F401587

General Info

Members Datasets Scaffolds Average Seq Length
312 193 312 227

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100378348|Ga0070708_1003783481
Length 254
Sequence MTTLQQLAVLNEEIISCQKCLRLARYRERIARTKRRAYRDWTYWGRPVPGFGDPQAELLIIGLAPAAHGANRTGRMFTGDRSGDFLHRLLHRVGLANQPTSTHRGDGLALHNAYISATLRCAPPHNKPLPGETRNCLPYLEAELDLIRPRAVLALGRIAFDAYLKLLLKRGAIATRSGYKFSHGASYQLSSALSTQSSRAHPGYAEATGAGQLQTRLPHLFASYHPSQQNTQTGRLTPAMFLRVLRQIRRFLSA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 8.33
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c005076 3300000041 Archaea 1134
2 ARcpr5yngRDRAFT_c005611 3300000043 Archaea 1153
3 Ga0070690_100096151 3300005330 Bacteria 1957
4 Ga0068868_100266775 3300005338 Bacteria 1445
5 Ga0070689_100081544 3300005340 Bacteria 2540
6 Ga0070687_100021453 3300005343 Bacteria 3036
7 Ga0070687_100049282 3300005343 Bacteria 2170
8 Ga0070675_100000395 3300005354 Bacteria 29588
9 Ga0070671_100026926 3300005355 Bacteria 4730
10 Ga0070671_100106236 3300005355 Bacteria 2357
11 Ga0070673_100096165 3300005364 Bacteria 2430
12 Ga0070659_100065739 3300005366 Bacteria 2872
13 Ga0070667_100030892 3300005367 Bacteria 4467
14 Ga0070667_100223399 3300005367 Unclassified 1677
15 Ga0070709_10006953 3300005434 Bacteria 6177
16 Ga0070709_10029533 3300005434 Unclassified 3280
17 Ga0070709_10262221 3300005434 Bacteria 1249
18 Ga0070709_10432612 3300005434 Unclassified 988
19 Ga0070714_100030690 3300005435 Bacteria 4476
20 Ga0070713_100003098 3300005436 Bacteria 10936
21 Ga0070713_100024085 3300005436 Viruses 4736
22 Ga0070711_100011019 3300005439 Bacteria 5608
23 Ga0070705_100035218 3300005440 Bacteria 2805
24 Ga0070705_100070143 3300005440 Unclassified 2116
25 Ga0070705_100138717 3300005440 Bacteria 1597
26 Ga0070694_100083371 3300005444 Bacteria 2228
27 Ga0070694_100174042 3300005444 Bacteria 1588
28 Ga0070708_100102600 3300005445 Unclassified 2621
29 Ga0070708_100378348 3300005445 Bacteria 1335
30 Ga0070663_100387436 3300005455 Bacteria 1139
31 Ga0070678_100474884 3300005456 Bacteria 1099
32 Ga0068867_100323936 3300005459 Bacteria 1278
33 Ga0070685_10003815 3300005466 Bacteria 7625
34 Ga0070685_10005168 3300005466 Bacteria 6618
35 Ga0070706_100329813 3300005467 Bacteria 1423
36 Ga0070706_100675455 3300005467 Bacteria 958
37 Ga0070707_100000161 3300005468 Bacteria 63936
38 Ga0070698_100002089 3300005471 Bacteria 22175
39 Ga0070698_100088879 3300005471 Bacteria 3074
40 Ga0070697_100440697 3300005536 Bacteria 1134
41 Ga0070686_100227781 3300005544 Bacteria 1350
42 Ga0070695_100062670 3300005545 Bacteria 2415
43 Ga0070696_100050670 3300005546 Bacteria 2886
44 Ga0070696_100367292 3300005546 Bacteria 1118
45 Ga0070704_100015144 3300005549 Bacteria 4836
46 Ga0070704_100016941 3300005549 Bacteria 4620
47 Ga0070704_100033226 3300005549 Bacteria 3486
48 Ga0070664_100312146 3300005564 Unclassified 1423
49 Ga0070664_100346152 3300005564 Bacteria 1351
50 Ga0068857_100710082 3300005577 Bacteria 956
51 Ga0070702_100021310 3300005615 Bacteria 3408
52 Ga0068864_100287752 3300005618 Bacteria 1535
53 Ga0068866_10445426 3300005718 Bacteria 846
54 Ga0068861_100246685 3300005719 Bacteria 1521
55 Ga0068851_10178345 3300005834 Bacteria 1176
56 Ga0068870_10047668 3300005840 Bacteria 2253
57 Ga0068858_100063943 3300005842 Bacteria 3404
58 Ga0068860_100022745 3300005843 Bacteria 6061
59 Ga0068860_100429595 3300005843 Bacteria 1310
60 Ga0070717_10058790 3300006028 Archaea 3179
61 Ga0075365_10219764 3300006038 Bacteria 1333
62 Ga0070716_100001625 3300006173 Bacteria 10133
63 Ga0070712_100031130 3300006175 Unclassified 3592
64 Ga0075430_100007614 3300006846 Bacteria 9148
65 Ga0075433_10034759 3300006852 Bacteria 4331
66 Ga0075436_100002089 3300006914 Bacteria 13788
67 Ga0075435_100011308 3300007076 Bacteria 6560
68 Ga0075435_100098500 3300007076 Bacteria 2421
69 Ga0099794_10001821 3300007265 Bacteria 7607
70 Ga0099794_10019574 3300007265 Bacteria 3053
71 Ga0099795_10002193 3300007788 Bacteria 4517
72 Ga0105240_10037391 3300009093 Bacteria 6240
73 Ga0105240_10142763 3300009093 Bacteria 2861
74 Ga0111539_10684190 3300009094 Bacteria 1194
75 Ga0105245_10055087 3300009098 Bacteria 3571
76 Ga0105247_10038748 3300009101 Bacteria 2911
77 Ga0114129_10118656 3300009147 Bacteria 3644
78 Ga0114129_10911569 3300009147 Bacteria 1113
79 Ga0105243_10201341 3300009148 Bacteria 1746
80 Ga0105243_10762777 3300009148 Bacteria 950
81 Ga0105242_10072884 3300009176 Bacteria 2854
82 Ga0105242_10123618 3300009176 Unclassified 2225
83 Ga0105248_10001065 3300009177 Bacteria 30355
84 Ga0105248_10150387 3300009177 Unclassified 2627
85 Ga0105237_10030508 3300009545 Bacteria 5474
86 Ga0105249_10404919 3300009553 Bacteria 1395
87 Ga0105239_10046155 3300010375 Bacteria 4773
88 Ga0157370_10103446 3300013104 Bacteria 2666
89 Ga0157374_10029364 3300013296 Bacteria 4978
90 Ga0157374_10157801 3300013296 Bacteria 2209
91 Ga0157374_10948094 3300013296 Bacteria 879
92 Ga0157378_10001669 3300013297 Bacteria 20038
93 Ga0157378_10054266 3300013297 Bacteria 3568
94 Ga0157378_10107144 3300013297 Bacteria 2557
95 Ga0157378_10272350 3300013297 Bacteria 1629
96 Ga0163162_10051177 3300013306 Bacteria 4143
97 Ga0163162_10630875 3300013306 Bacteria 1196
98 Ga0157372_10148525 3300013307 Unclassified 2704
99 Ga0157375_10000907 3300013308 Bacteria 25747
100 Ga0157375_10178080 3300013308 Bacteria 2277
101 Ga0157375_11006504 3300013308 Bacteria 973
102 Ga0163163_10020299 3300014325 Bacteria 6254
103 Ga0157377_10100699 3300014745 Bacteria 1721
104 Ga0157377_10140505 3300014745 Unclassified 1484
105 Ga0157379_10000644 3300014968 Bacteria 28159
106 Ga0157379_10459968 3300014968 Bacteria 1176
107 Ga0224572_1017055 3300024225 Unclassified 1393
108 Ga0228598_1000474 3300024227 Bacteria 8213
109 Ga0207685_10052835 3300025905 Bacteria 1575
110 Ga0207699_10003490 3300025906 Bacteria 7504
111 Ga0207699_10366884 3300025906 Unclassified 1019
112 Ga0207643_10075622 3300025908 Bacteria 1944
113 Ga0207684_10015379 3300025910 Bacteria 6587
114 Ga0207671_10114216 3300025914 Unclassified 2058
115 Ga0207663_10004082 3300025916 Bacteria 7240
116 Ga0207662_10019715 3300025918 Bacteria 3842
117 Ga0207646_10045077 3300025922 Bacteria 3958
118 Ga0207646_10577814 3300025922 Bacteria 1009
119 Ga0207650_10016193 3300025925 Bacteria 5206
120 Ga0207700_10002305 3300025928 Bacteria 10953
121 Ga0207700_10147394 3300025928 Viruses 1941
122 Ga0207664_10025070 3300025929 Bacteria 4486
123 Ga0207664_10106379 3300025929 Unclassified 2326
124 Ga0207664_10276095 3300025929 Unclassified 1473
125 Ga0207644_10050408 3300025931 Bacteria 2984
126 Ga0207690_10022462 3300025932 Bacteria 3926
127 Ga0207669_10048034 3300025937 Bacteria 2533
128 Ga0207665_10000649 3300025939 Bacteria 23368
129 Ga0207691_10118714 3300025940 Bacteria 2346
130 Ga0207689_10101303 3300025942 Bacteria 2366
131 Ga0207689_10278996 3300025942 Bacteria 1384
132 Ga0207679_10307501 3300025945 Bacteria 1368
133 Ga0207651_10071830 3300025960 Bacteria 2455
134 Ga0207651_10138136 3300025960 Bacteria 1878
135 Ga0207712_10255915 3300025961 Bacteria 1417
136 Ga0207658_10197266 3300025986 Bacteria 1678
137 Ga0207703_10025618 3300026035 Bacteria 4640
138 Ga0207708_10046102 3300026075 Bacteria 3321
139 Ga0207648_10290007 3300026089 Bacteria 1465
140 Ga0207676_10100231 3300026095 Bacteria 2399
141 Ga0207674_10373911 3300026116 Bacteria 1377
142 Ga0207675_100209602 3300026118 Bacteria 1874
143 Ga0207683_10180062 3300026121 Bacteria 1916
144 Ga0209588_1022173 3300027671 Bacteria 1998
145 Ga0209588_1049870 3300027671 Unclassified 1355
146 Ga0268265_10072927 3300028380 Bacteria 2679
147 Ga0268264_10052104 3300028381 Bacteria 3412
148 Ga0268264_10154195 3300028381 Bacteria 2063
149 Ga0265338_10054563 3300028800 Bacteria 3562
150 Ga0265338_10069772 3300028800 Bacteria 3017
151 Ga0265765_1004022 3300030879 Unclassified 1497
152 Ga0265760_10000023 3300031090 Bacteria 67653
153 Ga0265760_10031164 3300031090 Unclassified 1572
154 Ga0265325_10011158 3300031241 Bacteria 5171
155 Ga0265325_10019341 3300031241 Bacteria 3766
156 Ga0265331_10002970 3300031250 Bacteria 11159
157 Ga0265316_10005664 3300031344 Bacteria 12090
158 Ga0265316_10098044 3300031344 Bacteria 2230
159 Ga0265314_10070235 3300031711 Unclassified 2347
160 Ga0373926_0122890 3300035083 Bacteria 979
161 Ga0373934_0036121 3300035086 Bacteria 1946
162 Ga0373923_0049092 3300035111 Bacteria 1764
163 Ga0373923_0208091 3300035111 Bacteria 906
164 Ga0373936_0130951 3300035113 Bacteria 1078
165 Ga0373954_0017685 3300035118 Bacteria 3204
166 Ga0373946_0034185 3300035171 Bacteria 2051
167 Ga0373955_0435300 3300035172 Unclassified 799
168 Ga0373935_0000814 3300035692 Bacteria 16737
169 Ga0373927_0001500 3300035695 Bacteria 17573
170 Ga0373927_0010690 3300035695 Bacteria 6114
171 Ga0373933_0306490 3300035724 Bacteria 1029
172 Ga0373947_0003128 3300035725 Bacteria 9852
173 Ga0373947_0189499 3300035725 Bacteria 1341
174 Ga0373937_0019946 3300036401 Bacteria 6004
175 Ga0373937_0305228 3300036401 Unclassified 1505
176 Ga0373937_0316171 3300036401 Bacteria 1477
177 Ga0373925_0010778 3300037068 Bacteria 6627
178 Ga0436365_0146413 3300039437 Bacteria 6608
179 Ga0451577_0037642 3300042876 Bacteria 4354
180 Ga0451577_0631330 3300042876 Bacteria 972
181 Ga0453684_0190530 3300044712 Bacteria 2399
182 Ga0453684_1040192 3300044712 Bacteria 869
183 Ga0495592_0013890 3300046454 Bacteria 6120
184 Ga0495592_0049138 3300046454 Bacteria 3136
185 Ga0495592_0065833 3300046454 Bacteria 2652
186 Ga0495592_0169509 3300046454 Unclassified 1496
187 Ga0495592_0274768 3300046454 Unclassified 1104
188 Ga0495651_0000691 3300046462 Bacteria 26270
189 Ga0495651_0000739 3300046462 Bacteria 25269
190 Ga0495651_0002621 3300046462 Bacteria 13922
191 Ga0495653_0003151 3300046463 Bacteria 13227
192 Ga0495653_0058947 3300046463 Bacteria 2916
193 Ga0495580_0030789 3300046472 Bacteria 3882
194 Ga0495580_0060824 3300046472 Bacteria 2653
195 Ga0495582_0041673 3300046473 Bacteria 2530
196 Ga0495664_0016323 3300046477 Bacteria 4228
197 Ga0495664_0159358 3300046477 Bacteria 1369
198 Ga0495608_0005724 3300046511 Bacteria 8870
199 Ga0495608_0018711 3300046511 Bacteria 4774
200 Ga0495618_0020070 3300046514 Bacteria 4113
201 Ga0495618_0148485 3300046514 Bacteria 1498
202 Ga0495628_0005840 3300046516 Bacteria 10781
203 Ga0495628_0012661 3300046516 Bacteria 7105
204 Ga0495630_0003522 3300046517 Bacteria 10896
205 Ga0495630_0012123 3300046517 Bacteria 6249
206 Ga0495630_0018190 3300046517 Bacteria 5160
207 Ga0495630_0062959 3300046517 Bacteria 2787
208 Ga0495666_0024779 3300046526 Bacteria 2964
209 Ga0495666_0194922 3300046526 Bacteria 932
210 Ga0495652_0001149 3300046529 Bacteria 29800
211 Ga0495652_0094886 3300046529 Bacteria 2432
212 Ga0495665_0000933 3300046531 Bacteria 15422
213 Ga0495640_0077974 3300046533 Bacteria 2208
214 Ga0495586_0008648 3300046535 Bacteria 5420
215 Ga0495587_0002917 3300046536 Bacteria 11444
216 Ga0495587_0028445 3300046536 Bacteria 3399
217 Ga0495645_0010518 3300046543 Bacteria 6488
218 Ga0495645_0012246 3300046543 Bacteria 6040
219 Ga0495645_0019036 3300046543 Bacteria 4942
220 Ga0495645_0064228 3300046543 Bacteria 2657
221 Ga0495622_0075648 3300046557 Unclassified 1552
222 Ga0495667_0000777 3300046559 Bacteria 20490
223 Ga0495667_0005033 3300046559 Bacteria 8933
224 Ga0495667_0309303 3300046559 Bacteria 1001
225 Ga0495635_0006675 3300046663 Bacteria 8060
226 Ga0495657_0004072 3300046675 Bacteria 11720
227 Ga0495657_0006180 3300046675 Bacteria 9389
228 Ga0495657_0137899 3300046675 Bacteria 1522
229 Ga0495599_0005074 3300046678 Bacteria 7838
230 Ga0495599_0251938 3300046678 Unclassified 1074
231 Ga0495623_0003259 3300046679 Bacteria 10712
232 Ga0495646_0000354 3300046680 Bacteria 23670
233 Ga0495646_0066118 3300046680 Bacteria 2139
234 Ga0495613_0033334 3300046689 Bacteria 3828
235 Ga0495613_0047305 3300046689 Bacteria 3178
236 Ga0495613_0066933 3300046689 Bacteria 2622
237 Ga0495624_0001575 3300046690 Bacteria 17544
238 Ga0495624_0121604 3300046690 Bacteria 1603
239 Ga0495624_0306699 3300046690 Bacteria 957
240 Ga0495600_0002472 3300046809 Bacteria 10608
241 Ga0495600_0038900 3300046809 Bacteria 3097
242 Ga0495604_0000515 3300047317 Bacteria 33990
243 Ga0495604_0033263 3300047317 Bacteria 4082
244 Ga0495674_0018543 3300047319 Bacteria 6477
245 Ga0495674_0044059 3300047319 Bacteria 3968
246 Ga0495674_0089197 3300047319 Bacteria 2636
247 Ga0495674_0097497 3300047319 Unclassified 2504
248 Ga0495680_0000136 3300047322 Bacteria 73375
249 Ga0495680_0004203 3300047322 Bacteria 13823
250 Ga0495680_0066989 3300047322 Bacteria 2746
251 Ga0495675_0000186 3300047444 Bacteria 45392
252 Ga0495675_0006407 3300047444 Bacteria 7203
253 Ga0495675_0053812 3300047444 Bacteria 2555
254 Ga0495675_0356671 3300047444 Unclassified 859
255 Ga0495684_0048658 3300047471 Bacteria 3241
256 Ga0495593_0094007 3300047673 Unclassified 1542
257 Ga0495602_0022614 3300048088 Bacteria 6148
258 Ga0495602_0138450 3300048088 Bacteria 1930
259 Ga0495614_0002737 3300048089 Bacteria 7842
260 Ga0496100_0355754 3300048903 Bacteria 1107
261 Ga0496102_0060627 3300048905 Unclassified 3460
262 Ga0496103_0036555 3300048906 Bacteria 3008
263 Ga0496103_0144513 3300048906 Bacteria 1522
264 Ga0496104_0130493 3300048907 Unclassified 2414
265 Ga0496104_0223624 3300048907 Bacteria 1795
266 Ga0496105_0075184 3300048908 Bacteria 2790
267 Ga0496105_0375974 3300048908 Unclassified 1131
268 Ga0496106_0039724 3300048909 Bacteria 3524
269 Ga0496106_0156600 3300048909 Bacteria 1799
270 Ga0496106_0275486 3300048909 Bacteria 1347
271 Ga0496107_0083674 3300048910 Unclassified 2327
272 Ga0496107_0189107 3300048910 Bacteria 1529
273 Ga0496108_0019457 3300048911 Bacteria 5576
274 Ga0496108_0174666 3300048911 Bacteria 1859
275 Ga0496109_0131341 3300048912 Bacteria 2337
276 Ga0496109_0306253 3300048912 Bacteria 1498
277 Ga0496109_1110194 3300048912 Bacteria 728
278 Ga0496110_0143816 3300048913 Bacteria 2156
279 Ga0496110_0411831 3300048913 Bacteria 1232
280 Ga0496111_0319749 3300048914 Bacteria 1149
281 Ga0496111_0442407 3300048914 Bacteria 959
282 Ga0496112_0146420 3300048915 Bacteria 2330
283 Ga0496112_0189511 3300048915 Bacteria 2019
284 Ga0496112_0407679 3300048915 Bacteria 1299
285 Ga0496113_0141912 3300048916 Bacteria 1890
286 Ga0501040_0078811 3300049576 Bacteria 2280
287 Ga0501072_0308410 3300049588 Bacteria 1258
288 Ga0501075_0067274 3300049591 Bacteria 2705
289 Ga0501075_0167844 3300049591 Bacteria 1674
290 Ga0501075_0195134 3300049591 Bacteria 1544
291 Ga0501076_0048358 3300049592 Bacteria 3362
292 Ga0501076_0078177 3300049592 Bacteria 2655
293 Ga0501077_0005177 3300049593 Bacteria 7921
294 Ga0501079_0013624 3300049741 Bacteria 6201
295 Ga0501079_0146683 3300049741 Bacteria 1839
296 Ga0501083_0349160 3300049744 Bacteria 962
297 Ga0501045_0281781 3300049824 Bacteria 1237
298 nmdc:mga05p37_313534_c1 3300050507 Bacteria 1859
299 nmdc:mga0qj67_10889_c1 3300050509 Bacteria 6803
300 nmdc:mga0rr50_98748_c1 3300050513 Bacteria 2289
301 nmdc:mga08x19_125_c1 3300050514 Bacteria 67457
302 nmdc:mga08x19_537392_c1 3300050514 Bacteria 827
303 Ga0495601_0032368 3300053077 Bacteria 3255
304 Ga0495601_0150608 3300053077 Unclassified 1519
305 Ga0495612_0020138 3300053078 Bacteria 2673
306 Ga0495612_0049867 3300053078 Unclassified 1718
307 Ga0500644_0000446 3300053088 Bacteria 18927
308 Ga0500616_0125594 3300053153 Bacteria 1219
309 Ga0501084_0341374 3300054114 Bacteria 1265
310 Ga0501084_0686951 3300054114 Bacteria 863
311 Ga0501082_0055978 3300060353 Bacteria 3397
312 Ga0530510_0231282 3300061734 Bacteria 1375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_1110194 Ga0496109_1110194_67_672 183
2 3300036401 Ga0373937_0305228 Ga0373937_0305228_818_1444 188
3 3300006846 Ga0075430_100007614 Ga0075430_1000076143 193
4 3300050509 nmdc:mga0qj67_10889_c1 nmdc:mga0qj67_10889_c1_121_744 193
5 3300035083 Ga0373926_0122890 Ga0373926_0122890_310_930 195
6 3300025925 Ga0207650_10016193 Ga0207650_100161933 196
7 3300006028 Ga0070717_10058790 Ga0070717_100587903 197
8 3300007265 Ga0099794_10019574 Ga0099794_100195742 197
9 3300028800 Ga0265338_10069772 Ga0265338_100697722 197
10 3300035111 Ga0373923_0208091 Ga0373923_0208091_190_870 197
11 3300044712 Ga0453684_1040192 Ga0453684_1040192_25_663 197
12 3300046473 Ga0495582_0041673 Ga0495582_0041673_11_661 197
13 3300053088 Ga0500644_0000446 Ga0500644_0000446_1139_1777 197
14 3300009101 Ga0105247_10038748 Ga0105247_100387482 198
15 3300009148 Ga0105243_10762777 Ga0105243_107627772 198
16 3300009176 Ga0105242_10072884 Ga0105242_100728842 198
17 3300009177 Ga0105248_10001065 Ga0105248_100010655 198
18 3300013296 Ga0157374_10029364 Ga0157374_100293642 198
19 3300013306 Ga0163162_10051177 Ga0163162_100511775 198
20 3300013308 Ga0157375_10000907 Ga0157375_100009073 198
21 3300014325 Ga0163163_10020299 Ga0163163_100202992 198
22 3300014745 Ga0157377_10100699 Ga0157377_101006993 198
23 3300014968 Ga0157379_10000644 Ga0157379_100006445 198
24 3300005343 Ga0070687_100021453 Ga0070687_1000214533 202
25 3300005367 Ga0070667_100223399 Ga0070667_1002233993 202
26 3300005440 Ga0070705_100070143 Ga0070705_1000701432 202
27 3300005466 Ga0070685_10005168 Ga0070685_100051685 202
28 3300026121 Ga0207683_10180062 Ga0207683_101800622 202
29 3300005564 Ga0070664_100346152 Ga0070664_1003461521 203
30 3300025945 Ga0207679_10307501 Ga0207679_103075012 203
31 3300014745 Ga0157377_10140505 Ga0157377_101405051 204
32 3300005536 Ga0070697_100440697 Ga0070697_1004406971 205
33 3300025922 Ga0207646_10045077 Ga0207646_100450776 205
34 3300005467 Ga0070706_100675455 Ga0070706_1006754551 206
35 3300007076 Ga0075435_100098500 Ga0075435_1000985004 206
36 3300009147 Ga0114129_10118656 Ga0114129_101186563 206
37 3300025910 Ga0207684_10015379 Ga0207684_100153792 206
38 3300050507 nmdc:mga05p37_313534_c1 nmdc:mga05p37_313534_c1_896_1552 206
39 3300050513 nmdc:mga0rr50_98748_c1 nmdc:mga0rr50_98748_c1_1201_1857 206
40 3300050514 nmdc:mga08x19_537392_c1 nmdc:mga08x19_537392_c1_112_768 206
41 3300013308 Ga0157375_10178080 Ga0157375_101780804 208
42 3300025960 Ga0207651_10138136 Ga0207651_101381362 208
43 3300048915 Ga0496112_0407679 Ga0496112_0407679_613_1278 208
44 3300005444 Ga0070694_100174042 Ga0070694_1001740422 209
45 3300005467 Ga0070706_100329813 Ga0070706_1003298132 209
46 3300005549 Ga0070704_100015144 Ga0070704_1000151445 209
47 3300025922 Ga0207646_10577814 Ga0207646_105778141 209
48 3300005330 Ga0070690_100096151 Ga0070690_1000961512 210
49 3300005340 Ga0070689_100081544 Ga0070689_1000815442 210
50 3300005354 Ga0070675_100000395 Ga0070675_10000039523 210
51 3300005355 Ga0070671_100026926 Ga0070671_1000269265 210
52 3300005364 Ga0070673_100096165 Ga0070673_1000961652 210
53 3300005367 Ga0070667_100030892 Ga0070667_1000308922 210
54 3300005456 Ga0070678_100474884 Ga0070678_1004748842 210
55 3300005466 Ga0070685_10003815 Ga0070685_100038155 210
56 3300005564 Ga0070664_100312146 Ga0070664_1003121461 210
57 3300005618 Ga0068864_100287752 Ga0068864_1002877522 210
58 3300025960 Ga0207651_10071830 Ga0207651_100718302 210
59 3300005343 Ga0070687_100049282 Ga0070687_1000492821 211
60 3300005355 Ga0070671_100106236 Ga0070671_1001062362 211
61 3300005366 Ga0070659_100065739 Ga0070659_1000657394 211
62 3300005444 Ga0070694_100083371 Ga0070694_1000833712 211
63 3300005455 Ga0070663_100387436 Ga0070663_1003874362 211
64 3300005577 Ga0068857_100710082 Ga0068857_1007100821 211
65 3300005615 Ga0070702_100021310 Ga0070702_1000213102 211
66 3300005718 Ga0068866_10445426 Ga0068866_104454262 211
67 3300005719 Ga0068861_100246685 Ga0068861_1002466852 211
68 3300005842 Ga0068858_100063943 Ga0068858_1000639431 211
69 3300005843 Ga0068860_100429595 Ga0068860_1004295952 211
70 3300009094 Ga0111539_10684190 Ga0111539_106841902 211
71 3300009148 Ga0105243_10201341 Ga0105243_102013412 211
72 3300009553 Ga0105249_10404919 Ga0105249_104049192 211
73 3300013296 Ga0157374_10948094 Ga0157374_109480941 211
74 3300025908 Ga0207643_10075622 Ga0207643_100756224 211
75 3300025918 Ga0207662_10019715 Ga0207662_100197154 211
76 3300025931 Ga0207644_10050408 Ga0207644_100504084 211
77 3300025932 Ga0207690_10022462 Ga0207690_100224623 211
78 3300025937 Ga0207669_10048034 Ga0207669_100480342 211
79 3300025940 Ga0207691_10118714 Ga0207691_101187142 211
80 3300025961 Ga0207712_10255915 Ga0207712_102559152 211
81 3300025986 Ga0207658_10197266 Ga0207658_101972663 211
82 3300026035 Ga0207703_10025618 Ga0207703_100256186 211
83 3300026075 Ga0207708_10046102 Ga0207708_100461022 211
84 3300026095 Ga0207676_10100231 Ga0207676_101002313 211
85 3300026116 Ga0207674_10373911 Ga0207674_103739112 211
86 3300026118 Ga0207675_100209602 Ga0207675_1002096022 211
87 3300028380 Ga0268265_10072927 Ga0268265_100729271 211
88 3300028381 Ga0268264_10154195 Ga0268264_101541953 211
89 3300048906 Ga0496103_0144513 Ga0496103_0144513_344_1033 211
90 3300048908 Ga0496105_0075184 Ga0496105_0075184_304_993 211
91 3300048909 Ga0496106_0039724 Ga0496106_0039724_217_906 211
92 3300048909 Ga0496106_0275486 Ga0496106_0275486_107_796 211
93 3300048910 Ga0496107_0189107 Ga0496107_0189107_410_1099 211
94 3300048911 Ga0496108_0019457 Ga0496108_0019457_1572_2261 211
95 3300048911 Ga0496108_0174666 Ga0496108_0174666_320_1009 211
96 3300048912 Ga0496109_0131341 Ga0496109_0131341_500_1189 211
97 3300048912 Ga0496109_0306253 Ga0496109_0306253_440_1129 211
98 3300048913 Ga0496110_0143816 Ga0496110_0143816_535_1224 211
99 3300048913 Ga0496110_0411831 Ga0496110_0411831_530_1219 211
100 3300048914 Ga0496111_0319749 Ga0496111_0319749_104_793 211
101 3300048914 Ga0496111_0442407 Ga0496111_0442407_42_731 211
102 3300048915 Ga0496112_0146420 Ga0496112_0146420_214_903 211
103 3300048916 Ga0496113_0141912 Ga0496113_0141912_993_1682 211
104 3300006852 Ga0075433_10034759 Ga0075433_100347594 212
105 3300035086 Ga0373934_0036121 Ga0373934_0036121_1151_1837 212
106 3300035111 Ga0373923_0049092 Ga0373923_0049092_862_1548 212
107 3300035113 Ga0373936_0130951 Ga0373936_0130951_376_1062 212
108 3300035118 Ga0373954_0017685 Ga0373954_0017685_282_968 212
109 3300035692 Ga0373935_0000814 Ga0373935_0000814_15544_16230 212
110 3300035695 Ga0373927_0001500 Ga0373927_0001500_888_1574 212
111 3300035725 Ga0373947_0003128 Ga0373947_0003128_9079_9765 212
112 3300036401 Ga0373937_0019946 Ga0373937_0019946_32_718 212
113 3300046454 Ga0495592_0065833 Ga0495592_0065833_1177_1863 212
114 3300046462 Ga0495651_0000739 Ga0495651_0000739_4705_5391 212
115 3300046463 Ga0495653_0058947 Ga0495653_0058947_1050_1736 212
116 3300046472 Ga0495580_0030789 Ga0495580_0030789_2505_3191 212
117 3300046477 Ga0495664_0016323 Ga0495664_0016323_649_1335 212
118 3300046511 Ga0495608_0005724 Ga0495608_0005724_7468_8154 212
119 3300046514 Ga0495618_0148485 Ga0495618_0148485_32_718 212
120 3300046516 Ga0495628_0012661 Ga0495628_0012661_5147_5833 212
121 3300046517 Ga0495630_0012123 Ga0495630_0012123_287_973 212
122 3300046526 Ga0495666_0024779 Ga0495666_0024779_936_1622 212
123 3300046529 Ga0495652_0094886 Ga0495652_0094886_35_721 212
124 3300046531 Ga0495665_0000933 Ga0495665_0000933_12117_12803 212
125 3300046535 Ga0495586_0008648 Ga0495586_0008648_1064_1750 212
126 3300046536 Ga0495587_0028445 Ga0495587_0028445_486_1172 212
127 3300046543 Ga0495645_0019036 Ga0495645_0019036_1703_2389 212
128 3300046559 Ga0495667_0309303 Ga0495667_0309303_104_790 212
129 3300046663 Ga0495635_0006675 Ga0495635_0006675_2168_2854 212
130 3300046675 Ga0495657_0137899 Ga0495657_0137899_102_788 212
131 3300046679 Ga0495623_0003259 Ga0495623_0003259_9740_10426 212
132 3300046680 Ga0495646_0000354 Ga0495646_0000354_17807_18493 212
133 3300046690 Ga0495624_0001575 Ga0495624_0001575_16124_16810 212
134 3300047317 Ga0495604_0033263 Ga0495604_0033263_1622_2308 212
135 3300047444 Ga0495675_0053812 Ga0495675_0053812_1680_2366 212
136 3300047673 Ga0495593_0094007 Ga0495593_0094007_68_754 212
137 3300048089 Ga0495614_0002737 Ga0495614_0002737_1734_2420 212
138 3300053077 Ga0495601_0150608 Ga0495601_0150608_71_757 212
139 3300053078 Ga0495612_0020138 Ga0495612_0020138_1841_2527 212
140 3300053153 Ga0500616_0125594 Ga0500616_0125594_98_754 212
141 3300005445 Ga0070708_100378348 Ga0070708_1003783481 213
142 3300005468 Ga0070707_100000161 Ga0070707_10000016112 213
143 3300006914 Ga0075436_100002089 Ga0075436_10000208912 213
144 3300007076 Ga0075435_100011308 Ga0075435_1000113085 213
145 3300014968 Ga0157379_10459968 Ga0157379_104599682 213
146 3300027671 Ga0209588_1049870 Ga0209588_10498701 213
147 3300035171 Ga0373946_0034185 Ga0373946_0034185_1016_1711 213
148 3300035172 Ga0373955_0435300 Ga0373955_0435300_30_719 213
149 3300035695 Ga0373927_0010690 Ga0373927_0010690_1675_2370 213
150 3300035725 Ga0373947_0189499 Ga0373947_0189499_334_1029 213
151 3300037068 Ga0373925_0010778 Ga0373925_0010778_5306_6001 213
152 3300042876 Ga0451577_0037642 Ga0451577_0037642_3479_4219 213
153 3300044712 Ga0453684_0190530 Ga0453684_0190530_678_1418 213
154 3300046454 Ga0495592_0274768 Ga0495592_0274768_142_837 213
155 3300046462 Ga0495651_0000691 Ga0495651_0000691_16854_17543 213
156 3300046472 Ga0495580_0060824 Ga0495580_0060824_1174_1869 213
157 3300046477 Ga0495664_0159358 Ga0495664_0159358_444_1133 213
158 3300046517 Ga0495630_0018190 Ga0495630_0018190_995_1690 213
159 3300046526 Ga0495666_0194922 Ga0495666_0194922_135_830 213
160 3300046543 Ga0495645_0064228 Ga0495645_0064228_1769_2458 213
161 3300046557 Ga0495622_0075648 Ga0495622_0075648_597_1286 213
162 3300046559 Ga0495667_0005033 Ga0495667_0005033_4566_5255 213
163 3300046809 Ga0495600_0038900 Ga0495600_0038900_2304_2993 213
164 3300047319 Ga0495674_0097497 Ga0495674_0097497_483_1178 213
165 3300047322 Ga0495680_0000136 Ga0495680_0000136_62994_63683 213
166 3300047444 Ga0495675_0006407 Ga0495675_0006407_1543_2232 213
167 3300050514 nmdc:mga08x19_125_c1 nmdc:mga08x19_125_c1_27658_28413 213
168 3300005434 Ga0070709_10262221 Ga0070709_102622212 214
169 3300005434 Ga0070709_10432612 Ga0070709_104326121 214
170 3300005436 Ga0070713_100024085 Ga0070713_1000240852 214
171 3300005439 Ga0070711_100011019 Ga0070711_1000110191 214
172 3300005440 Ga0070705_100138717 Ga0070705_1001387171 214
173 3300005445 Ga0070708_100102600 Ga0070708_1001026002 214
174 3300005471 Ga0070698_100002089 Ga0070698_10000208912 214
175 3300005544 Ga0070686_100227781 Ga0070686_1002277811 214
176 3300005546 Ga0070696_100367292 Ga0070696_1003672921 214
177 3300005549 Ga0070704_100016941 Ga0070704_1000169415 214
178 3300005843 Ga0068860_100022745 Ga0068860_1000227452 214
179 3300009098 Ga0105245_10055087 Ga0105245_100550872 214
180 3300009176 Ga0105242_10123618 Ga0105242_101236182 214
181 3300009177 Ga0105248_10150387 Ga0105248_101503872 214
182 3300009545 Ga0105237_10030508 Ga0105237_100305087 214
183 3300010375 Ga0105239_10046155 Ga0105239_100461554 214
184 3300013296 Ga0157374_10157801 Ga0157374_101578012 214
185 3300013297 Ga0157378_10001669 Ga0157378_1000166910 214
186 3300013297 Ga0157378_10054266 Ga0157378_100542664 214
187 3300013306 Ga0163162_10630875 Ga0163162_106308752 214
188 3300013307 Ga0157372_10148525 Ga0157372_101485252 214
189 3300025906 Ga0207699_10366884 Ga0207699_103668842 214
190 3300025914 Ga0207671_10114216 Ga0207671_101142162 214
191 3300025916 Ga0207663_10004082 Ga0207663_1000408210 214
192 3300025928 Ga0207700_10147394 Ga0207700_101473942 214
193 3300025929 Ga0207664_10106379 Ga0207664_101063792 214
194 3300025942 Ga0207689_10101303 Ga0207689_101013032 214
195 3300027671 Ga0209588_1022173 Ga0209588_10221732 214
196 3300028381 Ga0268264_10052104 Ga0268264_100521042 214
197 3300028800 Ga0265338_10054563 Ga0265338_100545632 214
198 3300030879 Ga0265765_1004022 Ga0265765_10040222 214
199 3300031241 Ga0265325_10011158 Ga0265325_100111585 214
200 3300031241 Ga0265325_10019341 Ga0265325_100193412 214
201 3300031250 Ga0265331_10002970 Ga0265331_100029702 214
202 3300031344 Ga0265316_10005664 Ga0265316_100056643 214
203 3300035724 Ga0373933_0306490 Ga0373933_0306490_216_908 214
204 3300039437 Ga0436365_0146413 Ga0436365_0146413_421_1122 214
205 3300042876 Ga0451577_0631330 Ga0451577_0631330_106_813 214
206 3300046454 Ga0495592_0013890 Ga0495592_0013890_2407_3099 214
207 3300046454 Ga0495592_0049138 Ga0495592_0049138_2405_3100 214
208 3300046454 Ga0495592_0169509 Ga0495592_0169509_306_1007 214
209 3300046462 Ga0495651_0002621 Ga0495651_0002621_11609_12301 214
210 3300046463 Ga0495653_0003151 Ga0495653_0003151_11500_12192 214
211 3300046511 Ga0495608_0018711 Ga0495608_0018711_125_817 214
212 3300046514 Ga0495618_0020070 Ga0495618_0020070_2234_2926 214
213 3300046516 Ga0495628_0005840 Ga0495628_0005840_2129_2821 214
214 3300046517 Ga0495630_0003522 Ga0495630_0003522_136_834 214
215 3300046517 Ga0495630_0062959 Ga0495630_0062959_480_1172 214
216 3300046529 Ga0495652_0001149 Ga0495652_0001149_13541_14233 214
217 3300046533 Ga0495640_0077974 Ga0495640_0077974_955_1647 214
218 3300046536 Ga0495587_0002917 Ga0495587_0002917_4453_5145 214
219 3300046543 Ga0495645_0010518 Ga0495645_0010518_1610_2302 214
220 3300046543 Ga0495645_0012246 Ga0495645_0012246_2387_3088 214
221 3300046559 Ga0495667_0000777 Ga0495667_0000777_10800_11492 214
222 3300046675 Ga0495657_0004072 Ga0495657_0004072_8257_8949 214
223 3300046675 Ga0495657_0006180 Ga0495657_0006180_4129_4824 214
224 3300046678 Ga0495599_0005074 Ga0495599_0005074_4409_5101 214
225 3300046678 Ga0495599_0251938 Ga0495599_0251938_71_772 214
226 3300046680 Ga0495646_0066118 Ga0495646_0066118_892_1587 214
227 3300046689 Ga0495613_0033334 Ga0495613_0033334_1283_1963 214
228 3300046689 Ga0495613_0066933 Ga0495613_0066933_230_925 214
229 3300046690 Ga0495624_0121604 Ga0495624_0121604_766_1446 214
230 3300046690 Ga0495624_0306699 Ga0495624_0306699_121_813 214
231 3300046809 Ga0495600_0002472 Ga0495600_0002472_2924_3616 214
232 3300047317 Ga0495604_0000515 Ga0495604_0000515_6892_7584 214
233 3300047319 Ga0495674_0018543 Ga0495674_0018543_3090_3791 214
234 3300047319 Ga0495674_0044059 Ga0495674_0044059_963_1655 214
235 3300047319 Ga0495674_0089197 Ga0495674_0089197_567_1265 214
236 3300047322 Ga0495680_0004203 Ga0495680_0004203_12756_13448 214
237 3300047322 Ga0495680_0066989 Ga0495680_0066989_468_1163 214
238 3300047444 Ga0495675_0000186 Ga0495675_0000186_2119_2811 214
239 3300047444 Ga0495675_0356671 Ga0495675_0356671_44_739 214
240 3300047471 Ga0495684_0048658 Ga0495684_0048658_1528_2223 214
241 3300048088 Ga0495602_0022614 Ga0495602_0022614_3043_3735 214
242 3300048088 Ga0495602_0138450 Ga0495602_0138450_115_810 214
243 3300048903 Ga0496100_0355754 Ga0496100_0355754_221_931 214
244 3300048905 Ga0496102_0060627 Ga0496102_0060627_1281_1991 214
245 3300048906 Ga0496103_0036555 Ga0496103_0036555_581_1291 214
246 3300048907 Ga0496104_0130493 Ga0496104_0130493_608_1309 214
247 3300048908 Ga0496105_0375974 Ga0496105_0375974_218_919 214
248 3300048909 Ga0496106_0156600 Ga0496106_0156600_90_800 214
249 3300048910 Ga0496107_0083674 Ga0496107_0083674_340_1050 214
250 3300048915 Ga0496112_0189511 Ga0496112_0189511_1072_1782 214
251 3300053077 Ga0495601_0032368 Ga0495601_0032368_2366_3067 214
252 3300053078 Ga0495612_0049867 Ga0495612_0049867_922_1623 214
253 3300005434 Ga0070709_10006953 Ga0070709_100069533 215
254 3300005436 Ga0070713_100003098 Ga0070713_1000030988 215
255 3300005440 Ga0070705_100035218 Ga0070705_1000352182 215
256 3300005545 Ga0070695_100062670 Ga0070695_1000626703 215
257 3300005549 Ga0070704_100033226 Ga0070704_1000332262 215
258 3300006173 Ga0070716_100001625 Ga0070716_1000016253 215
259 3300006175 Ga0070712_100031130 Ga0070712_1000311302 215
260 3300007788 Ga0099795_10002193 Ga0099795_100021931 215
261 3300025905 Ga0207685_10052835 Ga0207685_100528351 215
262 3300025906 Ga0207699_10003490 Ga0207699_100034905 215
263 3300025928 Ga0207700_10002305 Ga0207700_100023058 215
264 3300025939 Ga0207665_10000649 Ga0207665_100006496 215
265 3300036401 Ga0373937_0316171 Ga0373937_0316171_52_765 215
266 3300046689 Ga0495613_0047305 Ga0495613_0047305_2340_3068 215
267 3300048907 Ga0496104_0223624 Ga0496104_0223624_330_1064 215
268 3300049576 Ga0501040_0078811 Ga0501040_0078811_654_1358 215
269 3300049588 Ga0501072_0308410 Ga0501072_0308410_330_1034 215
270 3300049591 Ga0501075_0067274 Ga0501075_0067274_1591_2295 215
271 3300049591 Ga0501075_0167844 Ga0501075_0167844_64_744 215
272 3300049591 Ga0501075_0195134 Ga0501075_0195134_422_1102 215
273 3300049592 Ga0501076_0048358 Ga0501076_0048358_2486_3190 215
274 3300049592 Ga0501076_0078177 Ga0501076_0078177_1326_2006 215
275 3300049593 Ga0501077_0005177 Ga0501077_0005177_5527_6207 215
276 3300049741 Ga0501079_0013624 Ga0501079_0013624_164_868 215
277 3300049741 Ga0501079_0146683 Ga0501079_0146683_251_931 215
278 3300049744 Ga0501083_0349160 Ga0501083_0349160_234_914 215
279 3300049824 Ga0501045_0281781 Ga0501045_0281781_119_823 215
280 3300054114 Ga0501084_0341374 Ga0501084_0341374_422_1126 215
281 3300054114 Ga0501084_0686951 Ga0501084_0686951_154_834 215
282 3300060353 Ga0501082_0055978 Ga0501082_0055978_1193_1897 215
283 3300061734 Ga0530510_0231282 Ga0530510_0231282_660_1364 215
284 3300005471 Ga0070698_100088879 Ga0070698_1000888791 216
285 3300005546 Ga0070696_100050670 Ga0070696_1000506702 216
286 3300009147 Ga0114129_10911569 Ga0114129_109115692 216
287 3300013297 Ga0157378_10107144 Ga0157378_101071443 216
288 3300024225 Ga0224572_1017055 Ga0224572_10170552 216
289 3300024227 Ga0228598_1000474 Ga0228598_10004745 216
290 3300026089 Ga0207648_10290007 Ga0207648_102900073 216
291 3300031090 Ga0265760_10031164 Ga0265760_100311642 216
292 3300031344 Ga0265316_10098044 Ga0265316_100980444 216
293 3300031711 Ga0265314_10070235 Ga0265314_100702352 216
294 3300005434 Ga0070709_10029533 Ga0070709_100295332 217
295 3300005834 Ga0068851_10178345 Ga0068851_101783452 217
296 3300005840 Ga0068870_10047668 Ga0068870_100476682 217
297 3300007265 Ga0099794_10001821 Ga0099794_100018214 217
298 3300009093 Ga0105240_10142763 Ga0105240_101427632 217
299 3300025929 Ga0207664_10276095 Ga0207664_102760952 217
300 3300031090 Ga0265760_10000023 Ga0265760_1000002354 217
301 3300006038 Ga0075365_10219764 Ga0075365_102197642 218
302 3300009093 Ga0105240_10037391 Ga0105240_100373913 218
303 3300013104 Ga0157370_10103446 Ga0157370_101034463 218
304 3300013297 Ga0157378_10272350 Ga0157378_102723502 218
305 3300005338 Ga0068868_100266775 Ga0068868_1002667752 219
306 3300005459 Ga0068867_100323936 Ga0068867_1003239362 219
307 3300025942 Ga0207689_10278996 Ga0207689_102789962 219
308 3300013308 Ga0157375_11006504 Ga0157375_110065041 220
309 3300005435 Ga0070714_100030690 Ga0070714_1000306902 221
310 3300025929 Ga0207664_10025070 Ga0207664_100250705 221
311 3300000041 ARcpr5oldR_c005076 ARcpr5oldR_0050762 224
312 3300000043 ARcpr5yngRDRAFT_c005611 ARcpr5yngRDRAFT_0056111 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

49

249

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9389 5 222
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9306 5 222
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7854 7 217
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7716 4 216
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7573 4 216
ID Description Score Start End Superfamily
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9588 8 222 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9435 8 222 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9292 8 222 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9226 8 222 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7721 4 216 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A836BL72-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9942 7 218 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A835X0W2-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9939 62 218 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A3N5E919-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9902 7 162 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A2V7JLX1-F1-model_v4 Uracil-DNA glycosylase 0.9894 6 147 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A350UJL0-F1-model_v4 Type-5 uracil-DNA glycosylase 0.989 5 157 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
92.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map