_100388136 3300005842 Bacteria 1340
68 Ga0068862_100109378 3300005844 Bacteria 2424
69 Ga0068862_101394722 3300005844 Unclassified 704
70 Ga0081455_10058522 3300005937 Bacteria 3260
71 Ga0081455_10069446 3300005937 Bacteria 2930
72 Ga0081540_1002315 3300005983 Bacteria 15610
73 Ga0081540_1045831 3300005983 Bacteria 2215
74 Ga0081539_10003081 3300005985 Bacteria 21451
75 Ga0081539_10004128 3300005985 Bacteria 16536
76 Ga0081539_10004698 3300005985 Bacteria 14814
77 Ga0081539_10032241 3300005985 Bacteria 3212
78 Ga0070717_10007508 3300006028 Bacteria 8102
79 Ga0070717_10074461 3300006028 Unclassified 2838
80 Ga0070717_10081589 3300006028 Bacteria 2715
81 Ga0075365_10168527 3300006038 Bacteria 1528
82 Ga0070716_100065194 3300006173 Bacteria 2120
83 Ga0070712_100776288 3300006175 Bacteria 821
84 Ga0075428_100055136 3300006844 Bacteria 4355
85 Ga0075428_100383150 3300006844 Bacteria 1507
86 Ga0075428_100831866 3300006844 Unclassified 981
87 Ga0075430_100042108 3300006846 Bacteria 3862
88 Ga0075430_100152089 3300006846 Bacteria 1927
89 Ga0075431_100021918 3300006847 Bacteria 6531
90 Ga0075433_10110345 3300006852 Bacteria 2440
91 Ga0075434_100040518 3300006871 Bacteria 4612
92 Ga0075434_100043398 3300006871 Bacteria 4460
93 Ga0075434_101913662 3300006871 Bacteria 599
94 Ga0075429_100082251 3300006880 Bacteria 2807
95 Ga0075429_100602975 3300006880 Bacteria 962
96 Ga0068865_100015210 3300006881 Bacteria 4904
97 Ga0068865_100143112 3300006881 Bacteria 1805
98 Ga0097620_102063323 3300006931 Bacteria 629
99 Ga0075435_100862993 3300007076 Bacteria 789
100 Ga0111539_10056587 3300009094 Bacteria 4660
101 Ga0111539_10244674 3300009094 Bacteria 2088
102 Ga0111539_10961765 3300009094 Bacteria 993
103 Ga0105245_10003390 3300009098 Bacteria 14272
104 Ga0105245_10004330 3300009098 Bacteria 12565
105 Ga0105247_10043720 3300009101 Bacteria 2745
106 Ga0105247_10283755 3300009101 Bacteria 1143
107 Ga0114129_10002210 3300009147 Bacteria 26825
108 Ga0114129_10108030 3300009147 Bacteria 3842
109 Ga0114129_10178908 3300009147 Bacteria 2888
110 Ga0114129_10342020 3300009147 Bacteria 1984
111 Ga0114129_10353229 3300009147 Bacteria 1947
112 Ga0114129_10464851 3300009147 Bacteria 1658
113 Ga0114129_10729262 3300009147 Unclassified 1271
114 Ga0114129_11388351 3300009147 Bacteria 867
115 Ga0114129_11979524 3300009147 Bacteria 705
116 Ga0105243_11202492 3300009148 Bacteria 771
117 Ga0105243_11569955 3300009148 Bacteria 684
118 Ga0105242_10240749 3300009176 Bacteria 1626
119 Ga0105248_10408054 3300009177 Bacteria 1530
120 Ga0105248_10454846 3300009177 Bacteria 1443
121 Ga0105248_11265359 3300009177 Bacteria 834
122 Ga0105238_10162535 3300009551 Bacteria 2209
123 Ga0105238_10261741 3300009551 Bacteria 1709
124 Ga0105249_10061580 3300009553 Bacteria 3444
125 Ga0105249_10301027 3300009553 Bacteria 1608
126 Ga0105239_10003323 3300010375 Bacteria 19789
127 Ga0105246_10007885 3300011119 Bacteria 6533
128 Ga0157371_10299693 3300013102 Bacteria 1164
129 Ga0157369_10117197 3300013105 Bacteria 2827
130 Ga0163162_10255968 3300013306 Bacteria 1882
131 Ga0163162_10355202 3300013306 Bacteria 1598
132 Ga0157372_10001454 3300013307 Bacteria 25656
133 Ga0157375_11056016 3300013308 Bacteria 950
134 Ga0163163_10040351 3300014325 Bacteria 4558
135 Ga0163163_10155033 3300014325 Bacteria 2334
136 Ga0163163_10269902 3300014325 Bacteria 1752
137 Ga0157377_10004791 3300014745 Bacteria 6275
138 Ga0157379_10022699 3300014968 Bacteria 5561
139 Ga0207692_10004367 3300025898 Bacteria 5599
140 Ga0207688_10212726 3300025901 Bacteria 1162
141 Ga0207647_10171521 3300025904 Bacteria 1263
142 Ga0207643_10401547 3300025908 Bacteria 866
143 Ga0207643_10615061 3300025908 Bacteria 700
144 Ga0207705_10171442 3300025909 Bacteria 1634
145 Ga0207684_10066852 3300025910 Bacteria 3053
146 Ga0207684_10429098 3300025910 Bacteria 1135
147 Ga0207707_10504150 3300025912 Bacteria 1032
148 Ga0207662_10100387 3300025918 Bacteria 1792
149 Ga0207662_10168721 3300025918 Bacteria 1402
150 Ga0207657_10253953 3300025919 Bacteria 1401
151 Ga0207649_10634930 3300025920 Bacteria 824
152 Ga0207646_10009193 3300025922 Bacteria 9799
153 Ga0207646_10011105 3300025922 Bacteria 8743
154 Ga0207646_10076373 3300025922 Bacteria 2993
155 Ga0207681_10026138 3300025923 Bacteria 3763
156 Ga0207681_10634815 3300025923 Bacteria 885
157 Ga0207694_10153817 3300025924 Bacteria 1854
158 Ga0207694_10566713 3300025924 Bacteria 954
159 Ga0207687_10039066 3300025927 Bacteria 3247
160 Ga0207687_10386402 3300025927 Bacteria 1148
161 Ga0207664_10013242 3300025929 Bacteria 5911
162 Ga0207664_10295224 3300025929 Bacteria 1425
163 Ga0207664_10708907 3300025929 Bacteria 905
164 Ga0207690_10025170 3300025932 Bacteria 3733
165 Ga0207706_10030037 3300025933 Bacteria 4850
166 Ga0207704_10080570 3300025938 Bacteria 2102
167 Ga0207711_10252482 3300025941 Bacteria 1620
168 Ga0207711_10719200 3300025941 Bacteria 931
169 Ga0207711_11178628 3300025941 Bacteria 707
170 Ga0207689_10037909 3300025942 Bacteria 3995
171 Ga0207661_10030249 3300025944 Bacteria 4169
172 Ga0207661_10090325 3300025944 Bacteria 2550
173 Ga0207679_10040813 3300025945 Bacteria 3324
174 Ga0207712_10860389 3300025961 Bacteria 800
175 Ga0207677_10372173 3300026023 Bacteria 1203
176 Ga0207703_10040220 3300026035 Bacteria 3741
177 Ga0207703_10386601 3300026035 Bacteria 1295
178 Ga0207678_10005758 3300026067 Bacteria 11051
179 Ga0207702_10114100 3300026078 Bacteria 2407
180 Ga0207641_10007184 3300026088 Bacteria 9286
181 Ga0207676_10075941 3300026095 Bacteria 2713
182 Ga0207674_10013926 3300026116 Bacteria 8897
183 Ga0207674_10023735 3300026116 Bacteria 6564
184 Ga0207675_100013852 3300026118 Bacteria 7519
185 Ga0207675_100134847 3300026118 Bacteria 2342
186 Ga0207683_10049138 3300026121 Bacteria 3692
187 Ga0207698_10032406 3300026142 Bacteria 3786
188 Ga0207698_10104246 3300026142 Bacteria 2359
189 Ga0207428_10345118 3300027907 Bacteria 1096
190 Ga0207428_10728865 3300027907 Bacteria 708
191 Ga0268266_11513729 3300028379 Bacteria 646
192 Ga0268265_10058120 3300028380 Bacteria 2951
193 Ga0265318_10060627 3300028577 Bacteria 1410
194 Ga0307405_10004074 3300031731 Bacteria 6865
195 Ga0307413_10024571 3300031824 Bacteria 3288
196 Ga0307406_10003735 3300031901 Bacteria 8278
197 Ga0307406_11417060 3300031901 Bacteria 609
198 Ga0307407_10023994 3300031903 Bacteria 3191
199 Ga0307412_10055094 3300031911 Bacteria 2643
200 Ga0307409_100003905 3300031995 Bacteria 8248
201 Ga0307409_100014312 3300031995 Bacteria 5153
202 Ga0307409_101085682 3300031995 Bacteria 821
203 Ga0307416_100004646 3300032002 Bacteria 8314
204 Ga0307416_100031904 3300032002 Bacteria 3973
205 Ga0307415_100000054 3300032126 Bacteria 49124
206 Ga0307415_100137265 3300032126 Bacteria 1862
207 Ga0373931_0939344 3300035691 Bacteria 583
208 Ga0395899_0194261 3300037312 Bacteria 1419
209 Ga0395900_0040015 3300037418 Bacteria 4831
210 Ga0395900_1209718 3300037418 Bacteria 671
211 Ga0395898_0301099 3300037466 Bacteria 1530
212 Ga0436364_0504722 3300037853 Bacteria 8555
213 Ga0395901_0010566 3300038443 Bacteria 9353
214 Ga0436363_1595775 3300039450 Unclassified 1271
215 Ga0439448_0005498 3300042005 Bacteria 3614
216 Ga0439448_0035913 3300042005 Bacteria 1588
217 Ga0439450_000994 3300042008 Bacteria 3974
218 Ga0439454_050067 3300042011 Bacteria 704
219 Ga0439455_0006577 3300042012 Bacteria 2420
220 Ga0439463_006285 3300042016 Bacteria 2945
221 Ga0450923_096781 3300042125 Bacteria 678
222 Ga0439435_0154837 3300042436 Bacteria 737
223 Ga0439464_0024765 3300042439 Bacteria 1659
224 Ga0439460_0009750 3300042461 Bacteria 2445
225 Ga0439440_0008669 3300042993 Bacteria 2092
226 Ga0466969_0003587 3300044656 Bacteria 8260
227 Ga0453683_0335985 3300044673 Bacteria 969
228 Ga0466965_0002874 3300044683 Bacteria 7427
229 Ga0466965_0171396 3300044683 Bacteria 1142
230 Ga0466966_0062674 3300044684 Bacteria 2344
231 Ga0466961_0020462 3300044693 Bacteria 4258
232 Ga0466961_0323800 3300044693 Bacteria 940
233 Ga0453684_0528854 3300044712 Bacteria 1302
234 Ga0466957_0553261 3300044842 Bacteria 802
235 Ga0466960_0020978 3300044901 Bacteria 2903
236 Ga0466960_0055029 3300044901 Unclassified 1934
237 Ga0466959_0034376 3300045049 Bacteria 3749
238 Ga0466959_0056660 3300045049 Bacteria 2859
239 Ga0466959_0735762 3300045049 Bacteria 660
240 Ga0466967_0135018 3300045976 Bacteria 2294
241 Ga0466967_0303319 3300045976 Bacteria 1537
242 Ga0495584_0339542 3300046491 Bacteria 763
243 Ga0495670_0182654 3300046691 Bacteria 1108
244 Ga0495636_0229614 3300047318 Unclassified 854
245 Ga0496100_0011878 3300048903 Bacteria 4972
246 Ga0496101_0004609 3300048904 Bacteria 8707
247 Ga0496102_0021788 3300048905 Bacteria 5671
248 Ga0496102_0091776 3300048905 Bacteria 2811
249 Ga0496103_0419643 3300048906 Bacteria 859
250 Ga0496105_0152905 3300048908 Bacteria 1896
251 Ga0496106_0001806 3300048909 Bacteria 15991
252 Ga0496107_0004767 3300048910 Bacteria 9210
253 Ga0496107_0648862 3300048910 Bacteria 778
254 Ga0496108_0047144 3300048911 Bacteria 3602
255 Ga0496109_0163370 3300048912 Bacteria 2086
256 Ga0496110_0012010 3300048913 Bacteria 7115
257 Ga0496111_0022679 3300048914 Bacteria 4397
258 Ga0496112_0030481 3300048915 Bacteria 5220
259 Ga0496114_0170254 3300048917 Bacteria 1898
260 Ga0496117_0080171 3300048920 Bacteria 2148
261 Ga0496118_0000609 3300048921 Bacteria 58938
262 Ga0501031_0083937 3300049568 Bacteria 2076
263 Ga0501033_0157424 3300049570 Bacteria 1636
264 Ga0501036_0280940 3300049572 Bacteria 1393
265 Ga0501038_0106496 3300049574 Bacteria 2327
266 Ga0501038_0470728 3300049574 Bacteria 964
267 Ga0501039_0306503 3300049575 Unclassified 1248
268 Ga0501040_0258114 3300049576 Bacteria 1243
269 Ga0501041_0174237 3300049577 Unclassified 1346
270 Ga0501042_0004372 3300049578 Bacteria 9014
271 Ga0501043_0120013 3300049579 Bacteria 2062
272 Ga0501046_0163808 3300049580 Bacteria 1671
273 Ga0501047_0108446 3300049581 Bacteria 2659
274 Ga0501048_0060282 3300049582 Bacteria 2689
275 Ga0501069_0265963 3300049585 Bacteria 1002
276 Ga0501071_0223288 3300049587 Unclassified 1418
277 Ga0501072_0126873 3300049588 Bacteria 2033
278 Ga0501072_0386801 3300049588 Unclassified 1110
279 Ga0501074_0006651 3300049590 Bacteria 8352
280 Ga0501074_0341001 3300049590 Bacteria 1064
281 Ga0501075_0012255 3300049591 Bacteria 6088
282 Ga0501075_0118800 3300049591 Bacteria 2011
283 Ga0501076_0181714 3300049592 Bacteria 1715
284 Ga0501076_0568077 3300049592 Unclassified 935
285 Ga0501079_0057195 3300049741 Bacteria 3010
286 Ga0501079_0068430 3300049741 Bacteria 2741
287 Ga0501081_0042505 3300049743 Bacteria 3115
288 Ga0501081_0117254 3300049743 Bacteria 1894
289 Ga0501035_0687368 3300049822 Unclassified 826
290 Ga0501044_0800707 3300049823 Bacteria 822
291 Ga0501044_1062305 3300049823 Bacteria 680
292 Ga0501045_0002072 3300049824 Bacteria 13541
293 Ga0501045_1076482 3300049824 Bacteria 588
294 nmdc:mga05p37_150611_c2 3300050507 Bacteria 1965
295 nmdc:mga05p37_245177_c1 3300050507 Bacteria 2151
296 nmdc:mga05p37_391105_c1 3300050507 Unclassified 1626
297 nmdc:mga05p37_4799_c1 3300050507 Bacteria 15804
298 nmdc:mga05p37_548223_c1 3300050507 Bacteria 1317
299 nmdc:mga0qj67_193327_c1 3300050509 Unclassified 1653
300 nmdc:mga0qj67_95248_c1 3300050509 Bacteria 2396
301 nmdc:mga06r32_15284_c1 3300050510 Bacteria 6973
302 nmdc:mga06r32_59906_c1 3300050510 Bacteria 3662
303 nmdc:mga08y16_226452_c1 3300050511 Bacteria 1935
304 nmdc:mga08y16_382656_c1 3300050511 Bacteria 1442
305 nmdc:mga0n895_78544_c1 3300050512 Bacteria 3285
306 nmdc:mga0a205_44955_c1 3300050515 Bacteria 4259
307 Ga0501084_0037232 3300054114 Bacteria 4064
308 Ga0501084_0298289 3300054114 Bacteria 1361
309 Ga0501082_0014809 3300060353 Bacteria 6717
310 Ga0501082_1103787 3300060353 Bacteria 693
311 2676485241 2675903059 Bacteria 8644972
312 3006325068 3006321560 Bacteria 8247479
313 Ga0070708_100434993
314 JGI25406J46586_10044656
315 JGI25406J46586_10086650
316 rootL2_10310734
317 Ga0070683_100016178
318 Ga0068869_100037709
319 Ga0070682_100641165
320 Ga0068868_100046608
321 Ga0070660_100061760
322 Ga0070689_100956353
323 Ga0070691_10127750
324 Ga0070687_100013466
325 Ga0070687_100495665
326 Ga0070661_100555557
327 Ga0070692_10077808
328 Ga0070669_100024517
329 Ga0070669_100609623
330 Ga0070675_100000917
331 Ga0070674_100059621
332 Ga0070659_100001292
333 Ga0070667_100606590
334 Ga0070714_100014324
335 Ga0070714_100931103
336 Ga0070705_100107950
337 Ga0070700_100039764
338 Ga0070700_100199929
339 Ga0070708_100046434
340 Ga0070708_100097226
341 Ga0070663_100040391
342 Ga0070678_100007220
343 Ga0070662_100221078
344 Ga0070681_10640268
345 Ga0070706_100047037
346 Ga0070706_100104970
347 Ga0070706_100700392
348 Ga0070707_100002834
349 Ga0070707_100085257
350 Ga0070707_100242418
351 Ga0070698_100007057
352 Ga0070698_100806861
353 Ga0070679_100672285
354 Ga0070684_100004109
355 Ga0070684_100027680
356 Ga0070684_100155661
357 Ga0070697_100000151
358 Ga0068853_100335703
359 Ga0070693_100200314
360 Ga0070665_100059023
361 Ga0070665_100377675
362 Ga0068855_100048549
363 Ga0070664_100005561
364 Ga0068857_100012087
365 Ga0068857_100013682
366 Ga0068856_100026056
367 Ga0070702_100104572
368 Ga0068852_100055046
369 Ga0068852_100074635
370 Ga0068859_102063692
371 Ga0068864_100008792
372 Ga0068864_100042591
373 Ga0068864_100115340
374 Ga0068861_100104145
375 Ga0068870_10751083
376 Ga0068863_100000632
377 Ga0068863_101033995
378 Ga0068858_100094712
379 Ga0068858_100388136
380 Ga0068862_100109378
381 Ga0068862_101394722
382 Ga0081455_10058522
383 Ga0081455_10069446
384 Ga0081540_1002315
385 Ga0081540_1045831
386 Ga0081539_10003081
387 Ga0081539_10004128
388 Ga0081539_10004698
389 Ga0081539_10032241
390 Ga0070717_10007508
391 Ga0070717_10074461
392 Ga0070717_10081589
393 Ga0075365_10168527
394 Ga0070716_100065194
395 Ga0070712_100776288
396 Ga0075428_100055136
397 Ga0075428_100383150
398 Ga0075428_100831866
399 Ga0075430_100042108
400 Ga0075430_100152089
401 Ga0075431_100021918
402 Ga0075433_10110345
403 Ga0075434_100040518
404 Ga0075434_100043398
405 Ga0075434_101913662
406 Ga0075429_100082251
407 Ga0075429_100602975
408 Ga0068865_100015210
409 Ga0068865_100143112
410 Ga0097620_102063323
411 Ga0075435_100862993
412 Ga0111539_10056587
413 Ga0111539_10244674
414 Ga0111539_10961765
415 Ga0105245_10003390
416 Ga0105245_10004330
417 Ga0105247_10043720
418 Ga0105247_10283755
419 Ga0114129_10002210
420 Ga0114129_10108030
421 Ga0114129_10178908
422 Ga0114129_10342020
423 Ga0114129_10353229
424 Ga0114129_10464851
425 Ga0114129_10729262
426 Ga0114129_11388351
427 Ga0114129_11979524
428 Ga0105243_11202492
429 Ga0105243_11569955
430 Ga0105242_10240749
431 Ga0105248_10408054
432 Ga0105248_10454846
433 Ga0105248_11265359
434 Ga0105238_10162535
435 Ga0105238_10261741
436 Ga0105249_10061580
437 Ga0105249_10301027
438 Ga0105239_10003323
439 Ga0105246_10007885
440 Ga0157371_10299693
441 Ga0157369_10117197
442 Ga0163162_10255968
443 Ga0163162_10355202
444 Ga0157372_10001454
445 Ga0157375_11056016
446 Ga0163163_10040351
447 Ga0163163_10155033
448 Ga0163163_10269902
449 Ga0157377_10004791
450 Ga0157379_10022699
451 Ga0207692_10004367
452 Ga0207688_10212726
453 Ga0207647_10171521
454 Ga0207643_10401547
455 Ga0207643_10615061
456 Ga0207705_10171442
457 Ga0207684_10066852
458 Ga0207684_10429098
459 Ga0207707_10504150
460 Ga0207662_10100387
461 Ga0207662_10168721
462 Ga0207657_10253953
463 Ga0207649_10634930
464 Ga0207646_10009193
465 Ga0207646_10011105
466 Ga0207646_10076373
467 Ga0207681_10026138
468 Ga0207681_10634815
469 Ga0207694_10153817
470 Ga0207694_10566713
471 Ga0207687_10039066
472 Ga0207687_10386402
473 Ga0207664_10013242
474 Ga0207664_10295224
475 Ga0207664_10708907
476 Ga0207690_10025170
477 Ga0207706_10030037
478 Ga0207704_10080570
479 Ga0207711_10252482
480 Ga0207711_10719200
481 Ga0207711_11178628
482 Ga0207689_10037909
483 Ga0207661_10030249
484 Ga0207661_10090325
485 Ga0207679_10040813
486 Ga0207712_10860389
487 Ga0207677_10372173
488 Ga0207703_10040220
489 Ga0207703_10386601
490 Ga0207678_10005758
491 Ga0207702_10114100
492 Ga0207641_10007184
493 Ga0207676_10075941
494 Ga0207674_10013926
495 Ga0207674_10023735
496 Ga0207675_100013852
497 Ga0207675_100134847
498 Ga0207683_10049138
499 Ga0207698_10032406
500 Ga0207698_10104246
501 Ga0207428_10345118
502 Ga0207428_10728865
503 Ga0268266_11513729
504 Ga0268265_10058120
505 Ga0265318_10060627
506 Ga0307405_10004074
507 Ga0307413_10024571
508 Ga0307406_10003735
509 Ga0307406_11417060
510 Ga0307407_10023994
511 Ga0307412_10055094
512 Ga0307409_100003905
513 Ga0307409_100014312
514 Ga0307409_101085682
515 Ga0307416_100004646
516 Ga0307416_100031904
517 Ga0307415_100000054
518 Ga0307415_100137265
519 Ga0373931_0939344
520 Ga0395899_0194261
521 Ga0395900_0040015
522 Ga0395900_1209718
523 Ga0395898_0301099
524 Ga0436364_0504722
525 Ga0395901_0010566
526 Ga0436363_1595775
527 Ga0439448_0005498
528 Ga0439448_0035913
529 Ga0439450_000994
530 Ga0439454_050067
531 Ga0439455_0006577
532 Ga0439463_006285
533 Ga0450923_096781
534 Ga0439435_0154837
535 Ga0439464_0024765
536 Ga0439460_0009750
537 Ga0439440_0008669
538 Ga0466969_0003587
539 Ga0453683_0335985
540 Ga0466965_0002874
541 Ga0466965_0171396
542 Ga0466966_0062674
543 Ga0466961_0020462
544 Ga0466961_0323800
545 Ga0453684_0528854
546 Ga0466957_0553261
547 Ga0466960_0020978
548 Ga0466960_0055029
549 Ga0466959_0034376
550 Ga0466959_0056660
551 Ga0466959_0735762
552 Ga0466967_0135018
553 Ga0466967_0303319
554 Ga0495584_0339542
555 Ga0495670_0182654
556 Ga0495636_0229614
557 Ga0496100_0011878
558 Ga0496101_0004609
559 Ga0496102_0021788
560 Ga0496102_0091776
561 Ga0496103_0419643
562 Ga0496105_0152905
563 Ga0496106_0001806
564 Ga0496107_0004767
565 Ga0496107_0648862
566 Ga0496108_0047144
567 Ga0496109_0163370
568 Ga0496110_0012010
569 Ga0496111_0022679
570 Ga0496112_0030481
571 Ga0496114_0170254
572 Ga0496117_0080171
573 Ga0496118_0000609
574 Ga0501031_0083937
575 Ga0501033_0157424
576 Ga0501036_0280940
577 Ga0501038_0106496
578 Ga0501038_0470728
579 Ga0501039_0306503
580 Ga0501040_0258114
581 Ga0501041_0174237
582 Ga0501042_0004372
583 Ga0501043_0120013
584 Ga0501046_0163808
585 Ga0501047_0108446
586 Ga0501048_0060282
587 Ga0501069_0265963
588 Ga0501071_0223288
589 Ga0501072_0126873
590 Ga0501072_0386801
591 Ga0501074_0006651
592 Ga0501074_0341001
593 Ga0501075_0012255
594 Ga0501075_0118800
595 Ga0501076_0181714
596 Ga0501076_0568077
597 Ga0501079_0057195
598 Ga0501079_0068430
599 Ga0501081_0042505
600 Ga0501081_0117254
601 Ga0501035_0687368
602 Ga0501044_0800707
603 Ga0501044_1062305
604 Ga0501045_0002072
605 Ga0501045_1076482
606 nmdc:mga05p37_150611_c2
607 nmdc:mga05p37_245177_c1
608 nmdc:mga05p37_391105_c1
609 nmdc:mga05p37_4799_c1
610 nmdc:mga05p37_548223_c1
611 nmdc:mga0qj67_193327_c1
612 nmdc:mga0qj67_95248_c1
613 nmdc:mga06r32_15284_c1
614 nmdc:mga06r32_59906_c1
615 nmdc:mga08y16_226452_c1
616 nmdc:mga08y16_382656_c1
617 nmdc:mga0n895_78544_c1
618 nmdc:mga0a205_44955_c1
619 Ga0501084_0037232
620 Ga0501084_0298289
621 Ga0501082_0014809
622 Ga0501082_1103787
623 2676485241
624 3006325068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

55

126

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8213 26 158
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8173 38 158
6vna-assembly1.cif.gz_C pden_1323 0.8146 22 171
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.7825 22 156
2arz-assembly1.cif.gz_B crystal structure of protein of unknown function from pseudomonas aeruginosa 0.7789 24 172
ID Description Score Start End Superfamily
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7959 23 158 2.30.110.10
af_Q0J6W9_62_206_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7847 23 169 2.30.110.10
2arzB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7771 24 172 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.774 25 164 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7701 23 158 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A535EPY7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9876 24 172
AF-A0A1V2Q3F8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9864 4 174 GO:0005829
GO:0016627
GO:0070967
AF-A0A536BI56-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9768 38 172 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W6C2A9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9761 20 172
AF-A0A1V2Q3F8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9751 4 174 GO:0005829
GO:0016627
GO:0070967

Map