F401587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 193 | 312 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100378348|Ga0070708_1003783481 |
| Length | 254 |
| Sequence | MTTLQQLAVLNEEIISCQKCLRLARYRERIARTKRRAYRDWTYWGRPVPGFGDPQAELLIIGLAPAAHGANRTGRMFTGDRSGDFLHRLLHRVGLANQPTSTHRGDGLALHNAYISATLRCAPPHNKPLPGETRNCLPYLEAELDLIRPRAVLALGRIAFDAYLKLLLKRGAIATRSGYKFSHGASYQLSSALSTQSSRAHPGYAEATGAGQLQTRLPHLFASYHPSQQNTQTGRLTPAMFLRVLRQIRRFLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 72 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 73 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.96 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 90.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c005076 | 3300000041 | Archaea | 1134 |
| 2 | ARcpr5yngRDRAFT_c005611 | 3300000043 | Archaea | 1153 |
| 3 | Ga0070690_100096151 | 3300005330 | Bacteria | 1957 |
| 4 | Ga0068868_100266775 | 3300005338 | Bacteria | 1445 |
| 5 | Ga0070689_100081544 | 3300005340 | Bacteria | 2540 |
| 6 | Ga0070687_100021453 | 3300005343 | Bacteria | 3036 |
| 7 | Ga0070687_100049282 | 3300005343 | Bacteria | 2170 |
| 8 | Ga0070675_100000395 | 3300005354 | Bacteria | 29588 |
| 9 | Ga0070671_100026926 | 3300005355 | Bacteria | 4730 |
| 10 | Ga0070671_100106236 | 3300005355 | Bacteria | 2357 |
| 11 | Ga0070673_100096165 | 3300005364 | Bacteria | 2430 |
| 12 | Ga0070659_100065739 | 3300005366 | Bacteria | 2872 |
| 13 | Ga0070667_100030892 | 3300005367 | Bacteria | 4467 |
| 14 | Ga0070667_100223399 | 3300005367 | Unclassified | 1677 |
| 15 | Ga0070709_10006953 | 3300005434 | Bacteria | 6177 |
| 16 | Ga0070709_10029533 | 3300005434 | Unclassified | 3280 |
| 17 | Ga0070709_10262221 | 3300005434 | Bacteria | 1249 |
| 18 | Ga0070709_10432612 | 3300005434 | Unclassified | 988 |
| 19 | Ga0070714_100030690 | 3300005435 | Bacteria | 4476 |
| 20 | Ga0070713_100003098 | 3300005436 | Bacteria | 10936 |
| 21 | Ga0070713_100024085 | 3300005436 | Viruses | 4736 |
| 22 | Ga0070711_100011019 | 3300005439 | Bacteria | 5608 |
| 23 | Ga0070705_100035218 | 3300005440 | Bacteria | 2805 |
| 24 | Ga0070705_100070143 | 3300005440 | Unclassified | 2116 |
| 25 | Ga0070705_100138717 | 3300005440 | Bacteria | 1597 |
| 26 | Ga0070694_100083371 | 3300005444 | Bacteria | 2228 |
| 27 | Ga0070694_100174042 | 3300005444 | Bacteria | 1588 |
| 28 | Ga0070708_100102600 | 3300005445 | Unclassified | 2621 |
| 29 | Ga0070708_100378348 | 3300005445 | Bacteria | 1335 |
| 30 | Ga0070663_100387436 | 3300005455 | Bacteria | 1139 |
| 31 | Ga0070678_100474884 | 3300005456 | Bacteria | 1099 |
| 32 | Ga0068867_100323936 | 3300005459 | Bacteria | 1278 |
| 33 | Ga0070685_10003815 | 3300005466 | Bacteria | 7625 |
| 34 | Ga0070685_10005168 | 3300005466 | Bacteria | 6618 |
| 35 | Ga0070706_100329813 | 3300005467 | Bacteria | 1423 |
| 36 | Ga0070706_100675455 | 3300005467 | Bacteria | 958 |
| 37 | Ga0070707_100000161 | 3300005468 | Bacteria | 63936 |
| 38 | Ga0070698_100002089 | 3300005471 | Bacteria | 22175 |
| 39 | Ga0070698_100088879 | 3300005471 | Bacteria | 3074 |
| 40 | Ga0070697_100440697 | 3300005536 | Bacteria | 1134 |
| 41 | Ga0070686_100227781 | 3300005544 | Bacteria | 1350 |
| 42 | Ga0070695_100062670 | 3300005545 | Bacteria | 2415 |
| 43 | Ga0070696_100050670 | 3300005546 | Bacteria | 2886 |
| 44 | Ga0070696_100367292 | 3300005546 | Bacteria | 1118 |
| 45 | Ga0070704_100015144 | 3300005549 | Bacteria | 4836 |
| 46 | Ga0070704_100016941 | 3300005549 | Bacteria | 4620 |
| 47 | Ga0070704_100033226 | 3300005549 | Bacteria | 3486 |
| 48 | Ga0070664_100312146 | 3300005564 | Unclassified | 1423 |
| 49 | Ga0070664_100346152 | 3300005564 | Bacteria | 1351 |
| 50 | Ga0068857_100710082 | 3300005577 | Bacteria | 956 |
| 51 | Ga0070702_100021310 | 3300005615 | Bacteria | 3408 |
| 52 | Ga0068864_100287752 | 3300005618 | Bacteria | 1535 |
| 53 | Ga0068866_10445426 | 3300005718 | Bacteria | 846 |
| 54 | Ga0068861_100246685 | 3300005719 | Bacteria | 1521 |
| 55 | Ga0068851_10178345 | 3300005834 | Bacteria | 1176 |
| 56 | Ga0068870_10047668 | 3300005840 | Bacteria | 2253 |
| 57 | Ga0068858_100063943 | 3300005842 | Bacteria | 3404 |
| 58 | Ga0068860_100022745 | 3300005843 | Bacteria | 6061 |
| 59 | Ga0068860_100429595 | 3300005843 | Bacteria | 1310 |
| 60 | Ga0070717_10058790 | 3300006028 | Archaea | 3179 |
| 61 | Ga0075365_10219764 | 3300006038 | Bacteria | 1333 |
| 62 | Ga0070716_100001625 | 3300006173 | Bacteria | 10133 |
| 63 | Ga0070712_100031130 | 3300006175 | Unclassified | 3592 |
| 64 | Ga0075430_100007614 | 3300006846 | Bacteria | 9148 |
| 65 | Ga0075433_10034759 | 3300006852 | Bacteria | 4331 |
| 66 | Ga0075436_100002089 | 3300006914 | Bacteria | 13788 |
| 67 | Ga0075435_100011308 | 3300007076 | Bacteria | 6560 |
| 68 | Ga0075435_100098500 | 3300007076 | Bacteria | 2421 |
| 69 | Ga0099794_10001821 | 3300007265 | Bacteria | 7607 |
| 70 | Ga0099794_10019574 | 3300007265 | Bacteria | 3053 |
| 71 | Ga0099795_10002193 | 3300007788 | Bacteria | 4517 |
| 72 | Ga0105240_10037391 | 3300009093 | Bacteria | 6240 |
| 73 | Ga0105240_10142763 | 3300009093 | Bacteria | 2861 |
| 74 | Ga0111539_10684190 | 3300009094 | Bacteria | 1194 |
| 75 | Ga0105245_10055087 | 3300009098 | Bacteria | 3571 |
| 76 | Ga0105247_10038748 | 3300009101 | Bacteria | 2911 |
| 77 | Ga0114129_10118656 | 3300009147 | Bacteria | 3644 |
| 78 | Ga0114129_10911569 | 3300009147 | Bacteria | 1113 |
| 79 | Ga0105243_10201341 | 3300009148 | Bacteria | 1746 |
| 80 | Ga0105243_10762777 | 3300009148 | Bacteria | 950 |
| 81 | Ga0105242_10072884 | 3300009176 | Bacteria | 2854 |
| 82 | Ga0105242_10123618 | 3300009176 | Unclassified | 2225 |
| 83 | Ga0105248_10001065 | 3300009177 | Bacteria | 30355 |
| 84 | Ga0105248_10150387 | 3300009177 | Unclassified | 2627 |
| 85 | Ga0105237_10030508 | 3300009545 | Bacteria | 5474 |
| 86 | Ga0105249_10404919 | 3300009553 | Bacteria | 1395 |
| 87 | Ga0105239_10046155 | 3300010375 | Bacteria | 4773 |
| 88 | Ga0157370_10103446 | 3300013104 | Bacteria | 2666 |
| 89 | Ga0157374_10029364 | 3300013296 | Bacteria | 4978 |
| 90 | Ga0157374_10157801 | 3300013296 | Bacteria | 2209 |
| 91 | Ga0157374_10948094 | 3300013296 | Bacteria | 879 |
| 92 | Ga0157378_10001669 | 3300013297 | Bacteria | 20038 |
| 93 | Ga0157378_10054266 | 3300013297 | Bacteria | 3568 |
| 94 | Ga0157378_10107144 | 3300013297 | Bacteria | 2557 |
| 95 | Ga0157378_10272350 | 3300013297 | Bacteria | 1629 |
| 96 | Ga0163162_10051177 | 3300013306 | Bacteria | 4143 |
| 97 | Ga0163162_10630875 | 3300013306 | Bacteria | 1196 |
| 98 | Ga0157372_10148525 | 3300013307 | Unclassified | 2704 |
| 99 | Ga0157375_10000907 | 3300013308 | Bacteria | 25747 |
| 100 | Ga0157375_10178080 | 3300013308 | Bacteria | 2277 |
| 101 | Ga0157375_11006504 | 3300013308 | Bacteria | 973 |
| 102 | Ga0163163_10020299 | 3300014325 | Bacteria | 6254 |
| 103 | Ga0157377_10100699 | 3300014745 | Bacteria | 1721 |
| 104 | Ga0157377_10140505 | 3300014745 | Unclassified | 1484 |
| 105 | Ga0157379_10000644 | 3300014968 | Bacteria | 28159 |
| 106 | Ga0157379_10459968 | 3300014968 | Bacteria | 1176 |
| 107 | Ga0224572_1017055 | 3300024225 | Unclassified | 1393 |
| 108 | Ga0228598_1000474 | 3300024227 | Bacteria | 8213 |
| 109 | Ga0207685_10052835 | 3300025905 | Bacteria | 1575 |
| 110 | Ga0207699_10003490 | 3300025906 | Bacteria | 7504 |
| 111 | Ga0207699_10366884 | 3300025906 | Unclassified | 1019 |
| 112 | Ga0207643_10075622 | 3300025908 | Bacteria | 1944 |
| 113 | Ga0207684_10015379 | 3300025910 | Bacteria | 6587 |
| 114 | Ga0207671_10114216 | 3300025914 | Unclassified | 2058 |
| 115 | Ga0207663_10004082 | 3300025916 | Bacteria | 7240 |
| 116 | Ga0207662_10019715 | 3300025918 | Bacteria | 3842 |
| 117 | Ga0207646_10045077 | 3300025922 | Bacteria | 3958 |
| 118 | Ga0207646_10577814 | 3300025922 | Bacteria | 1009 |
| 119 | Ga0207650_10016193 | 3300025925 | Bacteria | 5206 |
| 120 | Ga0207700_10002305 | 3300025928 | Bacteria | 10953 |
| 121 | Ga0207700_10147394 | 3300025928 | Viruses | 1941 |
| 122 | Ga0207664_10025070 | 3300025929 | Bacteria | 4486 |
| 123 | Ga0207664_10106379 | 3300025929 | Unclassified | 2326 |
| 124 | Ga0207664_10276095 | 3300025929 | Unclassified | 1473 |
| 125 | Ga0207644_10050408 | 3300025931 | Bacteria | 2984 |
| 126 | Ga0207690_10022462 | 3300025932 | Bacteria | 3926 |
| 127 | Ga0207669_10048034 | 3300025937 | Bacteria | 2533 |
| 128 | Ga0207665_10000649 | 3300025939 | Bacteria | 23368 |
| 129 | Ga0207691_10118714 | 3300025940 | Bacteria | 2346 |
| 130 | Ga0207689_10101303 | 3300025942 | Bacteria | 2366 |
| 131 | Ga0207689_10278996 | 3300025942 | Bacteria | 1384 |
| 132 | Ga0207679_10307501 | 3300025945 | Bacteria | 1368 |
| 133 | Ga0207651_10071830 | 3300025960 | Bacteria | 2455 |
| 134 | Ga0207651_10138136 | 3300025960 | Bacteria | 1878 |
| 135 | Ga0207712_10255915 | 3300025961 | Bacteria | 1417 |
| 136 | Ga0207658_10197266 | 3300025986 | Bacteria | 1678 |
| 137 | Ga0207703_10025618 | 3300026035 | Bacteria | 4640 |
| 138 | Ga0207708_10046102 | 3300026075 | Bacteria | 3321 |
| 139 | Ga0207648_10290007 | 3300026089 | Bacteria | 1465 |
| 140 | Ga0207676_10100231 | 3300026095 | Bacteria | 2399 |
| 141 | Ga0207674_10373911 | 3300026116 | Bacteria | 1377 |
| 142 | Ga0207675_100209602 | 3300026118 | Bacteria | 1874 |
| 143 | Ga0207683_10180062 | 3300026121 | Bacteria | 1916 |
| 144 | Ga0209588_1022173 | 3300027671 | Bacteria | 1998 |
| 145 | Ga0209588_1049870 | 3300027671 | Unclassified | 1355 |
| 146 | Ga0268265_10072927 | 3300028380 | Bacteria | 2679 |
| 147 | Ga0268264_10052104 | 3300028381 | Bacteria | 3412 |
| 148 | Ga0268264_10154195 | 3300028381 | Bacteria | 2063 |
| 149 | Ga0265338_10054563 | 3300028800 | Bacteria | 3562 |
| 150 | Ga0265338_10069772 | 3300028800 | Bacteria | 3017 |
| 151 | Ga0265765_1004022 | 3300030879 | Unclassified | 1497 |
| 152 | Ga0265760_10000023 | 3300031090 | Bacteria | 67653 |
| 153 | Ga0265760_10031164 | 3300031090 | Unclassified | 1572 |
| 154 | Ga0265325_10011158 | 3300031241 | Bacteria | 5171 |
| 155 | Ga0265325_10019341 | 3300031241 | Bacteria | 3766 |
| 156 | Ga0265331_10002970 | 3300031250 | Bacteria | 11159 |
| 157 | Ga0265316_10005664 | 3300031344 | Bacteria | 12090 |
| 158 | Ga0265316_10098044 | 3300031344 | Bacteria | 2230 |
| 159 | Ga0265314_10070235 | 3300031711 | Unclassified | 2347 |
| 160 | Ga0373926_0122890 | 3300035083 | Bacteria | 979 |
| 161 | Ga0373934_0036121 | 3300035086 | Bacteria | 1946 |
| 162 | Ga0373923_0049092 | 3300035111 | Bacteria | 1764 |
| 163 | Ga0373923_0208091 | 3300035111 | Bacteria | 906 |
| 164 | Ga0373936_0130951 | 3300035113 | Bacteria | 1078 |
| 165 | Ga0373954_0017685 | 3300035118 | Bacteria | 3204 |
| 166 | Ga0373946_0034185 | 3300035171 | Bacteria | 2051 |
| 167 | Ga0373955_0435300 | 3300035172 | Unclassified | 799 |
| 168 | Ga0373935_0000814 | 3300035692 | Bacteria | 16737 |
| 169 | Ga0373927_0001500 | 3300035695 | Bacteria | 17573 |
| 170 | Ga0373927_0010690 | 3300035695 | Bacteria | 6114 |
| 171 | Ga0373933_0306490 | 3300035724 | Bacteria | 1029 |
| 172 | Ga0373947_0003128 | 3300035725 | Bacteria | 9852 |
| 173 | Ga0373947_0189499 | 3300035725 | Bacteria | 1341 |
| 174 | Ga0373937_0019946 | 3300036401 | Bacteria | 6004 |
| 175 | Ga0373937_0305228 | 3300036401 | Unclassified | 1505 |
| 176 | Ga0373937_0316171 | 3300036401 | Bacteria | 1477 |
| 177 | Ga0373925_0010778 | 3300037068 | Bacteria | 6627 |
| 178 | Ga0436365_0146413 | 3300039437 | Bacteria | 6608 |
| 179 | Ga0451577_0037642 | 3300042876 | Bacteria | 4354 |
| 180 | Ga0451577_0631330 | 3300042876 | Bacteria | 972 |
| 181 | Ga0453684_0190530 | 3300044712 | Bacteria | 2399 |
| 182 | Ga0453684_1040192 | 3300044712 | Bacteria | 869 |
| 183 | Ga0495592_0013890 | 3300046454 | Bacteria | 6120 |
| 184 | Ga0495592_0049138 | 3300046454 | Bacteria | 3136 |
| 185 | Ga0495592_0065833 | 3300046454 | Bacteria | 2652 |
| 186 | Ga0495592_0169509 | 3300046454 | Unclassified | 1496 |
| 187 | Ga0495592_0274768 | 3300046454 | Unclassified | 1104 |
| 188 | Ga0495651_0000691 | 3300046462 | Bacteria | 26270 |
| 189 | Ga0495651_0000739 | 3300046462 | Bacteria | 25269 |
| 190 | Ga0495651_0002621 | 3300046462 | Bacteria | 13922 |
| 191 | Ga0495653_0003151 | 3300046463 | Bacteria | 13227 |
| 192 | Ga0495653_0058947 | 3300046463 | Bacteria | 2916 |
| 193 | Ga0495580_0030789 | 3300046472 | Bacteria | 3882 |
| 194 | Ga0495580_0060824 | 3300046472 | Bacteria | 2653 |
| 195 | Ga0495582_0041673 | 3300046473 | Bacteria | 2530 |
| 196 | Ga0495664_0016323 | 3300046477 | Bacteria | 4228 |
| 197 | Ga0495664_0159358 | 3300046477 | Bacteria | 1369 |
| 198 | Ga0495608_0005724 | 3300046511 | Bacteria | 8870 |
| 199 | Ga0495608_0018711 | 3300046511 | Bacteria | 4774 |
| 200 | Ga0495618_0020070 | 3300046514 | Bacteria | 4113 |
| 201 | Ga0495618_0148485 | 3300046514 | Bacteria | 1498 |
| 202 | Ga0495628_0005840 | 3300046516 | Bacteria | 10781 |
| 203 | Ga0495628_0012661 | 3300046516 | Bacteria | 7105 |
| 204 | Ga0495630_0003522 | 3300046517 | Bacteria | 10896 |
| 205 | Ga0495630_0012123 | 3300046517 | Bacteria | 6249 |
| 206 | Ga0495630_0018190 | 3300046517 | Bacteria | 5160 |
| 207 | Ga0495630_0062959 | 3300046517 | Bacteria | 2787 |
| 208 | Ga0495666_0024779 | 3300046526 | Bacteria | 2964 |
| 209 | Ga0495666_0194922 | 3300046526 | Bacteria | 932 |
| 210 | Ga0495652_0001149 | 3300046529 | Bacteria | 29800 |
| 211 | Ga0495652_0094886 | 3300046529 | Bacteria | 2432 |
| 212 | Ga0495665_0000933 | 3300046531 | Bacteria | 15422 |
| 213 | Ga0495640_0077974 | 3300046533 | Bacteria | 2208 |
| 214 | Ga0495586_0008648 | 3300046535 | Bacteria | 5420 |
| 215 | Ga0495587_0002917 | 3300046536 | Bacteria | 11444 |
| 216 | Ga0495587_0028445 | 3300046536 | Bacteria | 3399 |
| 217 | Ga0495645_0010518 | 3300046543 | Bacteria | 6488 |
| 218 | Ga0495645_0012246 | 3300046543 | Bacteria | 6040 |
| 219 | Ga0495645_0019036 | 3300046543 | Bacteria | 4942 |
| 220 | Ga0495645_0064228 | 3300046543 | Bacteria | 2657 |
| 221 | Ga0495622_0075648 | 3300046557 | Unclassified | 1552 |
| 222 | Ga0495667_0000777 | 3300046559 | Bacteria | 20490 |
| 223 | Ga0495667_0005033 | 3300046559 | Bacteria | 8933 |
| 224 | Ga0495667_0309303 | 3300046559 | Bacteria | 1001 |
| 225 | Ga0495635_0006675 | 3300046663 | Bacteria | 8060 |
| 226 | Ga0495657_0004072 | 3300046675 | Bacteria | 11720 |
| 227 | Ga0495657_0006180 | 3300046675 | Bacteria | 9389 |
| 228 | Ga0495657_0137899 | 3300046675 | Bacteria | 1522 |
| 229 | Ga0495599_0005074 | 3300046678 | Bacteria | 7838 |
| 230 | Ga0495599_0251938 | 3300046678 | Unclassified | 1074 |
| 231 | Ga0495623_0003259 | 3300046679 | Bacteria | 10712 |
| 232 | Ga0495646_0000354 | 3300046680 | Bacteria | 23670 |
| 233 | Ga0495646_0066118 | 3300046680 | Bacteria | 2139 |
| 234 | Ga0495613_0033334 | 3300046689 | Bacteria | 3828 |
| 235 | Ga0495613_0047305 | 3300046689 | Bacteria | 3178 |
| 236 | Ga0495613_0066933 | 3300046689 | Bacteria | 2622 |
| 237 | Ga0495624_0001575 | 3300046690 | Bacteria | 17544 |
| 238 | Ga0495624_0121604 | 3300046690 | Bacteria | 1603 |
| 239 | Ga0495624_0306699 | 3300046690 | Bacteria | 957 |
| 240 | Ga0495600_0002472 | 3300046809 | Bacteria | 10608 |
| 241 | Ga0495600_0038900 | 3300046809 | Bacteria | 3097 |
| 242 | Ga0495604_0000515 | 3300047317 | Bacteria | 33990 |
| 243 | Ga0495604_0033263 | 3300047317 | Bacteria | 4082 |
| 244 | Ga0495674_0018543 | 3300047319 | Bacteria | 6477 |
| 245 | Ga0495674_0044059 | 3300047319 | Bacteria | 3968 |
| 246 | Ga0495674_0089197 | 3300047319 | Bacteria | 2636 |
| 247 | Ga0495674_0097497 | 3300047319 | Unclassified | 2504 |
| 248 | Ga0495680_0000136 | 3300047322 | Bacteria | 73375 |
| 249 | Ga0495680_0004203 | 3300047322 | Bacteria | 13823 |
| 250 | Ga0495680_0066989 | 3300047322 | Bacteria | 2746 |
| 251 | Ga0495675_0000186 | 3300047444 | Bacteria | 45392 |
| 252 | Ga0495675_0006407 | 3300047444 | Bacteria | 7203 |
| 253 | Ga0495675_0053812 | 3300047444 | Bacteria | 2555 |
| 254 | Ga0495675_0356671 | 3300047444 | Unclassified | 859 |
| 255 | Ga0495684_0048658 | 3300047471 | Bacteria | 3241 |
| 256 | Ga0495593_0094007 | 3300047673 | Unclassified | 1542 |
| 257 | Ga0495602_0022614 | 3300048088 | Bacteria | 6148 |
| 258 | Ga0495602_0138450 | 3300048088 | Bacteria | 1930 |
| 259 | Ga0495614_0002737 | 3300048089 | Bacteria | 7842 |
| 260 | Ga0496100_0355754 | 3300048903 | Bacteria | 1107 |
| 261 | Ga0496102_0060627 | 3300048905 | Unclassified | 3460 |
| 262 | Ga0496103_0036555 | 3300048906 | Bacteria | 3008 |
| 263 | Ga0496103_0144513 | 3300048906 | Bacteria | 1522 |
| 264 | Ga0496104_0130493 | 3300048907 | Unclassified | 2414 |
| 265 | Ga0496104_0223624 | 3300048907 | Bacteria | 1795 |
| 266 | Ga0496105_0075184 | 3300048908 | Bacteria | 2790 |
| 267 | Ga0496105_0375974 | 3300048908 | Unclassified | 1131 |
| 268 | Ga0496106_0039724 | 3300048909 | Bacteria | 3524 |
| 269 | Ga0496106_0156600 | 3300048909 | Bacteria | 1799 |
| 270 | Ga0496106_0275486 | 3300048909 | Bacteria | 1347 |
| 271 | Ga0496107_0083674 | 3300048910 | Unclassified | 2327 |
| 272 | Ga0496107_0189107 | 3300048910 | Bacteria | 1529 |
| 273 | Ga0496108_0019457 | 3300048911 | Bacteria | 5576 |
| 274 | Ga0496108_0174666 | 3300048911 | Bacteria | 1859 |
| 275 | Ga0496109_0131341 | 3300048912 | Bacteria | 2337 |
| 276 | Ga0496109_0306253 | 3300048912 | Bacteria | 1498 |
| 277 | Ga0496109_1110194 | 3300048912 | Bacteria | 728 |
| 278 | Ga0496110_0143816 | 3300048913 | Bacteria | 2156 |
| 279 | Ga0496110_0411831 | 3300048913 | Bacteria | 1232 |
| 280 | Ga0496111_0319749 | 3300048914 | Bacteria | 1149 |
| 281 | Ga0496111_0442407 | 3300048914 | Bacteria | 959 |
| 282 | Ga0496112_0146420 | 3300048915 | Bacteria | 2330 |
| 283 | Ga0496112_0189511 | 3300048915 | Bacteria | 2019 |
| 284 | Ga0496112_0407679 | 3300048915 | Bacteria | 1299 |
| 285 | Ga0496113_0141912 | 3300048916 | Bacteria | 1890 |
| 286 | Ga0501040_0078811 | 3300049576 | Bacteria | 2280 |
| 287 | Ga0501072_0308410 | 3300049588 | Bacteria | 1258 |
| 288 | Ga0501075_0067274 | 3300049591 | Bacteria | 2705 |
| 289 | Ga0501075_0167844 | 3300049591 | Bacteria | 1674 |
| 290 | Ga0501075_0195134 | 3300049591 | Bacteria | 1544 |
| 291 | Ga0501076_0048358 | 3300049592 | Bacteria | 3362 |
| 292 | Ga0501076_0078177 | 3300049592 | Bacteria | 2655 |
| 293 | Ga0501077_0005177 | 3300049593 | Bacteria | 7921 |
| 294 | Ga0501079_0013624 | 3300049741 | Bacteria | 6201 |
| 295 | Ga0501079_0146683 | 3300049741 | Bacteria | 1839 |
| 296 | Ga0501083_0349160 | 3300049744 | Bacteria | 962 |
| 297 | Ga0501045_0281781 | 3300049824 | Bacteria | 1237 |
| 298 | nmdc:mga05p37_313534_c1 | 3300050507 | Bacteria | 1859 |
| 299 | nmdc:mga0qj67_10889_c1 | 3300050509 | Bacteria | 6803 |
| 300 | nmdc:mga0rr50_98748_c1 | 3300050513 | Bacteria | 2289 |
| 301 | nmdc:mga08x19_125_c1 | 3300050514 | Bacteria | 67457 |
| 302 | nmdc:mga08x19_537392_c1 | 3300050514 | Bacteria | 827 |
| 303 | Ga0495601_0032368 | 3300053077 | Bacteria | 3255 |
| 304 | Ga0495601_0150608 | 3300053077 | Unclassified | 1519 |
| 305 | Ga0495612_0020138 | 3300053078 | Bacteria | 2673 |
| 306 | Ga0495612_0049867 | 3300053078 | Unclassified | 1718 |
| 307 | Ga0500644_0000446 | 3300053088 | Bacteria | 18927 |
| 308 | Ga0500616_0125594 | 3300053153 | Bacteria | 1219 |
| 309 | Ga0501084_0341374 | 3300054114 | Bacteria | 1265 |
| 310 | Ga0501084_0686951 | 3300054114 | Bacteria | 863 |
| 311 | Ga0501082_0055978 | 3300060353 | Bacteria | 3397 |
| 312 | Ga0530510_0231282 | 3300061734 | Bacteria | 1375 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_1110194 | Ga0496109_1110194_67_672 | 183 |
| 2 | 3300036401 | Ga0373937_0305228 | Ga0373937_0305228_818_1444 | 188 |
| 3 | 3300006846 | Ga0075430_100007614 | Ga0075430_1000076143 | 193 |
| 4 | 3300050509 | nmdc:mga0qj67_10889_c1 | nmdc:mga0qj67_10889_c1_121_744 | 193 |
| 5 | 3300035083 | Ga0373926_0122890 | Ga0373926_0122890_310_930 | 195 |
| 6 | 3300025925 | Ga0207650_10016193 | Ga0207650_100161933 | 196 |
| 7 | 3300006028 | Ga0070717_10058790 | Ga0070717_100587903 | 197 |
| 8 | 3300007265 | Ga0099794_10019574 | Ga0099794_100195742 | 197 |
| 9 | 3300028800 | Ga0265338_10069772 | Ga0265338_100697722 | 197 |
| 10 | 3300035111 | Ga0373923_0208091 | Ga0373923_0208091_190_870 | 197 |
| 11 | 3300044712 | Ga0453684_1040192 | Ga0453684_1040192_25_663 | 197 |
| 12 | 3300046473 | Ga0495582_0041673 | Ga0495582_0041673_11_661 | 197 |
| 13 | 3300053088 | Ga0500644_0000446 | Ga0500644_0000446_1139_1777 | 197 |
| 14 | 3300009101 | Ga0105247_10038748 | Ga0105247_100387482 | 198 |
| 15 | 3300009148 | Ga0105243_10762777 | Ga0105243_107627772 | 198 |
| 16 | 3300009176 | Ga0105242_10072884 | Ga0105242_100728842 | 198 |
| 17 | 3300009177 | Ga0105248_10001065 | Ga0105248_100010655 | 198 |
| 18 | 3300013296 | Ga0157374_10029364 | Ga0157374_100293642 | 198 |
| 19 | 3300013306 | Ga0163162_10051177 | Ga0163162_100511775 | 198 |
| 20 | 3300013308 | Ga0157375_10000907 | Ga0157375_100009073 | 198 |
| 21 | 3300014325 | Ga0163163_10020299 | Ga0163163_100202992 | 198 |
| 22 | 3300014745 | Ga0157377_10100699 | Ga0157377_101006993 | 198 |
| 23 | 3300014968 | Ga0157379_10000644 | Ga0157379_100006445 | 198 |
| 24 | 3300005343 | Ga0070687_100021453 | Ga0070687_1000214533 | 202 |
| 25 | 3300005367 | Ga0070667_100223399 | Ga0070667_1002233993 | 202 |
| 26 | 3300005440 | Ga0070705_100070143 | Ga0070705_1000701432 | 202 |
| 27 | 3300005466 | Ga0070685_10005168 | Ga0070685_100051685 | 202 |
| 28 | 3300026121 | Ga0207683_10180062 | Ga0207683_101800622 | 202 |
| 29 | 3300005564 | Ga0070664_100346152 | Ga0070664_1003461521 | 203 |
| 30 | 3300025945 | Ga0207679_10307501 | Ga0207679_103075012 | 203 |
| 31 | 3300014745 | Ga0157377_10140505 | Ga0157377_101405051 | 204 |
| 32 | 3300005536 | Ga0070697_100440697 | Ga0070697_1004406971 | 205 |
| 33 | 3300025922 | Ga0207646_10045077 | Ga0207646_100450776 | 205 |
| 34 | 3300005467 | Ga0070706_100675455 | Ga0070706_1006754551 | 206 |
| 35 | 3300007076 | Ga0075435_100098500 | Ga0075435_1000985004 | 206 |
| 36 | 3300009147 | Ga0114129_10118656 | Ga0114129_101186563 | 206 |
| 37 | 3300025910 | Ga0207684_10015379 | Ga0207684_100153792 | 206 |
| 38 | 3300050507 | nmdc:mga05p37_313534_c1 | nmdc:mga05p37_313534_c1_896_1552 | 206 |
| 39 | 3300050513 | nmdc:mga0rr50_98748_c1 | nmdc:mga0rr50_98748_c1_1201_1857 | 206 |
| 40 | 3300050514 | nmdc:mga08x19_537392_c1 | nmdc:mga08x19_537392_c1_112_768 | 206 |
| 41 | 3300013308 | Ga0157375_10178080 | Ga0157375_101780804 | 208 |
| 42 | 3300025960 | Ga0207651_10138136 | Ga0207651_101381362 | 208 |
| 43 | 3300048915 | Ga0496112_0407679 | Ga0496112_0407679_613_1278 | 208 |
| 44 | 3300005444 | Ga0070694_100174042 | Ga0070694_1001740422 | 209 |
| 45 | 3300005467 | Ga0070706_100329813 | Ga0070706_1003298132 | 209 |
| 46 | 3300005549 | Ga0070704_100015144 | Ga0070704_1000151445 | 209 |
| 47 | 3300025922 | Ga0207646_10577814 | Ga0207646_105778141 | 209 |
| 48 | 3300005330 | Ga0070690_100096151 | Ga0070690_1000961512 | 210 |
| 49 | 3300005340 | Ga0070689_100081544 | Ga0070689_1000815442 | 210 |
| 50 | 3300005354 | Ga0070675_100000395 | Ga0070675_10000039523 | 210 |
| 51 | 3300005355 | Ga0070671_100026926 | Ga0070671_1000269265 | 210 |
| 52 | 3300005364 | Ga0070673_100096165 | Ga0070673_1000961652 | 210 |
| 53 | 3300005367 | Ga0070667_100030892 | Ga0070667_1000308922 | 210 |
| 54 | 3300005456 | Ga0070678_100474884 | Ga0070678_1004748842 | 210 |
| 55 | 3300005466 | Ga0070685_10003815 | Ga0070685_100038155 | 210 |
| 56 | 3300005564 | Ga0070664_100312146 | Ga0070664_1003121461 | 210 |
| 57 | 3300005618 | Ga0068864_100287752 | Ga0068864_1002877522 | 210 |
| 58 | 3300025960 | Ga0207651_10071830 | Ga0207651_100718302 | 210 |
| 59 | 3300005343 | Ga0070687_100049282 | Ga0070687_1000492821 | 211 |
| 60 | 3300005355 | Ga0070671_100106236 | Ga0070671_1001062362 | 211 |
| 61 | 3300005366 | Ga0070659_100065739 | Ga0070659_1000657394 | 211 |
| 62 | 3300005444 | Ga0070694_100083371 | Ga0070694_1000833712 | 211 |
| 63 | 3300005455 | Ga0070663_100387436 | Ga0070663_1003874362 | 211 |
| 64 | 3300005577 | Ga0068857_100710082 | Ga0068857_1007100821 | 211 |
| 65 | 3300005615 | Ga0070702_100021310 | Ga0070702_1000213102 | 211 |
| 66 | 3300005718 | Ga0068866_10445426 | Ga0068866_104454262 | 211 |
| 67 | 3300005719 | Ga0068861_100246685 | Ga0068861_1002466852 | 211 |
| 68 | 3300005842 | Ga0068858_100063943 | Ga0068858_1000639431 | 211 |
| 69 | 3300005843 | Ga0068860_100429595 | Ga0068860_1004295952 | 211 |
| 70 | 3300009094 | Ga0111539_10684190 | Ga0111539_106841902 | 211 |
| 71 | 3300009148 | Ga0105243_10201341 | Ga0105243_102013412 | 211 |
| 72 | 3300009553 | Ga0105249_10404919 | Ga0105249_104049192 | 211 |
| 73 | 3300013296 | Ga0157374_10948094 | Ga0157374_109480941 | 211 |
| 74 | 3300025908 | Ga0207643_10075622 | Ga0207643_100756224 | 211 |
| 75 | 3300025918 | Ga0207662_10019715 | Ga0207662_100197154 | 211 |
| 76 | 3300025931 | Ga0207644_10050408 | Ga0207644_100504084 | 211 |
| 77 | 3300025932 | Ga0207690_10022462 | Ga0207690_100224623 | 211 |
| 78 | 3300025937 | Ga0207669_10048034 | Ga0207669_100480342 | 211 |
| 79 | 3300025940 | Ga0207691_10118714 | Ga0207691_101187142 | 211 |
| 80 | 3300025961 | Ga0207712_10255915 | Ga0207712_102559152 | 211 |
| 81 | 3300025986 | Ga0207658_10197266 | Ga0207658_101972663 | 211 |
| 82 | 3300026035 | Ga0207703_10025618 | Ga0207703_100256186 | 211 |
| 83 | 3300026075 | Ga0207708_10046102 | Ga0207708_100461022 | 211 |
| 84 | 3300026095 | Ga0207676_10100231 | Ga0207676_101002313 | 211 |
| 85 | 3300026116 | Ga0207674_10373911 | Ga0207674_103739112 | 211 |
| 86 | 3300026118 | Ga0207675_100209602 | Ga0207675_1002096022 | 211 |
| 87 | 3300028380 | Ga0268265_10072927 | Ga0268265_100729271 | 211 |
| 88 | 3300028381 | Ga0268264_10154195 | Ga0268264_101541953 | 211 |
| 89 | 3300048906 | Ga0496103_0144513 | Ga0496103_0144513_344_1033 | 211 |
| 90 | 3300048908 | Ga0496105_0075184 | Ga0496105_0075184_304_993 | 211 |
| 91 | 3300048909 | Ga0496106_0039724 | Ga0496106_0039724_217_906 | 211 |
| 92 | 3300048909 | Ga0496106_0275486 | Ga0496106_0275486_107_796 | 211 |
| 93 | 3300048910 | Ga0496107_0189107 | Ga0496107_0189107_410_1099 | 211 |
| 94 | 3300048911 | Ga0496108_0019457 | Ga0496108_0019457_1572_2261 | 211 |
| 95 | 3300048911 | Ga0496108_0174666 | Ga0496108_0174666_320_1009 | 211 |
| 96 | 3300048912 | Ga0496109_0131341 | Ga0496109_0131341_500_1189 | 211 |
| 97 | 3300048912 | Ga0496109_0306253 | Ga0496109_0306253_440_1129 | 211 |
| 98 | 3300048913 | Ga0496110_0143816 | Ga0496110_0143816_535_1224 | 211 |
| 99 | 3300048913 | Ga0496110_0411831 | Ga0496110_0411831_530_1219 | 211 |
| 100 | 3300048914 | Ga0496111_0319749 | Ga0496111_0319749_104_793 | 211 |
| 101 | 3300048914 | Ga0496111_0442407 | Ga0496111_0442407_42_731 | 211 |
| 102 | 3300048915 | Ga0496112_0146420 | Ga0496112_0146420_214_903 | 211 |
| 103 | 3300048916 | Ga0496113_0141912 | Ga0496113_0141912_993_1682 | 211 |
| 104 | 3300006852 | Ga0075433_10034759 | Ga0075433_100347594 | 212 |
| 105 | 3300035086 | Ga0373934_0036121 | Ga0373934_0036121_1151_1837 | 212 |
| 106 | 3300035111 | Ga0373923_0049092 | Ga0373923_0049092_862_1548 | 212 |
| 107 | 3300035113 | Ga0373936_0130951 | Ga0373936_0130951_376_1062 | 212 |
| 108 | 3300035118 | Ga0373954_0017685 | Ga0373954_0017685_282_968 | 212 |
| 109 | 3300035692 | Ga0373935_0000814 | Ga0373935_0000814_15544_16230 | 212 |
| 110 | 3300035695 | Ga0373927_0001500 | Ga0373927_0001500_888_1574 | 212 |
| 111 | 3300035725 | Ga0373947_0003128 | Ga0373947_0003128_9079_9765 | 212 |
| 112 | 3300036401 | Ga0373937_0019946 | Ga0373937_0019946_32_718 | 212 |
| 113 | 3300046454 | Ga0495592_0065833 | Ga0495592_0065833_1177_1863 | 212 |
| 114 | 3300046462 | Ga0495651_0000739 | Ga0495651_0000739_4705_5391 | 212 |
| 115 | 3300046463 | Ga0495653_0058947 | Ga0495653_0058947_1050_1736 | 212 |
| 116 | 3300046472 | Ga0495580_0030789 | Ga0495580_0030789_2505_3191 | 212 |
| 117 | 3300046477 | Ga0495664_0016323 | Ga0495664_0016323_649_1335 | 212 |
| 118 | 3300046511 | Ga0495608_0005724 | Ga0495608_0005724_7468_8154 | 212 |
| 119 | 3300046514 | Ga0495618_0148485 | Ga0495618_0148485_32_718 | 212 |
| 120 | 3300046516 | Ga0495628_0012661 | Ga0495628_0012661_5147_5833 | 212 |
| 121 | 3300046517 | Ga0495630_0012123 | Ga0495630_0012123_287_973 | 212 |
| 122 | 3300046526 | Ga0495666_0024779 | Ga0495666_0024779_936_1622 | 212 |
| 123 | 3300046529 | Ga0495652_0094886 | Ga0495652_0094886_35_721 | 212 |
| 124 | 3300046531 | Ga0495665_0000933 | Ga0495665_0000933_12117_12803 | 212 |
| 125 | 3300046535 | Ga0495586_0008648 | Ga0495586_0008648_1064_1750 | 212 |
| 126 | 3300046536 | Ga0495587_0028445 | Ga0495587_0028445_486_1172 | 212 |
| 127 | 3300046543 | Ga0495645_0019036 | Ga0495645_0019036_1703_2389 | 212 |
| 128 | 3300046559 | Ga0495667_0309303 | Ga0495667_0309303_104_790 | 212 |
| 129 | 3300046663 | Ga0495635_0006675 | Ga0495635_0006675_2168_2854 | 212 |
| 130 | 3300046675 | Ga0495657_0137899 | Ga0495657_0137899_102_788 | 212 |
| 131 | 3300046679 | Ga0495623_0003259 | Ga0495623_0003259_9740_10426 | 212 |
| 132 | 3300046680 | Ga0495646_0000354 | Ga0495646_0000354_17807_18493 | 212 |
| 133 | 3300046690 | Ga0495624_0001575 | Ga0495624_0001575_16124_16810 | 212 |
| 134 | 3300047317 | Ga0495604_0033263 | Ga0495604_0033263_1622_2308 | 212 |
| 135 | 3300047444 | Ga0495675_0053812 | Ga0495675_0053812_1680_2366 | 212 |
| 136 | 3300047673 | Ga0495593_0094007 | Ga0495593_0094007_68_754 | 212 |
| 137 | 3300048089 | Ga0495614_0002737 | Ga0495614_0002737_1734_2420 | 212 |
| 138 | 3300053077 | Ga0495601_0150608 | Ga0495601_0150608_71_757 | 212 |
| 139 | 3300053078 | Ga0495612_0020138 | Ga0495612_0020138_1841_2527 | 212 |
| 140 | 3300053153 | Ga0500616_0125594 | Ga0500616_0125594_98_754 | 212 |
| 141 | 3300005445 | Ga0070708_100378348 | Ga0070708_1003783481 | 213 |
| 142 | 3300005468 | Ga0070707_100000161 | Ga0070707_10000016112 | 213 |
| 143 | 3300006914 | Ga0075436_100002089 | Ga0075436_10000208912 | 213 |
| 144 | 3300007076 | Ga0075435_100011308 | Ga0075435_1000113085 | 213 |
| 145 | 3300014968 | Ga0157379_10459968 | Ga0157379_104599682 | 213 |
| 146 | 3300027671 | Ga0209588_1049870 | Ga0209588_10498701 | 213 |
| 147 | 3300035171 | Ga0373946_0034185 | Ga0373946_0034185_1016_1711 | 213 |
| 148 | 3300035172 | Ga0373955_0435300 | Ga0373955_0435300_30_719 | 213 |
| 149 | 3300035695 | Ga0373927_0010690 | Ga0373927_0010690_1675_2370 | 213 |
| 150 | 3300035725 | Ga0373947_0189499 | Ga0373947_0189499_334_1029 | 213 |
| 151 | 3300037068 | Ga0373925_0010778 | Ga0373925_0010778_5306_6001 | 213 |
| 152 | 3300042876 | Ga0451577_0037642 | Ga0451577_0037642_3479_4219 | 213 |
| 153 | 3300044712 | Ga0453684_0190530 | Ga0453684_0190530_678_1418 | 213 |
| 154 | 3300046454 | Ga0495592_0274768 | Ga0495592_0274768_142_837 | 213 |
| 155 | 3300046462 | Ga0495651_0000691 | Ga0495651_0000691_16854_17543 | 213 |
| 156 | 3300046472 | Ga0495580_0060824 | Ga0495580_0060824_1174_1869 | 213 |
| 157 | 3300046477 | Ga0495664_0159358 | Ga0495664_0159358_444_1133 | 213 |
| 158 | 3300046517 | Ga0495630_0018190 | Ga0495630_0018190_995_1690 | 213 |
| 159 | 3300046526 | Ga0495666_0194922 | Ga0495666_0194922_135_830 | 213 |
| 160 | 3300046543 | Ga0495645_0064228 | Ga0495645_0064228_1769_2458 | 213 |
| 161 | 3300046557 | Ga0495622_0075648 | Ga0495622_0075648_597_1286 | 213 |
| 162 | 3300046559 | Ga0495667_0005033 | Ga0495667_0005033_4566_5255 | 213 |
| 163 | 3300046809 | Ga0495600_0038900 | Ga0495600_0038900_2304_2993 | 213 |
| 164 | 3300047319 | Ga0495674_0097497 | Ga0495674_0097497_483_1178 | 213 |
| 165 | 3300047322 | Ga0495680_0000136 | Ga0495680_0000136_62994_63683 | 213 |
| 166 | 3300047444 | Ga0495675_0006407 | Ga0495675_0006407_1543_2232 | 213 |
| 167 | 3300050514 | nmdc:mga08x19_125_c1 | nmdc:mga08x19_125_c1_27658_28413 | 213 |
| 168 | 3300005434 | Ga0070709_10262221 | Ga0070709_102622212 | 214 |
| 169 | 3300005434 | Ga0070709_10432612 | Ga0070709_104326121 | 214 |
| 170 | 3300005436 | Ga0070713_100024085 | Ga0070713_1000240852 | 214 |
| 171 | 3300005439 | Ga0070711_100011019 | Ga0070711_1000110191 | 214 |
| 172 | 3300005440 | Ga0070705_100138717 | Ga0070705_1001387171 | 214 |
| 173 | 3300005445 | Ga0070708_100102600 | Ga0070708_1001026002 | 214 |
| 174 | 3300005471 | Ga0070698_100002089 | Ga0070698_10000208912 | 214 |
| 175 | 3300005544 | Ga0070686_100227781 | Ga0070686_1002277811 | 214 |
| 176 | 3300005546 | Ga0070696_100367292 | Ga0070696_1003672921 | 214 |
| 177 | 3300005549 | Ga0070704_100016941 | Ga0070704_1000169415 | 214 |
| 178 | 3300005843 | Ga0068860_100022745 | Ga0068860_1000227452 | 214 |
| 179 | 3300009098 | Ga0105245_10055087 | Ga0105245_100550872 | 214 |
| 180 | 3300009176 | Ga0105242_10123618 | Ga0105242_101236182 | 214 |
| 181 | 3300009177 | Ga0105248_10150387 | Ga0105248_101503872 | 214 |
| 182 | 3300009545 | Ga0105237_10030508 | Ga0105237_100305087 | 214 |
| 183 | 3300010375 | Ga0105239_10046155 | Ga0105239_100461554 | 214 |
| 184 | 3300013296 | Ga0157374_10157801 | Ga0157374_101578012 | 214 |
| 185 | 3300013297 | Ga0157378_10001669 | Ga0157378_1000166910 | 214 |
| 186 | 3300013297 | Ga0157378_10054266 | Ga0157378_100542664 | 214 |
| 187 | 3300013306 | Ga0163162_10630875 | Ga0163162_106308752 | 214 |
| 188 | 3300013307 | Ga0157372_10148525 | Ga0157372_101485252 | 214 |
| 189 | 3300025906 | Ga0207699_10366884 | Ga0207699_103668842 | 214 |
| 190 | 3300025914 | Ga0207671_10114216 | Ga0207671_101142162 | 214 |
| 191 | 3300025916 | Ga0207663_10004082 | Ga0207663_1000408210 | 214 |
| 192 | 3300025928 | Ga0207700_10147394 | Ga0207700_101473942 | 214 |
| 193 | 3300025929 | Ga0207664_10106379 | Ga0207664_101063792 | 214 |
| 194 | 3300025942 | Ga0207689_10101303 | Ga0207689_101013032 | 214 |
| 195 | 3300027671 | Ga0209588_1022173 | Ga0209588_10221732 | 214 |
| 196 | 3300028381 | Ga0268264_10052104 | Ga0268264_100521042 | 214 |
| 197 | 3300028800 | Ga0265338_10054563 | Ga0265338_100545632 | 214 |
| 198 | 3300030879 | Ga0265765_1004022 | Ga0265765_10040222 | 214 |
| 199 | 3300031241 | Ga0265325_10011158 | Ga0265325_100111585 | 214 |
| 200 | 3300031241 | Ga0265325_10019341 | Ga0265325_100193412 | 214 |
| 201 | 3300031250 | Ga0265331_10002970 | Ga0265331_100029702 | 214 |
| 202 | 3300031344 | Ga0265316_10005664 | Ga0265316_100056643 | 214 |
| 203 | 3300035724 | Ga0373933_0306490 | Ga0373933_0306490_216_908 | 214 |
| 204 | 3300039437 | Ga0436365_0146413 | Ga0436365_0146413_421_1122 | 214 |
| 205 | 3300042876 | Ga0451577_0631330 | Ga0451577_0631330_106_813 | 214 |
| 206 | 3300046454 | Ga0495592_0013890 | Ga0495592_0013890_2407_3099 | 214 |
| 207 | 3300046454 | Ga0495592_0049138 | Ga0495592_0049138_2405_3100 | 214 |
| 208 | 3300046454 | Ga0495592_0169509 | Ga0495592_0169509_306_1007 | 214 |
| 209 | 3300046462 | Ga0495651_0002621 | Ga0495651_0002621_11609_12301 | 214 |
| 210 | 3300046463 | Ga0495653_0003151 | Ga0495653_0003151_11500_12192 | 214 |
| 211 | 3300046511 | Ga0495608_0018711 | Ga0495608_0018711_125_817 | 214 |
| 212 | 3300046514 | Ga0495618_0020070 | Ga0495618_0020070_2234_2926 | 214 |
| 213 | 3300046516 | Ga0495628_0005840 | Ga0495628_0005840_2129_2821 | 214 |
| 214 | 3300046517 | Ga0495630_0003522 | Ga0495630_0003522_136_834 | 214 |
| 215 | 3300046517 | Ga0495630_0062959 | Ga0495630_0062959_480_1172 | 214 |
| 216 | 3300046529 | Ga0495652_0001149 | Ga0495652_0001149_13541_14233 | 214 |
| 217 | 3300046533 | Ga0495640_0077974 | Ga0495640_0077974_955_1647 | 214 |
| 218 | 3300046536 | Ga0495587_0002917 | Ga0495587_0002917_4453_5145 | 214 |
| 219 | 3300046543 | Ga0495645_0010518 | Ga0495645_0010518_1610_2302 | 214 |
| 220 | 3300046543 | Ga0495645_0012246 | Ga0495645_0012246_2387_3088 | 214 |
| 221 | 3300046559 | Ga0495667_0000777 | Ga0495667_0000777_10800_11492 | 214 |
| 222 | 3300046675 | Ga0495657_0004072 | Ga0495657_0004072_8257_8949 | 214 |
| 223 | 3300046675 | Ga0495657_0006180 | Ga0495657_0006180_4129_4824 | 214 |
| 224 | 3300046678 | Ga0495599_0005074 | Ga0495599_0005074_4409_5101 | 214 |
| 225 | 3300046678 | Ga0495599_0251938 | Ga0495599_0251938_71_772 | 214 |
| 226 | 3300046680 | Ga0495646_0066118 | Ga0495646_0066118_892_1587 | 214 |
| 227 | 3300046689 | Ga0495613_0033334 | Ga0495613_0033334_1283_1963 | 214 |
| 228 | 3300046689 | Ga0495613_0066933 | Ga0495613_0066933_230_925 | 214 |
| 229 | 3300046690 | Ga0495624_0121604 | Ga0495624_0121604_766_1446 | 214 |
| 230 | 3300046690 | Ga0495624_0306699 | Ga0495624_0306699_121_813 | 214 |
| 231 | 3300046809 | Ga0495600_0002472 | Ga0495600_0002472_2924_3616 | 214 |
| 232 | 3300047317 | Ga0495604_0000515 | Ga0495604_0000515_6892_7584 | 214 |
| 233 | 3300047319 | Ga0495674_0018543 | Ga0495674_0018543_3090_3791 | 214 |
| 234 | 3300047319 | Ga0495674_0044059 | Ga0495674_0044059_963_1655 | 214 |
| 235 | 3300047319 | Ga0495674_0089197 | Ga0495674_0089197_567_1265 | 214 |
| 236 | 3300047322 | Ga0495680_0004203 | Ga0495680_0004203_12756_13448 | 214 |
| 237 | 3300047322 | Ga0495680_0066989 | Ga0495680_0066989_468_1163 | 214 |
| 238 | 3300047444 | Ga0495675_0000186 | Ga0495675_0000186_2119_2811 | 214 |
| 239 | 3300047444 | Ga0495675_0356671 | Ga0495675_0356671_44_739 | 214 |
| 240 | 3300047471 | Ga0495684_0048658 | Ga0495684_0048658_1528_2223 | 214 |
| 241 | 3300048088 | Ga0495602_0022614 | Ga0495602_0022614_3043_3735 | 214 |
| 242 | 3300048088 | Ga0495602_0138450 | Ga0495602_0138450_115_810 | 214 |
| 243 | 3300048903 | Ga0496100_0355754 | Ga0496100_0355754_221_931 | 214 |
| 244 | 3300048905 | Ga0496102_0060627 | Ga0496102_0060627_1281_1991 | 214 |
| 245 | 3300048906 | Ga0496103_0036555 | Ga0496103_0036555_581_1291 | 214 |
| 246 | 3300048907 | Ga0496104_0130493 | Ga0496104_0130493_608_1309 | 214 |
| 247 | 3300048908 | Ga0496105_0375974 | Ga0496105_0375974_218_919 | 214 |
| 248 | 3300048909 | Ga0496106_0156600 | Ga0496106_0156600_90_800 | 214 |
| 249 | 3300048910 | Ga0496107_0083674 | Ga0496107_0083674_340_1050 | 214 |
| 250 | 3300048915 | Ga0496112_0189511 | Ga0496112_0189511_1072_1782 | 214 |
| 251 | 3300053077 | Ga0495601_0032368 | Ga0495601_0032368_2366_3067 | 214 |
| 252 | 3300053078 | Ga0495612_0049867 | Ga0495612_0049867_922_1623 | 214 |
| 253 | 3300005434 | Ga0070709_10006953 | Ga0070709_100069533 | 215 |
| 254 | 3300005436 | Ga0070713_100003098 | Ga0070713_1000030988 | 215 |
| 255 | 3300005440 | Ga0070705_100035218 | Ga0070705_1000352182 | 215 |
| 256 | 3300005545 | Ga0070695_100062670 | Ga0070695_1000626703 | 215 |
| 257 | 3300005549 | Ga0070704_100033226 | Ga0070704_1000332262 | 215 |
| 258 | 3300006173 | Ga0070716_100001625 | Ga0070716_1000016253 | 215 |
| 259 | 3300006175 | Ga0070712_100031130 | Ga0070712_1000311302 | 215 |
| 260 | 3300007788 | Ga0099795_10002193 | Ga0099795_100021931 | 215 |
| 261 | 3300025905 | Ga0207685_10052835 | Ga0207685_100528351 | 215 |
| 262 | 3300025906 | Ga0207699_10003490 | Ga0207699_100034905 | 215 |
| 263 | 3300025928 | Ga0207700_10002305 | Ga0207700_100023058 | 215 |
| 264 | 3300025939 | Ga0207665_10000649 | Ga0207665_100006496 | 215 |
| 265 | 3300036401 | Ga0373937_0316171 | Ga0373937_0316171_52_765 | 215 |
| 266 | 3300046689 | Ga0495613_0047305 | Ga0495613_0047305_2340_3068 | 215 |
| 267 | 3300048907 | Ga0496104_0223624 | Ga0496104_0223624_330_1064 | 215 |
| 268 | 3300049576 | Ga0501040_0078811 | Ga0501040_0078811_654_1358 | 215 |
| 269 | 3300049588 | Ga0501072_0308410 | Ga0501072_0308410_330_1034 | 215 |
| 270 | 3300049591 | Ga0501075_0067274 | Ga0501075_0067274_1591_2295 | 215 |
| 271 | 3300049591 | Ga0501075_0167844 | Ga0501075_0167844_64_744 | 215 |
| 272 | 3300049591 | Ga0501075_0195134 | Ga0501075_0195134_422_1102 | 215 |
| 273 | 3300049592 | Ga0501076_0048358 | Ga0501076_0048358_2486_3190 | 215 |
| 274 | 3300049592 | Ga0501076_0078177 | Ga0501076_0078177_1326_2006 | 215 |
| 275 | 3300049593 | Ga0501077_0005177 | Ga0501077_0005177_5527_6207 | 215 |
| 276 | 3300049741 | Ga0501079_0013624 | Ga0501079_0013624_164_868 | 215 |
| 277 | 3300049741 | Ga0501079_0146683 | Ga0501079_0146683_251_931 | 215 |
| 278 | 3300049744 | Ga0501083_0349160 | Ga0501083_0349160_234_914 | 215 |
| 279 | 3300049824 | Ga0501045_0281781 | Ga0501045_0281781_119_823 | 215 |
| 280 | 3300054114 | Ga0501084_0341374 | Ga0501084_0341374_422_1126 | 215 |
| 281 | 3300054114 | Ga0501084_0686951 | Ga0501084_0686951_154_834 | 215 |
| 282 | 3300060353 | Ga0501082_0055978 | Ga0501082_0055978_1193_1897 | 215 |
| 283 | 3300061734 | Ga0530510_0231282 | Ga0530510_0231282_660_1364 | 215 |
| 284 | 3300005471 | Ga0070698_100088879 | Ga0070698_1000888791 | 216 |
| 285 | 3300005546 | Ga0070696_100050670 | Ga0070696_1000506702 | 216 |
| 286 | 3300009147 | Ga0114129_10911569 | Ga0114129_109115692 | 216 |
| 287 | 3300013297 | Ga0157378_10107144 | Ga0157378_101071443 | 216 |
| 288 | 3300024225 | Ga0224572_1017055 | Ga0224572_10170552 | 216 |
| 289 | 3300024227 | Ga0228598_1000474 | Ga0228598_10004745 | 216 |
| 290 | 3300026089 | Ga0207648_10290007 | Ga0207648_102900073 | 216 |
| 291 | 3300031090 | Ga0265760_10031164 | Ga0265760_100311642 | 216 |
| 292 | 3300031344 | Ga0265316_10098044 | Ga0265316_100980444 | 216 |
| 293 | 3300031711 | Ga0265314_10070235 | Ga0265314_100702352 | 216 |
| 294 | 3300005434 | Ga0070709_10029533 | Ga0070709_100295332 | 217 |
| 295 | 3300005834 | Ga0068851_10178345 | Ga0068851_101783452 | 217 |
| 296 | 3300005840 | Ga0068870_10047668 | Ga0068870_100476682 | 217 |
| 297 | 3300007265 | Ga0099794_10001821 | Ga0099794_100018214 | 217 |
| 298 | 3300009093 | Ga0105240_10142763 | Ga0105240_101427632 | 217 |
| 299 | 3300025929 | Ga0207664_10276095 | Ga0207664_102760952 | 217 |
| 300 | 3300031090 | Ga0265760_10000023 | Ga0265760_1000002354 | 217 |
| 301 | 3300006038 | Ga0075365_10219764 | Ga0075365_102197642 | 218 |
| 302 | 3300009093 | Ga0105240_10037391 | Ga0105240_100373913 | 218 |
| 303 | 3300013104 | Ga0157370_10103446 | Ga0157370_101034463 | 218 |
| 304 | 3300013297 | Ga0157378_10272350 | Ga0157378_102723502 | 218 |
| 305 | 3300005338 | Ga0068868_100266775 | Ga0068868_1002667752 | 219 |
| 306 | 3300005459 | Ga0068867_100323936 | Ga0068867_1003239362 | 219 |
| 307 | 3300025942 | Ga0207689_10278996 | Ga0207689_102789962 | 219 |
| 308 | 3300013308 | Ga0157375_11006504 | Ga0157375_110065041 | 220 |
| 309 | 3300005435 | Ga0070714_100030690 | Ga0070714_1000306902 | 221 |
| 310 | 3300025929 | Ga0207664_10025070 | Ga0207664_100250705 | 221 |
| 311 | 3300000041 | ARcpr5oldR_c005076 | ARcpr5oldR_0050762 | 224 |
| 312 | 3300000043 | ARcpr5yngRDRAFT_c005611 | ARcpr5yngRDRAFT_0056111 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9389 | 5 | 222 |
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9306 | 5 | 222 |
| 1vk2-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution | 0.7854 | 7 | 217 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7716 | 4 | 216 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7573 | 4 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9588 | 8 | 222 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9435 | 8 | 222 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9292 | 8 | 222 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9226 | 8 | 222 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7721 | 4 | 216 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836BL72-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9942 | 7 | 218 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A835X0W2-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9939 | 62 | 218 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A3N5E919-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9902 | 7 | 162 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A2V7JLX1-F1-model_v4 | Uracil-DNA glycosylase | 0.9894 | 6 | 147 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A350UJL0-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.989 | 5 | 157 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar