F401485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 245 | 244 | 187 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3002141150|3002141200 |
| Length | 202 |
| Sequence | STALPAETVMVKLNKIYTRTGDDGTTGLGSGDRRLKHDLRVEAYGTVDEANSCIGLARLYTEKEFPDIDAMLVRIQNDLFDLGADLATPDTCKKLDYEPLRIIDSQVLRVEADIDLLNEKLAPLRSFVLPGGSPASAALHLARTVARRAERHMVELVQKPDEIVTPAALKYINRVSDFLFVAARAVNDNGAKDVLWVPGKNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 4 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 5 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 6 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 7 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 8 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 9 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 10 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 11 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 12 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 13 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 14 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 15 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 16 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 17 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 18 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 19 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 20 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 21 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 22 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 23 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 24 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 25 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 26 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 27 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 28 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 29 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 30 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 31 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 32 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 33 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 34 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 35 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 36 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 37 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 38 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 39 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 40 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 41 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 42 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 43 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 44 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 45 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 46 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 47 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 48 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 49 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 50 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 51 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 52 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 53 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 54 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 55 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 56 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 57 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 58 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 59 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 60 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 61 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 62 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 63 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 64 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 65 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 67 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 68 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 71 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 73 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 237 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 238 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 239 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 241 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 242 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 243 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 244 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 245 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.46 |
| Metatranscriptomes | 0 |
| Isolates | 21.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 9.32 |
| Rhizoplane | 2.57 |
| Rhizosphere | 61.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000006 | 3300001979 | Bacteria | 86112 |
| 2 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 3 | JGI25156J39149_1000033 | 3300002705 | Bacteria | 114688 |
| 4 | JGI25156J39149_1000186 | 3300002705 | Bacteria | 45132 |
| 5 | JGI25162J39368_1000413 | 3300002737 | Bacteria | 34872 |
| 6 | JGI25154J39366_1000058 | 3300002738 | Bacteria | 107363 |
| 7 | JGI25154J39366_1000187 | 3300002738 | Bacteria | 46590 |
| 8 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 9 | JGI25151J46595_10011077 | 3300003187 | Bacteria | 4160 |
| 10 | JGI25165J46597_1000675 | 3300003214 | Bacteria | 27458 |
| 11 | rootL2_10034535 | 3300003322 | Bacteria | 3661 |
| 12 | Ga0055539_1005928 | 3300003752 | Bacteria | 1574 |
| 13 | Ga0058692_1003402 | 3300003856 | Bacteria | 4918 |
| 14 | Ga0058692_1003685 | 3300003856 | Bacteria | 4680 |
| 15 | Ga0070683_100454455 | 3300005329 | Bacteria | 1222 |
| 16 | Ga0070691_10000521 | 3300005341 | Bacteria | 14493 |
| 17 | Ga0070709_10001436 | 3300005434 | Bacteria | 12862 |
| 18 | Ga0070709_10304499 | 3300005434 | Bacteria | 1165 |
| 19 | Ga0070714_100148562 | 3300005435 | Bacteria | 2109 |
| 20 | Ga0070714_100487092 | 3300005435 | Bacteria | 1175 |
| 21 | Ga0070713_100000199 | 3300005436 | Bacteria | 40083 |
| 22 | Ga0070711_100025595 | 3300005439 | Bacteria | 3863 |
| 23 | Ga0070711_100046190 | 3300005439 | Bacteria | 2966 |
| 24 | Ga0070711_101322009 | 3300005439 | Bacteria | 626 |
| 25 | Ga0070705_100112226 | 3300005440 | Bacteria | 1744 |
| 26 | Ga0070663_100047823 | 3300005455 | Bacteria | 3031 |
| 27 | Ga0070707_100269915 | 3300005468 | Bacteria | 1654 |
| 28 | Ga0070707_100564782 | 3300005468 | Bacteria | 1100 |
| 29 | Ga0070697_100331637 | 3300005536 | Bacteria | 1312 |
| 30 | Ga0068853_100019990 | 3300005539 | Bacteria | 5563 |
| 31 | Ga0070695_100010283 | 3300005545 | Bacteria | 5584 |
| 32 | Ga0070693_100083144 | 3300005547 | Bacteria | 1913 |
| 33 | Ga0070693_100203620 | 3300005547 | Bacteria | 1287 |
| 34 | Ga0070665_100624043 | 3300005548 | Bacteria | 1091 |
| 35 | Ga0068857_100002551 | 3300005577 | Bacteria | 14915 |
| 36 | Ga0068854_100249107 | 3300005578 | Bacteria | 1418 |
| 37 | Ga0068854_100280608 | 3300005578 | Bacteria | 1341 |
| 38 | Ga0068856_100004606 | 3300005614 | Bacteria | 13715 |
| 39 | Ga0068856_100010174 | 3300005614 | Bacteria | 9143 |
| 40 | Ga0068856_100491763 | 3300005614 | Bacteria | 1248 |
| 41 | Ga0068852_100030992 | 3300005616 | Bacteria | 4407 |
| 42 | Ga0068858_100048518 | 3300005842 | Bacteria | 3934 |
| 43 | Ga0081540_1001433 | 3300005983 | Bacteria | 20635 |
| 44 | Ga0075365_10136635 | 3300006038 | Bacteria | 1699 |
| 45 | Ga0075368_10008184 | 3300006042 | Bacteria | 3716 |
| 46 | Ga0075368_10158851 | 3300006042 | Bacteria | 946 |
| 47 | Ga0070712_100013632 | 3300006175 | Bacteria | 5197 |
| 48 | Ga0070712_100155236 | 3300006175 | Bacteria | 1762 |
| 49 | Ga0075367_10030893 | 3300006178 | Bacteria | 3074 |
| 50 | Ga0075369_10058771 | 3300006186 | Bacteria | 1674 |
| 51 | Ga0075430_100260944 | 3300006846 | Bacteria | 1435 |
| 52 | Ga0075434_100065293 | 3300006871 | Bacteria | 3625 |
| 53 | Ga0075434_100150428 | 3300006871 | Bacteria | 2348 |
| 54 | Ga0075436_100006588 | 3300006914 | Bacteria | 7957 |
| 55 | Ga0099826_10004861 | 3300006948 | Bacteria | 9505 |
| 56 | Ga0099826_10016860 | 3300006948 | Bacteria | 5520 |
| 57 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 58 | Ga0105240_10054675 | 3300009093 | Bacteria | 5002 |
| 59 | Ga0105243_10252111 | 3300009148 | Bacteria | 1576 |
| 60 | Ga0105241_10020835 | 3300009174 | Bacteria | 4846 |
| 61 | Ga0105241_10025795 | 3300009174 | Bacteria | 4369 |
| 62 | Ga0105248_10828238 | 3300009177 | Bacteria | 1044 |
| 63 | Ga0105237_10008030 | 3300009545 | Bacteria | 11482 |
| 64 | Ga0105237_10014957 | 3300009545 | Bacteria | 8089 |
| 65 | Ga0105238_10005724 | 3300009551 | Bacteria | 12287 |
| 66 | Ga0105239_10014384 | 3300010375 | Bacteria | 8779 |
| 67 | Ga0157373_10143042 | 3300013100 | Bacteria | 1682 |
| 68 | Ga0157370_10006398 | 3300013104 | Bacteria | 12990 |
| 69 | Ga0157370_10020300 | 3300013104 | Bacteria | 6636 |
| 70 | Ga0157369_10357325 | 3300013105 | Bacteria | 1517 |
| 71 | Ga0157374_10503636 | 3300013296 | Bacteria | 1216 |
| 72 | Ga0157378_10033076 | 3300013297 | Bacteria | 4570 |
| 73 | Ga0163162_10680648 | 3300013306 | Bacteria | 1151 |
| 74 | Ga0163162_11114346 | 3300013306 | Bacteria | 894 |
| 75 | Ga0157372_10028084 | 3300013307 | Bacteria | 6137 |
| 76 | Ga0163163_10343841 | 3300014325 | Bacteria | 1547 |
| 77 | Ga0182008_10291762 | 3300014497 | Bacteria | 851 |
| 78 | Ga0157379_10001860 | 3300014968 | Bacteria | 17473 |
| 79 | Ga0157379_10018635 | 3300014968 | Bacteria | 6120 |
| 80 | Ga0157379_10052091 | 3300014968 | Bacteria | 3655 |
| 81 | Ga0182007_10002724 | 3300015262 | Bacteria | 8647 |
| 82 | Ga0182005_1031683 | 3300015265 | Bacteria | 1440 |
| 83 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 84 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 85 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 86 | Ga0209646_1025538 | 3300025246 | Bacteria | 824 |
| 87 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 88 | Ga0209677_100629 | 3300025253 | Bacteria | 18933 |
| 89 | Ga0209148_1023078 | 3300025254 | Bacteria | 993 |
| 90 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 91 | Ga0209759_1026980 | 3300025256 | Bacteria | 1194 |
| 92 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 93 | Ga0209233_1000353 | 3300025261 | Bacteria | 42997 |
| 94 | Ga0209455_1016472 | 3300025272 | Bacteria | 1587 |
| 95 | Ga0209025_1000581 | 3300025294 | Bacteria | 66321 |
| 96 | Ga0209025_1060852 | 3300025294 | Bacteria | 1414 |
| 97 | Ga0207699_10000124 | 3300025906 | Bacteria | 54948 |
| 98 | Ga0207699_10176715 | 3300025906 | Bacteria | 1432 |
| 99 | Ga0207699_10211652 | 3300025906 | Bacteria | 1319 |
| 100 | Ga0207654_10022969 | 3300025911 | Bacteria | 3335 |
| 101 | Ga0207654_10029205 | 3300025911 | Bacteria | 3015 |
| 102 | Ga0207671_10000364 | 3300025914 | Bacteria | 64550 |
| 103 | Ga0207671_10005935 | 3300025914 | Bacteria | 11071 |
| 104 | Ga0207693_10006235 | 3300025915 | Bacteria | 9892 |
| 105 | Ga0207693_10101597 | 3300025915 | Bacteria | 2255 |
| 106 | Ga0207663_10003545 | 3300025916 | Bacteria | 7653 |
| 107 | Ga0207663_10016101 | 3300025916 | Bacteria | 4138 |
| 108 | Ga0207694_10030459 | 3300025924 | Bacteria | 4121 |
| 109 | Ga0207700_10000026 | 3300025928 | Bacteria | 139690 |
| 110 | Ga0207664_10116458 | 3300025929 | Bacteria | 2230 |
| 111 | Ga0207664_10123941 | 3300025929 | Bacteria | 2167 |
| 112 | Ga0207709_10050313 | 3300025935 | Bacteria | 2548 |
| 113 | Ga0207661_10687316 | 3300025944 | Bacteria | 941 |
| 114 | Ga0207667_10041930 | 3300025949 | Bacteria | 4867 |
| 115 | Ga0207640_10123355 | 3300025981 | Bacteria | 1860 |
| 116 | Ga0207640_10254003 | 3300025981 | Bacteria | 1366 |
| 117 | Ga0207658_10086500 | 3300025986 | Bacteria | 2418 |
| 118 | Ga0207703_10030660 | 3300026035 | Bacteria | 4251 |
| 119 | Ga0207678_10663389 | 3300026067 | Bacteria | 917 |
| 120 | Ga0207702_10000021 | 3300026078 | Bacteria | 196115 |
| 121 | Ga0207702_10417400 | 3300026078 | Bacteria | 1297 |
| 122 | Ga0207676_10722180 | 3300026095 | Bacteria | 967 |
| 123 | Ga0207674_10000898 | 3300026116 | Bacteria | 38900 |
| 124 | Ga0209371_1000996 | 3300027312 | Bacteria | 21749 |
| 125 | Ga0209371_1001537 | 3300027312 | Bacteria | 15275 |
| 126 | Ga0209282_1003524 | 3300027666 | Bacteria | 9310 |
| 127 | Ga0209282_1030549 | 3300027666 | Bacteria | 3314 |
| 128 | Ga0265318_10000115 | 3300028577 | Bacteria | 74110 |
| 129 | Ga0265338_10019251 | 3300028800 | Bacteria | 7260 |
| 130 | Ga0265338_10093376 | 3300028800 | Bacteria | 2479 |
| 131 | Ga0265338_10440474 | 3300028800 | Bacteria | 924 |
| 132 | Ga0268256_1000728 | 3300030500 | Bacteria | 24256 |
| 133 | Ga0268256_1001520 | 3300030500 | Bacteria | 13708 |
| 134 | Ga0265328_10000085 | 3300031239 | Bacteria | 48380 |
| 135 | Ga0265320_10000477 | 3300031240 | Bacteria | 31277 |
| 136 | Ga0265325_10000067 | 3300031241 | Bacteria | 72846 |
| 137 | Ga0265340_10034608 | 3300031247 | Bacteria | 2511 |
| 138 | Ga0265339_10002397 | 3300031249 | Bacteria | 13434 |
| 139 | Ga0265339_10030163 | 3300031249 | Bacteria | 3072 |
| 140 | Ga0265331_10056729 | 3300031250 | Bacteria | 1859 |
| 141 | Ga0265316_10008995 | 3300031344 | Bacteria | 9211 |
| 142 | Ga0265316_10152654 | 3300031344 | Bacteria | 1730 |
| 143 | Ga0307513_10055409 | 3300031456 | Bacteria | 4243 |
| 144 | Ga0307408_100893362 | 3300031548 | Bacteria | 813 |
| 145 | Ga0265313_10002160 | 3300031595 | Bacteria | 17462 |
| 146 | Ga0265314_10011835 | 3300031711 | Bacteria | 7167 |
| 147 | Ga0265314_10074190 | 3300031711 | Bacteria | 2266 |
| 148 | Ga0265314_10296199 | 3300031711 | Bacteria | 909 |
| 149 | Ga0265342_10082003 | 3300031712 | Bacteria | 1862 |
| 150 | Ga0265342_10124080 | 3300031712 | Bacteria | 1452 |
| 151 | Ga0307516_10185565 | 3300031730 | Bacteria | 1810 |
| 152 | Ga0307405_11043531 | 3300031731 | Bacteria | 700 |
| 153 | Ga0307410_10495974 | 3300031852 | Bacteria | 1004 |
| 154 | Ga0307409_100571853 | 3300031995 | Bacteria | 1113 |
| 155 | Ga0307409_100928455 | 3300031995 | Bacteria | 885 |
| 156 | Ga0373926_0132188 | 3300035083 | Bacteria | 945 |
| 157 | Ga0373944_0037474 | 3300035089 | Bacteria | 1485 |
| 158 | Ga0373932_0063067 | 3300035112 | Bacteria | 1131 |
| 159 | Ga0373943_0019854 | 3300035170 | Bacteria | 3094 |
| 160 | Ga0373946_0140116 | 3300035171 | Bacteria | 1120 |
| 161 | Ga0373955_0008291 | 3300035172 | Bacteria | 4820 |
| 162 | Ga0373935_0006310 | 3300035692 | Bacteria | 7065 |
| 163 | Ga0373935_0074770 | 3300035692 | Bacteria | 2191 |
| 164 | Ga0373927_0331310 | 3300035695 | Bacteria | 1003 |
| 165 | Ga0373933_0050112 | 3300035724 | Bacteria | 2491 |
| 166 | Ga0373933_0203032 | 3300035724 | Bacteria | 1269 |
| 167 | Ga0373947_0003799 | 3300035725 | Bacteria | 8905 |
| 168 | Ga0373947_0127568 | 3300035725 | Bacteria | 1622 |
| 169 | Ga0373947_0429397 | 3300035725 | Bacteria | 893 |
| 170 | Ga0373937_0000477 | 3300036401 | Bacteria | 36794 |
| 171 | Ga0373937_0539866 | 3300036401 | Bacteria | 1108 |
| 172 | Ga0373937_1019240 | 3300036401 | Bacteria | 776 |
| 173 | Ga0373925_0001546 | 3300037068 | Bacteria | 19580 |
| 174 | Ga0373925_0079589 | 3300037068 | Bacteria | 2490 |
| 175 | Ga0373925_0302634 | 3300037068 | Bacteria | 1291 |
| 176 | Ga0395899_0000107 | 3300037312 | Bacteria | 144087 |
| 177 | Ga0395900_0000101 | 3300037418 | Bacteria | 153550 |
| 178 | Ga0395900_0292634 | 3300037418 | Bacteria | 1617 |
| 179 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 180 | Ga0395905_0000101 | 3300037471 | Bacteria | 144115 |
| 181 | Ga0395901_0000068 | 3300038443 | Bacteria | 144095 |
| 182 | Ga0395901_0138022 | 3300038443 | Bacteria | 2563 |
| 183 | Ga0436365_0186666 | 3300039437 | Bacteria | 1085 |
| 184 | Ga0436365_0772433 | 3300039437 | Bacteria | 2583 |
| 185 | Ga0436365_1070125 | 3300039437 | Bacteria | 29375 |
| 186 | Ga0466963_0074512 | 3300044694 | Bacteria | 2289 |
| 187 | Ga0466971_0307571 | 3300044719 | Bacteria | 762 |
| 188 | Ga0466970_0008038 | 3300044765 | Bacteria | 5295 |
| 189 | Ga0466959_0394320 | 3300045049 | Bacteria | 941 |
| 190 | Ga0466958_0030801 | 3300045836 | Bacteria | 3188 |
| 191 | Ga0495629_0174860 | 3300046459 | Bacteria | 1489 |
| 192 | Ga0495580_0033396 | 3300046472 | Bacteria | 3708 |
| 193 | Ga0495580_0066436 | 3300046472 | Bacteria | 2524 |
| 194 | Ga0495664_0595254 | 3300046477 | Bacteria | 657 |
| 195 | Ga0495625_0031485 | 3300046660 | Bacteria | 3945 |
| 196 | Ga0495588_0001014 | 3300046674 | Bacteria | 12199 |
| 197 | Ga0495623_0145289 | 3300046679 | Bacteria | 1407 |
| 198 | Ga0495658_0007243 | 3300046683 | Bacteria | 5482 |
| 199 | Ga0495613_0337493 | 3300046689 | Bacteria | 1037 |
| 200 | Ga0495581_0467119 | 3300047315 | Bacteria | 734 |
| 201 | Ga0495674_0061971 | 3300047319 | Bacteria | 3258 |
| 202 | Ga0495681_0015189 | 3300047470 | Bacteria | 4367 |
| 203 | Ga0495602_0098133 | 3300048088 | Bacteria | 2412 |
| 204 | Ga0496100_0061578 | 3300048903 | Bacteria | 2473 |
| 205 | Ga0496103_0294871 | 3300048906 | Bacteria | 1043 |
| 206 | Ga0496110_0673196 | 3300048913 | Bacteria | 935 |
| 207 | Ga0496116_0021780 | 3300048919 | Bacteria | 4824 |
| 208 | Ga0496117_0047305 | 3300048920 | Bacteria | 3086 |
| 209 | Ga0496118_0019261 | 3300048921 | Bacteria | 6108 |
| 210 | Ga0496119_0017910 | 3300048922 | Bacteria | 5304 |
| 211 | Ga0496119_0040907 | 3300048922 | Bacteria | 2958 |
| 212 | Ga0496120_0038778 | 3300048923 | Bacteria | 2816 |
| 213 | Ga0496121_0006814 | 3300048924 | Bacteria | 13991 |
| 214 | Ga0496121_0407047 | 3300048924 | Bacteria | 889 |
| 215 | Ga0496123_0013339 | 3300048926 | Bacteria | 6911 |
| 216 | Ga0496124_0013703 | 3300048927 | Bacteria | 7896 |
| 217 | Ga0496124_0084160 | 3300048927 | Bacteria | 2609 |
| 218 | Ga0496125_0046864 | 3300048928 | Bacteria | 3622 |
| 219 | Ga0496125_0160779 | 3300048928 | Bacteria | 1526 |
| 220 | Ga0501038_0044495 | 3300049574 | Bacteria | 3856 |
| 221 | Ga0501047_0690305 | 3300049581 | Bacteria | 839 |
| 222 | Ga0501067_0338306 | 3300049583 | Bacteria | 839 |
| 223 | Ga0501070_0100289 | 3300049586 | Bacteria | 2395 |
| 224 | Ga0501074_0653548 | 3300049590 | Bacteria | 743 |
| 225 | Ga0501080_1130697 | 3300049742 | Bacteria | 675 |
| 226 | Ga0501081_0625083 | 3300049743 | Bacteria | 807 |
| 227 | Ga0501280_003445 | 3300049776 | Bacteria | 2433 |
| 228 | nmdc:mga00v17_202747_c1 | 3300050491 | Bacteria | 1282 |
| 229 | nmdc:mga0yw44_353544_c1 | 3300050492 | Bacteria | 989 |
| 230 | nmdc:mga06z11_20784_c1 | 3300050494 | Bacteria | 3040 |
| 231 | nmdc:mga04h51_3830_c1 | 3300050495 | Bacteria | 3693 |
| 232 | nmdc:mga0qj67_266178_c1 | 3300050509 | Bacteria | 1390 |
| 233 | nmdc:mga0n895_21759_c1 | 3300050512 | Bacteria | 6002 |
| 234 | nmdc:mga0n895_92286_c1 | 3300050512 | Bacteria | 3031 |
| 235 | nmdc:mga0rr50_14023_c1 | 3300050513 | Bacteria | 5240 |
| 236 | nmdc:mga08x19_54_c1 | 3300050514 | Bacteria | 121662 |
| 237 | nmdc:mga0sz30_35204_c1 | 3300050516 | Bacteria | 2088 |
| 238 | nmdc:mga0sz30_52420_c2 | 3300050516 | Bacteria | 1068 |
| 239 | Ga0500643_043218 | 3300053087 | Bacteria | 1315 |
| 240 | Ga0500651_0112391 | 3300053093 | Bacteria | 1661 |
| 241 | Ga0500560_000603 | 3300053107 | Bacteria | 5231 |
| 242 | Ga0500616_0099629 | 3300053153 | Bacteria | 1423 |
| 243 | Ga0500624_012080 | 3300053157 | Bacteria | 1271 |
| 244 | Ga0501084_0000366 | 3300054114 | Bacteria | 34534 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0539866 | Ga0373937_0539866_19_582 | 162 |
| 2 | 3300047470 | Ga0495681_0015189 | Ga0495681_0015189_3299_3877 | 165 |
| 3 | 3300009148 | Ga0105243_10252111 | Ga0105243_102521112 | 167 |
| 4 | 3300003322 | rootL2_10034535 | rootL2_100345351 | 168 |
| 5 | 3300009545 | Ga0105237_10008030 | Ga0105237_1000803013 | 168 |
| 6 | 3300046674 | Ga0495588_0001014 | Ga0495588_0001014_9294_9872 | 168 |
| 7 | 3300048926 | Ga0496123_0013339 | Ga0496123_0013339_2439_3017 | 168 |
| 8 | iso_pu_bacteria | 2902330777 | 2902336626 | 168 |
| 9 | 3300005329 | Ga0070683_100454455 | Ga0070683_1004544552 | 169 |
| 10 | 3300005341 | Ga0070691_10000521 | Ga0070691_100005211 | 169 |
| 11 | 3300005434 | Ga0070709_10001436 | Ga0070709_1000143612 | 169 |
| 12 | 3300005434 | Ga0070709_10304499 | Ga0070709_103044993 | 169 |
| 13 | 3300005435 | Ga0070714_100148562 | Ga0070714_1001485623 | 169 |
| 14 | 3300005435 | Ga0070714_100487092 | Ga0070714_1004870922 | 169 |
| 15 | 3300005436 | Ga0070713_100000199 | Ga0070713_10000019927 | 169 |
| 16 | 3300005439 | Ga0070711_100025595 | Ga0070711_1000255953 | 169 |
| 17 | 3300005439 | Ga0070711_100046190 | Ga0070711_1000461903 | 169 |
| 18 | 3300005439 | Ga0070711_101322009 | Ga0070711_1013220091 | 169 |
| 19 | 3300005440 | Ga0070705_100112226 | Ga0070705_1001122263 | 169 |
| 20 | 3300005468 | Ga0070707_100564782 | Ga0070707_1005647823 | 169 |
| 21 | 3300005536 | Ga0070697_100331637 | Ga0070697_1003316372 | 169 |
| 22 | 3300005539 | Ga0068853_100019990 | Ga0068853_1000199905 | 169 |
| 23 | 3300005545 | Ga0070695_100010283 | Ga0070695_1000102833 | 169 |
| 24 | 3300005547 | Ga0070693_100083144 | Ga0070693_1000831443 | 169 |
| 25 | 3300005547 | Ga0070693_100203620 | Ga0070693_1002036202 | 169 |
| 26 | 3300005548 | Ga0070665_100624043 | Ga0070665_1006240432 | 169 |
| 27 | 3300005577 | Ga0068857_100002551 | Ga0068857_10000255110 | 169 |
| 28 | 3300005578 | Ga0068854_100249107 | Ga0068854_1002491073 | 169 |
| 29 | 3300005614 | Ga0068856_100004606 | Ga0068856_10000460610 | 169 |
| 30 | 3300005614 | Ga0068856_100010174 | Ga0068856_1000101742 | 169 |
| 31 | 3300005616 | Ga0068852_100030992 | Ga0068852_1000309923 | 169 |
| 32 | 3300005842 | Ga0068858_100048518 | Ga0068858_1000485184 | 169 |
| 33 | 3300006175 | Ga0070712_100013632 | Ga0070712_1000136323 | 169 |
| 34 | 3300006175 | Ga0070712_100155236 | Ga0070712_1001552362 | 169 |
| 35 | 3300006846 | Ga0075430_100260944 | Ga0075430_1002609442 | 169 |
| 36 | 3300006871 | Ga0075434_100065293 | Ga0075434_1000652933 | 169 |
| 37 | 3300006871 | Ga0075434_100150428 | Ga0075434_1001504283 | 169 |
| 38 | 3300006914 | Ga0075436_100006588 | Ga0075436_1000065888 | 169 |
| 39 | 3300009093 | Ga0105240_10000013 | Ga0105240_1000001344 | 169 |
| 40 | 3300009093 | Ga0105240_10054675 | Ga0105240_100546753 | 169 |
| 41 | 3300009174 | Ga0105241_10020835 | Ga0105241_100208354 | 169 |
| 42 | 3300009174 | Ga0105241_10025795 | Ga0105241_100257953 | 169 |
| 43 | 3300009177 | Ga0105248_10828238 | Ga0105248_108282381 | 169 |
| 44 | 3300009545 | Ga0105237_10014957 | Ga0105237_100149573 | 169 |
| 45 | 3300009551 | Ga0105238_10005724 | Ga0105238_100057249 | 169 |
| 46 | 3300013104 | Ga0157370_10006398 | Ga0157370_1000639812 | 169 |
| 47 | 3300013104 | Ga0157370_10020300 | Ga0157370_100203003 | 169 |
| 48 | 3300013105 | Ga0157369_10357325 | Ga0157369_103573251 | 169 |
| 49 | 3300013296 | Ga0157374_10503636 | Ga0157374_105036361 | 169 |
| 50 | 3300013297 | Ga0157378_10033076 | Ga0157378_100330763 | 169 |
| 51 | 3300013306 | Ga0163162_10680648 | Ga0163162_106806481 | 169 |
| 52 | 3300013307 | Ga0157372_10028084 | Ga0157372_100280845 | 169 |
| 53 | 3300014325 | Ga0163163_10343841 | Ga0163163_103438411 | 169 |
| 54 | 3300014497 | Ga0182008_10291762 | Ga0182008_102917622 | 169 |
| 55 | 3300014968 | Ga0157379_10001860 | Ga0157379_100018608 | 169 |
| 56 | 3300014968 | Ga0157379_10018635 | Ga0157379_100186356 | 169 |
| 57 | 3300014968 | Ga0157379_10052091 | Ga0157379_100520914 | 169 |
| 58 | 3300015262 | Ga0182007_10002724 | Ga0182007_100027246 | 169 |
| 59 | 3300015265 | Ga0182005_1031683 | Ga0182005_10316831 | 169 |
| 60 | 3300025906 | Ga0207699_10000124 | Ga0207699_1000012419 | 169 |
| 61 | 3300025906 | Ga0207699_10176715 | Ga0207699_101767153 | 169 |
| 62 | 3300025906 | Ga0207699_10211652 | Ga0207699_102116522 | 169 |
| 63 | 3300025911 | Ga0207654_10022969 | Ga0207654_100229693 | 169 |
| 64 | 3300025911 | Ga0207654_10029205 | Ga0207654_100292053 | 169 |
| 65 | 3300025914 | Ga0207671_10005935 | Ga0207671_100059358 | 169 |
| 66 | 3300025915 | Ga0207693_10006235 | Ga0207693_100062359 | 169 |
| 67 | 3300025915 | Ga0207693_10101597 | Ga0207693_101015972 | 169 |
| 68 | 3300025916 | Ga0207663_10003545 | Ga0207663_100035456 | 169 |
| 69 | 3300025916 | Ga0207663_10016101 | Ga0207663_100161015 | 169 |
| 70 | 3300025924 | Ga0207694_10030459 | Ga0207694_100304593 | 169 |
| 71 | 3300025928 | Ga0207700_10000026 | Ga0207700_10000026135 | 169 |
| 72 | 3300025929 | Ga0207664_10116458 | Ga0207664_101164583 | 169 |
| 73 | 3300025929 | Ga0207664_10123941 | Ga0207664_101239413 | 169 |
| 74 | 3300025944 | Ga0207661_10687316 | Ga0207661_106873161 | 169 |
| 75 | 3300025949 | Ga0207667_10041930 | Ga0207667_100419303 | 169 |
| 76 | 3300025981 | Ga0207640_10123355 | Ga0207640_101233553 | 169 |
| 77 | 3300026035 | Ga0207703_10030660 | Ga0207703_100306604 | 169 |
| 78 | 3300026078 | Ga0207702_10000021 | Ga0207702_10000021112 | 169 |
| 79 | 3300026116 | Ga0207674_10000898 | Ga0207674_100008989 | 169 |
| 80 | 3300028577 | Ga0265318_10000115 | Ga0265318_1000011525 | 169 |
| 81 | 3300028800 | Ga0265338_10019251 | Ga0265338_100192515 | 169 |
| 82 | 3300028800 | Ga0265338_10093376 | Ga0265338_100933762 | 169 |
| 83 | 3300028800 | Ga0265338_10440474 | Ga0265338_104404741 | 169 |
| 84 | 3300031240 | Ga0265320_10000477 | Ga0265320_1000047719 | 169 |
| 85 | 3300031241 | Ga0265325_10000067 | Ga0265325_100000675 | 169 |
| 86 | 3300031247 | Ga0265340_10034608 | Ga0265340_100346085 | 169 |
| 87 | 3300031249 | Ga0265339_10002397 | Ga0265339_100023979 | 169 |
| 88 | 3300031249 | Ga0265339_10030163 | Ga0265339_100301633 | 169 |
| 89 | 3300031250 | Ga0265331_10056729 | Ga0265331_100567291 | 169 |
| 90 | 3300031344 | Ga0265316_10008995 | Ga0265316_100089954 | 169 |
| 91 | 3300031344 | Ga0265316_10152654 | Ga0265316_101526542 | 169 |
| 92 | 3300031595 | Ga0265313_10002160 | Ga0265313_100021606 | 169 |
| 93 | 3300031711 | Ga0265314_10011835 | Ga0265314_100118355 | 169 |
| 94 | 3300031711 | Ga0265314_10074190 | Ga0265314_100741903 | 169 |
| 95 | 3300031711 | Ga0265314_10296199 | Ga0265314_102961991 | 169 |
| 96 | 3300031712 | Ga0265342_10082003 | Ga0265342_100820033 | 169 |
| 97 | 3300031712 | Ga0265342_10124080 | Ga0265342_101240802 | 169 |
| 98 | 3300035083 | Ga0373926_0132188 | Ga0373926_0132188_169_732 | 169 |
| 99 | 3300035089 | Ga0373944_0037474 | Ga0373944_0037474_434_997 | 169 |
| 100 | 3300035112 | Ga0373932_0063067 | Ga0373932_0063067_460_1023 | 169 |
| 101 | 3300035170 | Ga0373943_0019854 | Ga0373943_0019854_2170_2733 | 169 |
| 102 | 3300035171 | Ga0373946_0140116 | Ga0373946_0140116_356_919 | 169 |
| 103 | 3300035172 | Ga0373955_0008291 | Ga0373955_0008291_2758_3321 | 169 |
| 104 | 3300035692 | Ga0373935_0006310 | Ga0373935_0006310_1735_2298 | 169 |
| 105 | 3300035692 | Ga0373935_0074770 | Ga0373935_0074770_1338_1970 | 169 |
| 106 | 3300035695 | Ga0373927_0331310 | Ga0373927_0331310_147_710 | 169 |
| 107 | 3300035724 | Ga0373933_0050112 | Ga0373933_0050112_1665_2228 | 169 |
| 108 | 3300035724 | Ga0373933_0203032 | Ga0373933_0203032_695_1258 | 169 |
| 109 | 3300035725 | Ga0373947_0003799 | Ga0373947_0003799_770_1333 | 169 |
| 110 | 3300035725 | Ga0373947_0127568 | Ga0373947_0127568_368_931 | 169 |
| 111 | 3300035725 | Ga0373947_0429397 | Ga0373947_0429397_273_836 | 169 |
| 112 | 3300036401 | Ga0373937_0000477 | Ga0373937_0000477_17385_17948 | 169 |
| 113 | 3300036401 | Ga0373937_1019240 | Ga0373937_1019240_30_593 | 169 |
| 114 | 3300037068 | Ga0373925_0001546 | Ga0373925_0001546_16725_17288 | 169 |
| 115 | 3300037068 | Ga0373925_0079589 | Ga0373925_0079589_1432_2064 | 169 |
| 116 | 3300037068 | Ga0373925_0302634 | Ga0373925_0302634_470_1033 | 169 |
| 117 | 3300037418 | Ga0395900_0292634 | Ga0395900_0292634_559_1122 | 169 |
| 118 | 3300038443 | Ga0395901_0138022 | Ga0395901_0138022_1319_1882 | 169 |
| 119 | 3300039437 | Ga0436365_0186666 | Ga0436365_0186666_506_1069 | 169 |
| 120 | 3300039437 | Ga0436365_0772433 | Ga0436365_0772433_620_1183 | 169 |
| 121 | 3300039437 | Ga0436365_1070125 | Ga0436365_1070125_14236_14799 | 169 |
| 122 | 3300046459 | Ga0495629_0174860 | Ga0495629_0174860_95_658 | 169 |
| 123 | 3300046472 | Ga0495580_0033396 | Ga0495580_0033396_1839_2402 | 169 |
| 124 | 3300046472 | Ga0495580_0066436 | Ga0495580_0066436_292_855 | 169 |
| 125 | 3300046477 | Ga0495664_0595254 | Ga0495664_0595254_52_615 | 169 |
| 126 | 3300046679 | Ga0495623_0145289 | Ga0495623_0145289_641_1204 | 169 |
| 127 | 3300046683 | Ga0495658_0007243 | Ga0495658_0007243_1018_1581 | 169 |
| 128 | 3300046689 | Ga0495613_0337493 | Ga0495613_0337493_281_844 | 169 |
| 129 | 3300047315 | Ga0495581_0467119 | Ga0495581_0467119_78_641 | 169 |
| 130 | 3300047319 | Ga0495674_0061971 | Ga0495674_0061971_1273_1836 | 169 |
| 131 | 3300048088 | Ga0495602_0098133 | Ga0495602_0098133_1376_1939 | 169 |
| 132 | 3300048906 | Ga0496103_0294871 | Ga0496103_0294871_97_660 | 169 |
| 133 | 3300048913 | Ga0496110_0673196 | Ga0496110_0673196_279_842 | 169 |
| 134 | 3300049574 | Ga0501038_0044495 | Ga0501038_0044495_2806_3369 | 169 |
| 135 | 3300049583 | Ga0501067_0338306 | Ga0501067_0338306_123_686 | 169 |
| 136 | 3300049586 | Ga0501070_0100289 | Ga0501070_0100289_949_1512 | 169 |
| 137 | 3300049743 | Ga0501081_0625083 | Ga0501081_0625083_80_643 | 169 |
| 138 | 3300050509 | nmdc:mga0qj67_266178_c1 | nmdc:mga0qj67_266178_c1_544_1107 | 169 |
| 139 | 3300050512 | nmdc:mga0n895_21759_c1 | nmdc:mga0n895_21759_c1_2719_3282 | 169 |
| 140 | 3300050512 | nmdc:mga0n895_92286_c1 | nmdc:mga0n895_92286_c1_1883_2446 | 169 |
| 141 | 3300050513 | nmdc:mga0rr50_14023_c1 | nmdc:mga0rr50_14023_c1_909_1472 | 169 |
| 142 | 3300050514 | nmdc:mga08x19_54_c1 | nmdc:mga08x19_54_c1_1465_2028 | 169 |
| 143 | 3300050516 | nmdc:mga0sz30_52420_c2 | nmdc:mga0sz30_52420_c2_42_605 | 169 |
| 144 | 3300054114 | Ga0501084_0000366 | Ga0501084_0000366_25989_26552 | 169 |
| 145 | 3300003752 | Ga0055539_1005928 | Ga0055539_10059283 | 170 |
| 146 | 3300003856 | Ga0058692_1003402 | Ga0058692_10034025 | 170 |
| 147 | 3300005468 | Ga0070707_100269915 | Ga0070707_1002699152 | 170 |
| 148 | 3300005578 | Ga0068854_100280608 | Ga0068854_1002806082 | 170 |
| 149 | 3300010375 | Ga0105239_10014384 | Ga0105239_100143842 | 170 |
| 150 | 3300025253 | Ga0209677_100629 | Ga0209677_1006293 | 170 |
| 151 | 3300025256 | Ga0209759_1026980 | Ga0209759_10269802 | 170 |
| 152 | 3300025261 | Ga0209233_1000353 | Ga0209233_100035343 | 170 |
| 153 | 3300025914 | Ga0207671_10000364 | Ga0207671_1000036418 | 170 |
| 154 | 3300025981 | Ga0207640_10254003 | Ga0207640_102540032 | 170 |
| 155 | 3300025986 | Ga0207658_10086500 | Ga0207658_100865003 | 170 |
| 156 | 3300027312 | Ga0209371_1001537 | Ga0209371_10015372 | 170 |
| 157 | 3300030500 | Ga0268256_1000728 | Ga0268256_10007282 | 170 |
| 158 | 3300048903 | Ga0496100_0061578 | Ga0496100_0061578_242_820 | 170 |
| 159 | 3300048924 | Ga0496121_0006814 | Ga0496121_0006814_8732_9310 | 170 |
| 160 | 3300048927 | Ga0496124_0013703 | Ga0496124_0013703_6780_7358 | 170 |
| 161 | 3300049581 | Ga0501047_0690305 | Ga0501047_0690305_73_645 | 170 |
| 162 | 3300049742 | Ga0501080_1130697 | Ga0501080_1130697_36_608 | 170 |
| 163 | 3300053107 | Ga0500560_000603 | Ga0500560_000603_2529_3107 | 170 |
| 164 | iso_pu_bacteria | 2585427634 | 2586002206 | 170 |
| 165 | 3300025254 | Ga0209148_1023078 | Ga0209148_10230781 | 171 |
| 166 | iso_pu_bacteria | 2510461069 | 2510843507 | 172 |
| 167 | iso_pu_bacteria | 2511231027 | 2511392244 | 172 |
| 168 | iso_pu_bacteria | 2537561587 | 2537874183 | 172 |
| 169 | iso_pu_bacteria | 2554235003 | 2554245310 | 172 |
| 170 | iso_pu_bacteria | 2558860242 | 2559296860 | 172 |
| 171 | iso_pu_bacteria | 2599185210 | 2599604550 | 172 |
| 172 | iso_pu_bacteria | 2600255279 | 2601610259 | 172 |
| 173 | iso_pu_bacteria | 2600255308 | 2601747411 | 172 |
| 174 | iso_pu_bacteria | 2615840698 | 2616557762 | 172 |
| 175 | iso_pu_bacteria | 2643221558 | 2643813592 | 172 |
| 176 | iso_pu_bacteria | 2643221582 | 2643917053 | 172 |
| 177 | iso_pu_bacteria | 2643221653 | 2644300049 | 172 |
| 178 | iso_pu_bacteria | 2643221693 | 2644520989 | 172 |
| 179 | iso_pu_bacteria | 2643221719 | 2644658275 | 172 |
| 180 | iso_pu_bacteria | 2765235802 | 2765467925 | 172 |
| 181 | iso_pu_bacteria | 2767802442 | 2770198576 | 172 |
| 182 | iso_pu_bacteria | 2775506902 | 2776270106 | 172 |
| 183 | iso_pu_bacteria | 2775506904 | 2776281231 | 172 |
| 184 | iso_pu_bacteria | 2808606387 | 2808987318 | 172 |
| 185 | iso_pu_bacteria | 2818991272 | 2819243618 | 172 |
| 186 | iso_pu_bacteria | 2838029111 | 2838030762 | 172 |
| 187 | iso_pu_bacteria | 2838675328 | 2838678149 | 172 |
| 188 | iso_pu_bacteria | 2838714209 | 2838716944 | 172 |
| 189 | iso_pu_bacteria | 2838719591 | 2838722445 | 172 |
| 190 | iso_pu_bacteria | 2838724970 | 2838727694 | 172 |
| 191 | iso_pu_bacteria | 2839993093 | 2839997888 | 172 |
| 192 | iso_pu_bacteria | 2840764183 | 2840765525 | 172 |
| 193 | iso_pu_bacteria | 2841846520 | 2841849350 | 172 |
| 194 | iso_pu_bacteria | 2842124991 | 2842127901 | 172 |
| 195 | iso_pu_bacteria | 2842130223 | 2842133042 | 172 |
| 196 | iso_pu_bacteria | 2842152218 | 2842155036 | 172 |
| 197 | iso_pu_bacteria | 2842170452 | 2842173535 | 172 |
| 198 | iso_pu_bacteria | 2842175837 | 2842178657 | 172 |
| 199 | iso_pu_bacteria | 2842187318 | 2842190052 | 172 |
| 200 | iso_pu_bacteria | 2842211629 | 2842214366 | 172 |
| 201 | iso_pu_bacteria | 2842224351 | 2842227085 | 172 |
| 202 | iso_pu_bacteria | 2842475841 | 2842477494 | 172 |
| 203 | iso_pu_bacteria | 2842502639 | 2842504633 | 172 |
| 204 | iso_pu_bacteria | 2842509118 | 2842511886 | 172 |
| 205 | iso_pu_bacteria | 2842871566 | 2842875877 | 172 |
| 206 | iso_pu_bacteria | 2876392853 | 2876396149 | 172 |
| 207 | iso_pu_bacteria | 2899792073 | 2899792719 | 172 |
| 208 | iso_pu_bacteria | 2899845264 | 2899845603 | 172 |
| 209 | iso_pu_bacteria | 2904659560 | 2904662925 | 172 |
| 210 | iso_pu_bacteria | 2919114240 | 2919117201 | 172 |
| 211 | iso_pu_bacteria | 2926754445 | 2926758649 | 172 |
| 212 | iso_pu_bacteria | 2926760298 | 2926763817 | 172 |
| 213 | iso_pu_bacteria | 2928521798 | 2928526638 | 172 |
| 214 | iso_pu_bacteria | 2933006813 | 2933009584 | 172 |
| 215 | iso_pu_bacteria | 2933594066 | 2933595563 | 172 |
| 216 | iso_pu_bacteria | 2954011201 | 2954013372 | 172 |
| 217 | iso_pu_bacteria | 2961114664 | 2961117951 | 172 |
| 218 | iso_pu_bacteria | 2968110612 | 2968114012 | 172 |
| 219 | iso_pu_bacteria | 2979089926 | 2979091141 | 172 |
| 220 | iso_pu_bacteria | 2979095461 | 2979096667 | 172 |
| 221 | iso_pu_bacteria | 2989776772 | 2989779891 | 172 |
| 222 | iso_pu_bacteria | 2996336353 | 2996341280 | 172 |
| 223 | iso_pu_bacteria | 3003930520 | 3003930852 | 172 |
| 224 | iso_pu_bacteria | 650716007 | 650843283 | 172 |
| 225 | iso_pu_bacteria | 8003570095 | 8003572860 | 172 |
| 226 | iso_pu_bacteria | 8005658619 | 8005660642 | 172 |
| 227 | iso_pu_bacteria | 8005682033 | 8005687633 | 172 |
| 228 | iso_pu_bacteria | 8018150411 | 8018154552 | 172 |
| 229 | iso_pu_bacteria | 8055431914 | 8055435751 | 172 |
| 230 | 3300002704 | JGI25155J39150_1000010 | JGI25155J39150_1000010168 | 174 |
| 231 | 3300002705 | JGI25156J39149_1000033 | JGI25156J39149_100003315 | 174 |
| 232 | 3300002705 | JGI25156J39149_1000186 | JGI25156J39149_100018641 | 174 |
| 233 | 3300002738 | JGI25154J39366_1000058 | JGI25154J39366_1000058100 | 174 |
| 234 | 3300002738 | JGI25154J39366_1000187 | JGI25154J39366_10001875 | 174 |
| 235 | 3300002741 | JGI25157J39369_1000009 | JGI25157J39369_1000009167 | 174 |
| 236 | 3300025206 | Ga0209435_100009 | Ga0209435_100009424 | 174 |
| 237 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018424 | 174 |
| 238 | 3300025250 | Ga0209026_1000068 | Ga0209026_1000068166 | 174 |
| 239 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007424 | 174 |
| 240 | 3300048924 | Ga0496121_0407047 | Ga0496121_0407047_152_724 | 174 |
| 241 | 3300013306 | Ga0163162_11114346 | Ga0163162_111143461 | 175 |
| 242 | 3300026095 | Ga0207676_10722180 | Ga0207676_107221801 | 175 |
| 243 | 3300031239 | Ga0265328_10000085 | Ga0265328_1000008532 | 175 |
| 244 | 3300049776 | Ga0501280_003445 | Ga0501280_003445_871_1449 | 175 |
| 245 | 3300001979 | JGI24740J21852_10000006 | JGI24740J21852_1000000642 | 176 |
| 246 | 3300002737 | JGI25162J39368_1000413 | JGI25162J39368_100041314 | 176 |
| 247 | 3300003187 | JGI25151J46595_10011077 | JGI25151J46595_100110775 | 176 |
| 248 | 3300003214 | JGI25165J46597_1000675 | JGI25165J46597_100067525 | 176 |
| 249 | 3300003856 | Ga0058692_1003685 | Ga0058692_10036853 | 176 |
| 250 | 3300005455 | Ga0070663_100047823 | Ga0070663_1000478231 | 176 |
| 251 | 3300005614 | Ga0068856_100491763 | Ga0068856_1004917631 | 176 |
| 252 | 3300005983 | Ga0081540_1001433 | Ga0081540_100143320 | 176 |
| 253 | 3300006038 | Ga0075365_10136635 | Ga0075365_101366353 | 176 |
| 254 | 3300006042 | Ga0075368_10008184 | Ga0075368_100081843 | 176 |
| 255 | 3300006042 | Ga0075368_10158851 | Ga0075368_101588512 | 176 |
| 256 | 3300006178 | Ga0075367_10030893 | Ga0075367_100308934 | 176 |
| 257 | 3300006186 | Ga0075369_10058771 | Ga0075369_100587712 | 176 |
| 258 | 3300006948 | Ga0099826_10004861 | Ga0099826_100048617 | 176 |
| 259 | 3300006948 | Ga0099826_10016860 | Ga0099826_100168601 | 176 |
| 260 | 3300013100 | Ga0157373_10143042 | Ga0157373_101430423 | 176 |
| 261 | 3300025233 | Ga0209437_100057 | Ga0209437_10005743 | 176 |
| 262 | 3300025246 | Ga0209646_1025538 | Ga0209646_10255382 | 176 |
| 263 | 3300025261 | Ga0209233_1000134 | Ga0209233_100013443 | 176 |
| 264 | 3300025272 | Ga0209455_1016472 | Ga0209455_10164721 | 176 |
| 265 | 3300025294 | Ga0209025_1000581 | Ga0209025_100058121 | 176 |
| 266 | 3300025294 | Ga0209025_1060852 | Ga0209025_10608523 | 176 |
| 267 | 3300025935 | Ga0207709_10050313 | Ga0207709_100503133 | 176 |
| 268 | 3300026067 | Ga0207678_10663389 | Ga0207678_106633891 | 176 |
| 269 | 3300026078 | Ga0207702_10417400 | Ga0207702_104174001 | 176 |
| 270 | 3300027312 | Ga0209371_1000996 | Ga0209371_100099612 | 176 |
| 271 | 3300027666 | Ga0209282_1003524 | Ga0209282_10035246 | 176 |
| 272 | 3300027666 | Ga0209282_1030549 | Ga0209282_10305494 | 176 |
| 273 | 3300030500 | Ga0268256_1001520 | Ga0268256_100152011 | 176 |
| 274 | 3300031456 | Ga0307513_10055409 | Ga0307513_100554091 | 176 |
| 275 | 3300031548 | Ga0307408_100893362 | Ga0307408_1008933621 | 176 |
| 276 | 3300031730 | Ga0307516_10185565 | Ga0307516_101855653 | 176 |
| 277 | 3300031731 | Ga0307405_11043531 | Ga0307405_110435312 | 176 |
| 278 | 3300031852 | Ga0307410_10495974 | Ga0307410_104959742 | 176 |
| 279 | 3300031995 | Ga0307409_100571853 | Ga0307409_1005718532 | 176 |
| 280 | 3300031995 | Ga0307409_100928455 | Ga0307409_1009284551 | 176 |
| 281 | 3300037312 | Ga0395899_0000107 | Ga0395899_0000107_33410_33991 | 176 |
| 282 | 3300037418 | Ga0395900_0000101 | Ga0395900_0000101_110097_110678 | 176 |
| 283 | 3300037466 | Ga0395898_0000043 | Ga0395898_0000043_33438_34019 | 176 |
| 284 | 3300037471 | Ga0395905_0000101 | Ga0395905_0000101_33438_34019 | 176 |
| 285 | 3300038443 | Ga0395901_0000068 | Ga0395901_0000068_33438_34019 | 176 |
| 286 | 3300044694 | Ga0466963_0074512 | Ga0466963_0074512_592_1224 | 176 |
| 287 | 3300044719 | Ga0466971_0307571 | Ga0466971_0307571_161_739 | 176 |
| 288 | 3300044765 | Ga0466970_0008038 | Ga0466970_0008038_546_1178 | 176 |
| 289 | 3300045049 | Ga0466959_0394320 | Ga0466959_0394320_284_916 | 176 |
| 290 | 3300045836 | Ga0466958_0030801 | Ga0466958_0030801_497_1129 | 176 |
| 291 | 3300046660 | Ga0495625_0031485 | Ga0495625_0031485_2913_3491 | 176 |
| 292 | 3300048919 | Ga0496116_0021780 | Ga0496116_0021780_3142_3735 | 176 |
| 293 | 3300048920 | Ga0496117_0047305 | Ga0496117_0047305_271_849 | 176 |
| 294 | 3300048921 | Ga0496118_0019261 | Ga0496118_0019261_3139_3717 | 176 |
| 295 | 3300048922 | Ga0496119_0017910 | Ga0496119_0017910_1705_2283 | 176 |
| 296 | 3300048922 | Ga0496119_0040907 | Ga0496119_0040907_487_1065 | 176 |
| 297 | 3300048923 | Ga0496120_0038778 | Ga0496120_0038778_388_966 | 176 |
| 298 | 3300048927 | Ga0496124_0084160 | Ga0496124_0084160_643_1221 | 176 |
| 299 | 3300048928 | Ga0496125_0046864 | Ga0496125_0046864_2360_2938 | 176 |
| 300 | 3300048928 | Ga0496125_0160779 | Ga0496125_0160779_618_1196 | 176 |
| 301 | 3300049590 | Ga0501074_0653548 | Ga0501074_0653548_27_608 | 176 |
| 302 | 3300050491 | nmdc:mga00v17_202747_c1 | nmdc:mga00v17_202747_c1_676_1254 | 176 |
| 303 | 3300050492 | nmdc:mga0yw44_353544_c1 | nmdc:mga0yw44_353544_c1_342_920 | 176 |
| 304 | 3300050494 | nmdc:mga06z11_20784_c1 | nmdc:mga06z11_20784_c1_2048_2632 | 176 |
| 305 | 3300050495 | nmdc:mga04h51_3830_c1 | nmdc:mga04h51_3830_c1_2019_2603 | 176 |
| 306 | 3300050516 | nmdc:mga0sz30_35204_c1 | nmdc:mga0sz30_35204_c1_645_1223 | 176 |
| 307 | 3300053087 | Ga0500643_043218 | Ga0500643_043218_269_850 | 176 |
| 308 | 3300053093 | Ga0500651_0112391 | Ga0500651_0112391_141_722 | 176 |
| 309 | 3300053153 | Ga0500616_0099629 | Ga0500616_0099629_273_854 | 176 |
| 310 | 3300053157 | Ga0500624_012080 | Ga0500624_012080_66_644 | 176 |
| 311 | iso_pu_bacteria | 3002141150 | 3002141200 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gah-assembly1.cif.gz_A | structure of a f112h variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp | 0.7965 | 6 | 165 |
| 2r6x-assembly1.cif.gz_A | structure of a d35n variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp | 0.7959 | 6 | 165 |
| 3ci1-assembly1.cif.gz_A | structure of the pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with four-coordinate cob(ii)alamin and atp | 0.7952 | 6 | 165 |
| 3gai-assembly1.cif.gz_A | structure of a f112a variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp | 0.7949 | 6 | 165 |
| 6wgs-assembly1.cif.gz_A | mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to adenosylcobalamin | 0.7831 | 12 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I133_189_375_1.20.1200.10 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.7891 | 22 | 163 | 1.20.1200.10 |
| 2idxB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.7823 | 17 | 164 | 1.20.1200.10 |
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.7812 | 16 | 171 | 1.20.1200.10 |
| af_Q18218_22_209_1.20.1200.10 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.7777 | 17 | 165 | 1.20.1200.10 |
| af_Q54W51_39_259_1.20.1200.10 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.7766 | 17 | 162 | 1.20.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3DWJ5-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.889 | 1 | 79 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A2N3DWJ5-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.8801 | 1 | 79 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A3B9RGR1-F1-model_v4 | deleted | 0.88 | 1 | 80 |
|
| AF-A0A7S1NF66-F1-model_v4 | Cobalamin adenosyltransferase-like domain-containing protein | 0.8676 | 4 | 83 |
GO:0005524
GO:0008817 |
| AF-A0A7G1I9X7-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.8606 | 1 | 79 |
GO:0005524
GO:0008817 GO:0009236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar