F401510

General Info

Members Datasets Scaffolds Average Seq Length
312 189 624 256

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10025712|rootH1_100257129
Length 303
Sequence VQLGRARGVTSKLQRMQPENARALVDGGAADTEASRATQARANREFAMSLKDPNVVNAKKPKRVAIVIANPALSTTTGWPVGFWWAELTHPYYVLEEAGYEVEVFSPKGGKCEADAMSDPRDASGYSSSDLISMGFIHTPKLAALVEETKPASDISVDAFDAIIVAGGQAPMFTFEAAHELQRKFAEFYEQGKVAVALCHGVAILRYVKLSSGEYLAKGKTVTGFANVEEDFADNAVWDAKLLSRDKHVMPWRIEDEMKKLGANYIQAGLWRGFAIRDGNLITGQQNFSGEETARLLVATLGR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0
Rhizoplane 4.17
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10025712 3300003323 Bacteria 13228
2 rootH1_10001755 3300003323 Bacteria 15867
3 rootH1_10070901 3300003323 Bacteria 6335
4 rootH1_10179204 3300003323 Bacteria 3870
5 rootH1_10251257 3300003323 Bacteria 4081
6 rootH1_10261349 3300003323 Bacteria 8940
7 Ga0055535_1004674 3300003761 Bacteria 3240
8 Ga0070658_10053323 3300005327 Bacteria 3282
9 Ga0070680_100019389 3300005336 Bacteria 5389
10 Ga0070689_100391323 3300005340 Bacteria 1173
11 Ga0070691_10047116 3300005341 Bacteria 2049
12 Ga0070709_10000183 3300005434 Bacteria 39793
13 Ga0070709_10011787 3300005434 Bacteria 4882
14 Ga0070714_100068667 3300005435 Bacteria 3059
15 Ga0070713_100000006 3300005436 Bacteria 190565
16 Ga0070713_100033958 3300005436 Bacteria 4092
17 Ga0070713_100064450 3300005436 Unclassified 3076
18 Ga0070710_10194308 3300005437 Bacteria 1278
19 Ga0070711_100341708 3300005439 Bacteria 1201
20 Ga0070708_100000494 3300005445 Bacteria 29731
21 Ga0070708_100149883 3300005445 Bacteria 2169
22 Ga0070708_100742496 3300005445 Unclassified 923
23 Ga0070678_100491937 3300005456 Bacteria 1081
24 Ga0070706_100078941 3300005467 Bacteria 3046
25 Ga0070706_100092407 3300005467 Bacteria 2807
26 Ga0070698_100251828 3300005471 Bacteria 1699
27 Ga0070679_100009999 3300005530 Bacteria 8980
28 Ga0070679_100031262 3300005530 Bacteria 5258
29 Ga0070684_100189162 3300005535 Bacteria 1873
30 Ga0068853_100003548 3300005539 Bacteria 11931
31 Ga0068853_100103105 3300005539 Unclassified 2525
32 Ga0068853_100132311 3300005539 Bacteria 2234
33 Ga0068853_100296137 3300005539 Bacteria 1494
34 Ga0070686_100183235 3300005544 Bacteria 1489
35 Ga0070695_100006749 3300005545 Bacteria 6792
36 Ga0070665_100000180 3300005548 Bacteria 112186
37 Ga0070665_100449926 3300005548 Unclassified 1297
38 Ga0068855_100168256 3300005563 Bacteria 2483
39 Ga0070664_100037561 3300005564 Bacteria 4073
40 Ga0068857_100005005 3300005577 Bacteria 11262
41 Ga0068856_100000071 3300005614 Bacteria 95174
42 Ga0068856_100077615 3300005614 Bacteria 3291
43 Ga0068852_100067835 3300005616 Bacteria 3119
44 Ga0068859_100017652 3300005617 Bacteria 7174
45 Ga0068859_100452677 3300005617 Bacteria 1380
46 Ga0068864_100145531 3300005618 Bacteria 2142
47 Ga0068861_100010151 3300005719 Bacteria 6531
48 Ga0068861_100118393 3300005719 Bacteria 2133
49 Ga0068863_100318128 3300005841 Bacteria 1511
50 Ga0068860_100067563 3300005843 Bacteria 3396
51 Ga0068860_100738206 3300005843 Bacteria 996
52 Ga0068862_100436510 3300005844 Bacteria 1232
53 Ga0081455_10128552 3300005937 Bacteria 1984
54 Ga0081540_1000935 3300005983 Bacteria 26250
55 Ga0070717_10149753 3300006028 Bacteria 2018
56 Ga0070717_10169019 3300006028 Unclassified 1901
57 Ga0075368_10035708 3300006042 Bacteria 1941
58 Ga0075364_10028752 3300006051 Bacteria 3560
59 Ga0070716_100262597 3300006173 Bacteria 1182
60 Ga0070712_100001574 3300006175 Bacteria 13963
61 Ga0070712_100164087 3300006175 Bacteria 1718
62 Ga0075366_10005738 3300006195 Bacteria 6737
63 Ga0075366_10042644 3300006195 Bacteria 2687
64 Ga0075370_10024888 3300006353 Bacteria 3309
65 Ga0068871_100077768 3300006358 Bacteria 2743
66 Ga0068871_100135670 3300006358 Bacteria 2090
67 Ga0068871_100510786 3300006358 Bacteria 1084
68 Ga0075428_100002138 3300006844 Bacteria 21328
69 Ga0075428_100033819 3300006844 Bacteria 5641
70 Ga0075428_100081895 3300006844 Bacteria 3522
71 Ga0075428_100102905 3300006844 Bacteria 3114
72 Ga0075428_100255763 3300006844 Bacteria 1887
73 Ga0075428_100328087 3300006844 Bacteria 1644
74 Ga0075428_100421655 3300006844 Bacteria 1430
75 Ga0075430_100069599 3300006846 Bacteria 2952
76 Ga0075430_100129277 3300006846 Bacteria 2105
77 Ga0075430_100162232 3300006846 Bacteria 1860
78 Ga0075431_100000029 3300006847 Bacteria 73283
79 Ga0075431_100001981 3300006847 Bacteria 19537
80 Ga0075431_100009050 3300006847 Bacteria 9985
81 Ga0075431_100132469 3300006847 Bacteria 2571
82 Ga0075431_100145769 3300006847 Bacteria 2440
83 Ga0075431_100159223 3300006847 Bacteria 2322
84 Ga0075431_100177012 3300006847 Bacteria 2190
85 Ga0075431_100334955 3300006847 Unclassified 1524
86 Ga0075433_10021298 3300006852 Bacteria 5436
87 Ga0075433_10218402 3300006852 Bacteria 1693
88 Ga0075434_100012608 3300006871 Bacteria 8015
89 Ga0075434_100058868 3300006871 Bacteria 3819
90 Ga0075434_100111863 3300006871 Bacteria 2742
91 Ga0075429_100111000 3300006880 Bacteria 2397
92 Ga0075429_100440461 3300006880 Bacteria 1142
93 Ga0075436_100000062 3300006914 Bacteria 64424
94 Ga0097620_100017652 3300006931 Bacteria 7174
95 Ga0097620_100452715 3300006931 Bacteria 1380
96 Ga0105240_10166241 3300009093 Bacteria 2616
97 Ga0105240_10472008 3300009093 Unclassified 1400
98 Ga0111539_10150754 3300009094 Bacteria 2722
99 Ga0105247_10002221 3300009101 Bacteria 13367
100 Ga0114129_10000661 3300009147 Bacteria 43208
101 Ga0114129_10015864 3300009147 Bacteria 10713
102 Ga0114129_10019850 3300009147 Bacteria 9565
103 Ga0114129_10032635 3300009147 Bacteria 7358
104 Ga0114129_10085027 3300009147 Bacteria 4389
105 Ga0114129_10107931 3300009147 Unclassified 3844
106 Ga0105241_10078682 3300009174 Bacteria 2577
107 Ga0105237_10007187 3300009545 Bacteria 12227
108 Ga0105237_10046465 3300009545 Bacteria 4366
109 Ga0105238_10005804 3300009551 Bacteria 12224
110 Ga0105238_10007430 3300009551 Bacteria 10975
111 Ga0105249_10029818 3300009553 Unclassified 4929
112 Ga0105249_10073884 3300009553 Bacteria 3155
113 Ga0105239_10212606 3300010375 Bacteria 2168
114 Ga0105239_10415139 3300010375 Bacteria 1524
115 Ga0157370_10001820 3300013104 Bacteria 26266
116 Ga0157370_10052368 3300013104 Bacteria 3897
117 Ga0157369_10030702 3300013105 Bacteria 5925
118 Ga0157369_10125277 3300013105 Bacteria 2724
119 Ga0157378_10099568 3300013297 Bacteria 2652
120 Ga0163162_10530295 3300013306 Bacteria 1307
121 Ga0157372_10146359 3300013307 Bacteria 2724
122 Ga0157379_10021180 3300014968 Bacteria 5753
123 Ga0213876_10006193 3300021384 Bacteria 6529
124 Ga0213875_10065187 3300021388 Bacteria 1702
125 Ga0209258_100029 3300025242 Bacteria 490648
126 Ga0209148_1000089 3300025254 Bacteria 253548
127 Ga0207710_10004561 3300025900 Bacteria 6023
128 Ga0207699_10000152 3300025906 Bacteria 44191
129 Ga0207684_10092405 3300025910 Bacteria 2579
130 Ga0207684_10228972 3300025910 Bacteria 1604
131 Ga0207695_10231049 3300025913 Bacteria 1754
132 Ga0207695_10373473 3300025913 Bacteria 1312
133 Ga0207671_10074707 3300025914 Bacteria 2534
134 Ga0207671_10521863 3300025914 Bacteria 947
135 Ga0207693_10004202 3300025915 Bacteria 12212
136 Ga0207663_10280786 3300025916 Bacteria 1237
137 Ga0207660_10017040 3300025917 Bacteria 4820
138 Ga0207652_10011264 3300025921 Bacteria 7205
139 Ga0207652_10068849 3300025921 Bacteria 3071
140 Ga0207646_10016064 3300025922 Bacteria 7034
141 Ga0207646_10277802 3300025922 Bacteria 1514
142 Ga0207646_10405361 3300025922 Unclassified 1231
143 Ga0207694_10005380 3300025924 Bacteria 9857
144 Ga0207694_10078221 3300025924 Bacteria 2592
145 Ga0207700_10000020 3300025928 Bacteria 176182
146 Ga0207700_10052157 3300025928 Unclassified 3056
147 Ga0207700_10655156 3300025928 Bacteria 936
148 Ga0207664_10061643 3300025929 Bacteria 2993
149 Ga0207664_10528568 3300025929 Unclassified 1057
150 Ga0207665_10295699 3300025939 Bacteria 1209
151 Ga0207679_10083538 3300025945 Bacteria 2448
152 Ga0207667_10034726 3300025949 Bacteria 5412
153 Ga0207712_10022101 3300025961 Unclassified 4186
154 Ga0207712_10314904 3300025961 Bacteria 1289
155 Ga0207639_10116638 3300026041 Bacteria 2186
156 Ga0207639_10212517 3300026041 Bacteria 1666
157 Ga0207702_10000021 3300026078 Bacteria 196115
158 Ga0207702_10008519 3300026078 Bacteria 8645
159 Ga0207674_10000584 3300026116 Bacteria 47996
160 Ga0207675_100007019 3300026118 Bacteria 10646
161 Ga0207675_100031833 3300026118 Bacteria 4914
162 Ga0209813_10016967 3300027866 Bacteria 1994
163 Ga0268266_10000565 3300028379 Bacteria 51457
164 Ga0268264_10302530 3300028381 Bacteria 1506
165 Ga0268264_10897383 3300028381 Bacteria 889
166 Ga0265337_1000161 3300028556 Bacteria 34508
167 Ga0265318_10000028 3300028577 Bacteria 149330
168 Ga0265318_10000934 3300028577 Bacteria 18893
169 Ga0265318_10050175 3300028577 Bacteria 1568
170 Ga0265336_10002462 3300028666 Bacteria 7613
171 Ga0265338_10001299 3300028800 Bacteria 40894
172 Ga0265338_10004290 3300028800 Bacteria 19355
173 Ga0265338_10004324 3300028800 Bacteria 19273
174 Ga0265324_10049533 3300029957 Bacteria 1445
175 Ga0265330_10000021 3300031235 Bacteria 154495
176 Ga0265330_10000279 3300031235 Bacteria 37685
177 Ga0265332_10000109 3300031238 Bacteria 70186
178 Ga0265332_10000650 3300031238 Bacteria 22546
179 Ga0265328_10000635 3300031239 Bacteria 16263
180 Ga0265328_10003826 3300031239 Bacteria 6612
181 Ga0265320_10000033 3300031240 Bacteria 141362
182 Ga0265320_10003786 3300031240 Bacteria 10044
183 Ga0265320_10012770 3300031240 Bacteria 4867
184 Ga0265329_10010889 3300031242 Bacteria 3325
185 Ga0265339_10128795 3300031249 Bacteria 1296
186 Ga0265331_10000269 3300031250 Bacteria 58263
187 Ga0265331_10023929 3300031250 Bacteria 3096
188 Ga0265331_10059640 3300031250 Bacteria 1804
189 Ga0265327_10000459 3300031251 Bacteria 73045
190 Ga0265327_10004795 3300031251 Bacteria 11751
191 Ga0265316_10010213 3300031344 Bacteria 8572
192 Ga0307509_10017257 3300031507 Bacteria 8316
193 Ga0265313_10000243 3300031595 Bacteria 59382
194 Ga0265313_10010903 3300031595 Bacteria 5700
195 Ga0265313_10011561 3300031595 Bacteria 5475
196 Ga0265314_10000407 3300031711 Bacteria 58254
197 Ga0265314_10032334 3300031711 Bacteria 3849
198 Ga0265314_10155241 3300031711 Bacteria 1398
199 Ga0265314_10188547 3300031711 Bacteria 1229
200 Ga0265342_10008480 3300031712 Bacteria 7363
201 Ga0265342_10010537 3300031712 Bacteria 6401
202 Ga0373934_0034176 3300035086 Bacteria 1998
203 Ga0373940_0021436 3300035088 Bacteria 1651
204 Ga0373923_0141370 3300035111 Bacteria 1088
205 Ga0373953_0024708 3300035117 Bacteria 2287
206 Ga0373954_0039395 3300035118 Bacteria 2199
207 Ga0373957_0049347 3300035120 Bacteria 1606
208 Ga0373955_0001566 3300035172 Bacteria 9768
209 Ga0373927_0213435 3300035695 Bacteria 1268
210 Ga0373933_0105542 3300035724 Bacteria 1752
211 Ga0373937_0476554 3300036401 Bacteria 1185
212 Ga0373925_0428274 3300037068 Bacteria 1082
213 Ga0395905_0373198 3300037471 Bacteria 1320
214 Ga0436364_0150582 3300037853 Bacteria 1619
215 Ga0436364_0601190 3300037853 Bacteria 2323
216 Ga0395901_0739546 3300038443 Bacteria 978
217 Ga0436365_0305644 3300039437 Bacteria 1044
218 Ga0436365_0311124 3300039437 Unclassified 2322
219 Ga0436365_0869156 3300039437 Bacteria 1496
220 Ga0436365_1464985 3300039437 Bacteria 22876
221 Ga0436360_1087278 3300039438 Bacteria 5256
222 Ga0436363_0463087 3300039450 Bacteria 2003
223 Ga0436363_0469201 3300039450 Bacteria 1884
224 Ga0436363_0491660 3300039450 Bacteria 2785
225 Ga0436363_0624688 3300039450 Unclassified 1427
226 Ga0436363_0637192 3300039450 Bacteria 1016
227 Ga0439435_0018578 3300042436 Bacteria 1771
228 Ga0451577_0001741 3300042876 Bacteria 28063
229 Ga0466969_0003261 3300044656 Bacteria 8625
230 Ga0466966_0000181 3300044684 Bacteria 41793
231 Ga0466961_0038092 3300044693 Bacteria 3085
232 Ga0466960_0013440 3300044901 Unclassified 3479
233 Ga0451576_0195637 3300045051 Bacteria 2112
234 Ga0451576_0324823 3300045051 Bacteria 1610
235 Ga0451576_1094035 3300045051 Bacteria 834
236 Ga0495592_0107102 3300046454 Bacteria 1983
237 Ga0495629_0058662 3300046459 Bacteria 2691
238 Ga0495651_0022191 3300046462 Bacteria 4935
239 Ga0495653_0063330 3300046463 Bacteria 2791
240 Ga0495580_0059719 3300046472 Bacteria 2680
241 Ga0495639_0180117 3300046475 Bacteria 1029
242 Ga0495664_0070881 3300046477 Bacteria 2081
243 Ga0495618_0247683 3300046514 Bacteria 1118
244 Ga0495652_0096166 3300046529 Bacteria 2412
245 Ga0495640_0154072 3300046533 Bacteria 1475
246 Ga0495586_0131147 3300046535 Bacteria 1403
247 Ga0495587_0024266 3300046536 Bacteria 3718
248 Ga0495645_0072776 3300046543 Bacteria 2476
249 Ga0495667_0165330 3300046559 Bacteria 1422
250 Ga0495634_0063910 3300046642 Bacteria 2441
251 Ga0495635_0102547 3300046663 Bacteria 1955
252 Ga0495657_0070042 3300046675 Bacteria 2292
253 Ga0495623_0046272 3300046679 Bacteria 2762
254 Ga0495624_0359348 3300046690 Bacteria 876
255 Ga0495600_0017182 3300046809 Bacteria 4598
256 Ga0495674_0064034 3300047319 Bacteria 3197
257 Ga0495602_0056303 3300048088 Bacteria 3458
258 Ga0496101_0249715 3300048904 Bacteria 1382
259 Ga0496101_0478126 3300048904 Bacteria 984
260 Ga0496102_0557163 3300048905 Bacteria 1069
261 Ga0496104_0031247 3300048907 Bacteria 4952
262 Ga0496105_0259973 3300048908 Bacteria 1404
263 Ga0496107_0283026 3300048910 Bacteria 1234
264 Ga0496108_0242299 3300048911 Bacteria 1568
265 Ga0496109_0002813 3300048912 Bacteria 14569
266 Ga0496110_0043846 3300048913 Bacteria 3905
267 Ga0496111_0120266 3300048914 Bacteria 1940
268 Ga0496112_0011554 3300048915 Bacteria 8068
269 Ga0496112_0051969 3300048915 Bacteria 4021
270 Ga0496113_0004891 3300048916 Bacteria 8300
271 Ga0501073_0087818 3300049589 Bacteria 2162
272 Ga0501035_0000030 3300049822 Bacteria 176511
273 nmdc:mga00v17_200283_c1 3300050491 Unclassified 1291
274 nmdc:mga0k408_992_c1 3300050493 Bacteria 15617
275 nmdc:mga06z11_48787_c1 3300050494 Bacteria 2157
276 nmdc:mga06z11_56989_c1 3300050494 Unclassified 2023
277 nmdc:mga04h51_12670_c1 3300050495 Bacteria 2372
278 nmdc:mga07m45_9403_c1 3300050496 Bacteria 5069
279 nmdc:mga05p37_105106_c1 3300050507 Unclassified 3474
280 nmdc:mga05p37_10542_c1 3300050507 Bacteria 10959
281 nmdc:mga05p37_1793_c1 3300050507 Bacteria 25060
282 nmdc:mga05p37_45077_c1 3300050507 Bacteria 5425
283 nmdc:mga05p37_6053_c1 3300050507 Bacteria 14241
284 nmdc:mga09592_43088_c1 3300050508 Unclassified 3797
285 nmdc:mga0qj67_220311_c1 3300050509 Bacteria 1540
286 nmdc:mga0qj67_316390_c1 3300050509 Bacteria 1264
287 nmdc:mga0qj67_31842_c1 3300050509 Bacteria 4110
288 nmdc:mga0qj67_48641_c1 3300050509 Bacteria 3350
289 nmdc:mga0qj67_50210_c1 3300050509 Bacteria 3298
290 nmdc:mga06r32_142016_c1 3300050510 Bacteria 2378
291 nmdc:mga06r32_1566_c1 3300050510 Bacteria 20624
292 nmdc:mga06r32_379848_c1 3300050510 Bacteria 1396
293 nmdc:mga06r32_44952_c1 3300050510 Bacteria 4208
294 nmdc:mga06r32_45369_c1 3300050510 Unclassified 4189
295 nmdc:mga06r32_7264_c1 3300050510 Bacteria 9979
296 nmdc:mga06r32_76322_c1 3300050510 Bacteria 3254
297 nmdc:mga06r32_85_c1 3300050510 Bacteria 64050
298 nmdc:mga08y16_104003_c1 3300050511 Bacteria 2956
299 nmdc:mga08y16_59574_c1 3300050511 Bacteria 3987
300 nmdc:mga0n895_10662_c1 3300050512 Bacteria 8138
301 nmdc:mga0n895_461596_c1 3300050512 Bacteria 1282
302 nmdc:mga0n895_892682_c1 3300050512 Bacteria 875
303 nmdc:mga08x19_37_c1 3300050514 Bacteria 163624
304 nmdc:mga0a205_473704_c1 3300050515 Bacteria 1111
305 nmdc:mga0a205_6152_c1 3300050515 Bacteria 10827
306 nmdc:mga0a205_7859_c1 3300050515 Unclassified 3170
307 Ga0495601_0248929 3300053077 Bacteria 1160
308 Ga0495612_0034901 3300053078 Bacteria 2037
309 Ga0495595_0020599 3300053084 Bacteria 2871
310 Ga0495619_0035454 3300053085 Bacteria 3244
311 Ga0500578_0178884 3300053086 Bacteria 1308
312 2993372583 2993372514 Bacteria 4214139
313 rootH1_10025712
314 rootH1_10001755
315 rootH1_10070901
316 rootH1_10179204
317 rootH1_10251257
318 rootH1_10261349
319 Ga0055535_1004674
320 Ga0070658_10053323
321 Ga0070680_100019389
322 Ga0070689_100391323
323 Ga0070691_10047116
324 Ga0070709_10000183
325 Ga0070709_10011787
326 Ga0070714_100068667
327 Ga0070713_100000006
328 Ga0070713_100033958
329 Ga0070713_100064450
330 Ga0070710_10194308
331 Ga0070711_100341708
332 Ga0070708_100000494
333 Ga0070708_100149883
334 Ga0070708_100742496
335 Ga0070678_100491937
336 Ga0070706_100078941
337 Ga0070706_100092407
338 Ga0070698_100251828
339 Ga0070679_100009999
340 Ga0070679_100031262
341 Ga0070684_100189162
342 Ga0068853_100003548
343 Ga0068853_100103105
344 Ga0068853_100132311
345 Ga0068853_100296137
346 Ga0070686_100183235
347 Ga0070695_100006749
348 Ga0070665_100000180
349 Ga0070665_100449926
350 Ga0068855_100168256
351 Ga0070664_100037561
352 Ga0068857_100005005
353 Ga0068856_100000071
354 Ga0068856_100077615
355 Ga0068852_100067835
356 Ga0068859_100017652
357 Ga0068859_100452677
358 Ga0068864_100145531
359 Ga0068861_100010151
360 Ga0068861_100118393
361 Ga0068863_100318128
362 Ga0068860_100067563
363 Ga0068860_100738206
364 Ga0068862_100436510
365 Ga0081455_10128552
366 Ga0081540_1000935
367 Ga0070717_10149753
368 Ga0070717_10169019
369 Ga0075368_10035708
370 Ga0075364_10028752
371 Ga0070716_100262597
372 Ga0070712_100001574
373 Ga0070712_100164087
374 Ga0075366_10005738
375 Ga0075366_10042644
376 Ga0075370_10024888
377 Ga0068871_100077768
378 Ga0068871_100135670
379 Ga0068871_100510786
380 Ga0075428_100002138
381 Ga0075428_100033819
382 Ga0075428_100081895
383 Ga0075428_100102905
384 Ga0075428_100255763
385 Ga0075428_100328087
386 Ga0075428_100421655
387 Ga0075430_100069599
388 Ga0075430_100129277
389 Ga0075430_100162232
390 Ga0075431_100000029
391 Ga0075431_100001981
392 Ga0075431_100009050
393 Ga0075431_100132469
394 Ga0075431_100145769
395 Ga0075431_100159223
396 Ga0075431_100177012
397 Ga0075431_100334955
398 Ga0075433_10021298
399 Ga0075433_10218402
400 Ga0075434_100012608
401 Ga0075434_100058868
402 Ga0075434_100111863
403 Ga0075429_100111000
404 Ga0075429_100440461
405 Ga0075436_100000062
406 Ga0097620_100017652
407 Ga0097620_100452715
408 Ga0105240_10166241
409 Ga0105240_10472008
410 Ga0111539_10150754
411 Ga0105247_10002221
412 Ga0114129_10000661
413 Ga0114129_10015864
414 Ga0114129_10019850
415 Ga0114129_10032635
416 Ga0114129_10085027
417 Ga0114129_10107931
418 Ga0105241_10078682
419 Ga0105237_10007187
420 Ga0105237_10046465
421 Ga0105238_10005804
422 Ga0105238_10007430
423 Ga0105249_10029818
424 Ga0105249_10073884
425 Ga0105239_10212606
426 Ga0105239_10415139
427 Ga0157370_10001820
428 Ga0157370_10052368
429 Ga0157369_10030702
430 Ga0157369_10125277
431 Ga0157378_10099568
432 Ga0163162_10530295
433 Ga0157372_10146359
434 Ga0157379_10021180
435 Ga0213876_10006193
436 Ga0213875_10065187
437 Ga0209258_100029
438 Ga0209148_1000089
439 Ga0207710_10004561
440 Ga0207699_10000152
441 Ga0207684_10092405
442 Ga0207684_10228972
443 Ga0207695_10231049
444 Ga0207695_10373473
445 Ga0207671_10074707
446 Ga0207671_10521863
447 Ga0207693_10004202
448 Ga0207663_10280786
449 Ga0207660_10017040
450 Ga0207652_10011264
451 Ga0207652_10068849
452 Ga0207646_10016064
453 Ga0207646_10277802
454 Ga0207646_10405361
455 Ga0207694_10005380
456 Ga0207694_10078221
457 Ga0207700_10000020
458 Ga0207700_10052157
459 Ga0207700_10655156
460 Ga0207664_10061643
461 Ga0207664_10528568
462 Ga0207665_10295699
463 Ga0207679_10083538
464 Ga0207667_10034726
465 Ga0207712_10022101
466 Ga0207712_10314904
467 Ga0207639_10116638
468 Ga0207639_10212517
469 Ga0207702_10000021
470 Ga0207702_10008519
471 Ga0207674_10000584
472 Ga0207675_100007019
473 Ga0207675_100031833
474 Ga0209813_10016967
475 Ga0268266_10000565
476 Ga0268264_10302530
477 Ga0268264_10897383
478 Ga0265337_1000161
479 Ga0265318_10000028
480 Ga0265318_10000934
481 Ga0265318_10050175
482 Ga0265336_10002462
483 Ga0265338_10001299
484 Ga0265338_10004290
485 Ga0265338_10004324
486 Ga0265324_10049533
487 Ga0265330_10000021
488 Ga0265330_10000279
489 Ga0265332_10000109
490 Ga0265332_10000650
491 Ga0265328_10000635
492 Ga0265328_10003826
493 Ga0265320_10000033
494 Ga0265320_10003786
495 Ga0265320_10012770
496 Ga0265329_10010889
497 Ga0265339_10128795
498 Ga0265331_10000269
499 Ga0265331_10023929
500 Ga0265331_10059640
501 Ga0265327_10000459
502 Ga0265327_10004795
503 Ga0265316_10010213
504 Ga0307509_10017257
505 Ga0265313_10000243
506 Ga0265313_10010903
507 Ga0265313_10011561
508 Ga0265314_10000407
509 Ga0265314_10032334
510 Ga0265314_10155241
511 Ga0265314_10188547
512 Ga0265342_10008480
513 Ga0265342_10010537
514 Ga0373934_0034176
515 Ga0373940_0021436
516 Ga0373923_0141370
517 Ga0373953_0024708
518 Ga0373954_0039395
519 Ga0373957_0049347
520 Ga0373955_0001566
521 Ga0373927_0213435
522 Ga0373933_0105542
523 Ga0373937_0476554
524 Ga0373925_0428274
525 Ga0395905_0373198
526 Ga0436364_0150582
527 Ga0436364_0601190
528 Ga0395901_0739546
529 Ga0436365_0305644
530 Ga0436365_0311124
531 Ga0436365_0869156
532 Ga0436365_1464985
533 Ga0436360_1087278
534 Ga0436363_0463087
535 Ga0436363_0469201
536 Ga0436363_0491660
537 Ga0436363_0624688
538 Ga0436363_0637192
539 Ga0439435_0018578
540 Ga0451577_0001741
541 Ga0466969_0003261
542 Ga0466966_0000181
543 Ga0466961_0038092
544 Ga0466960_0013440
545 Ga0451576_0195637
546 Ga0451576_0324823
547 Ga0451576_1094035
548 Ga0495592_0107102
549 Ga0495629_0058662
550 Ga0495651_0022191
551 Ga0495653_0063330
552 Ga0495580_0059719
553 Ga0495639_0180117
554 Ga0495664_0070881
555 Ga0495618_0247683
556 Ga0495652_0096166
557 Ga0495640_0154072
558 Ga0495586_0131147
559 Ga0495587_0024266
560 Ga0495645_0072776
561 Ga0495667_0165330
562 Ga0495634_0063910
563 Ga0495635_0102547
564 Ga0495657_0070042
565 Ga0495623_0046272
566 Ga0495624_0359348
567 Ga0495600_0017182
568 Ga0495674_0064034
569 Ga0495602_0056303
570 Ga0496101_0249715
571 Ga0496101_0478126
572 Ga0496102_0557163
573 Ga0496104_0031247
574 Ga0496105_0259973
575 Ga0496107_0283026
576 Ga0496108_0242299
577 Ga0496109_0002813
578 Ga0496110_0043846
579 Ga0496111_0120266
580 Ga0496112_0011554
581 Ga0496112_0051969
582 Ga0496113_0004891
583 Ga0501073_0087818
584 Ga0501035_0000030
585 nmdc:mga00v17_200283_c1
586 nmdc:mga0k408_992_c1
587 nmdc:mga06z11_48787_c1
588 nmdc:mga06z11_56989_c1
589 nmdc:mga04h51_12670_c1
590 nmdc:mga07m45_9403_c1
591 nmdc:mga05p37_105106_c1
592 nmdc:mga05p37_10542_c1
593 nmdc:mga05p37_1793_c1
594 nmdc:mga05p37_45077_c1
595 nmdc:mga05p37_6053_c1
596 nmdc:mga09592_43088_c1
597 nmdc:mga0qj67_220311_c1
598 nmdc:mga0qj67_316390_c1
599 nmdc:mga0qj67_31842_c1
600 nmdc:mga0qj67_48641_c1
601 nmdc:mga0qj67_50210_c1
602 nmdc:mga06r32_142016_c1
603 nmdc:mga06r32_1566_c1
604 nmdc:mga06r32_379848_c1
605 nmdc:mga06r32_44952_c1
606 nmdc:mga06r32_45369_c1
607 nmdc:mga06r32_7264_c1
608 nmdc:mga06r32_76322_c1
609 nmdc:mga06r32_85_c1
610 nmdc:mga08y16_104003_c1
611 nmdc:mga08y16_59574_c1
612 nmdc:mga0n895_10662_c1
613 nmdc:mga0n895_461596_c1
614 nmdc:mga0n895_892682_c1
615 nmdc:mga08x19_37_c1
616 nmdc:mga0a205_473704_c1
617 nmdc:mga0a205_6152_c1
618 nmdc:mga0a205_7859_c1
619 Ga0495601_0248929
620 Ga0495612_0034901
621 Ga0495595_0020599
622 Ga0495619_0035454
623 Ga0500578_0178884
624 2993372583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

81

250

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9292 15 256
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9213 15 256
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.902 13 254
4hcj-assembly1.cif.gz_A crystal structure of thij/pfpi domain protein from brachyspira murdochii 0.8841 13 254
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.8825 13 254
ID Description Score Start End Superfamily
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9287 15 256 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9218 16 252 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9209 15 256 3.40.50.880
af_Q58377_26_203_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9135 14 254 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9099 16 252 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A355ET02-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9725 134 256 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-A0A7X3D7E6-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9709 12 254 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-C4KYU5-F1-model_v4 ThiJ/PfpI domain protein 0.9663 15 254 GO:0005737
GO:0019172
GO:0019243
AF-V7FN47-F1-model_v4 Thimanine synthesis protein ThiJ 0.9652 1 256 GO:0005737
GO:0019172
GO:0019243
AF-V7FN47-F1-model_v4 Thimanine synthesis protein ThiJ 0.9615 1 256 GO:0005737
GO:0019172
GO:0019243

Map