F401485

General Info

Members Datasets Scaffolds Average Seq Length
311 245 244 187

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3002141150|3002141200
Length 202
Sequence STALPAETVMVKLNKIYTRTGDDGTTGLGSGDRRLKHDLRVEAYGTVDEANSCIGLARLYTEKEFPDIDAMLVRIQNDLFDLGADLATPDTCKKLDYEPLRIIDSQVLRVEADIDLLNEKLAPLRSFVLPGGSPASAALHLARTVARRAERHMVELVQKPDEIVTPAALKYINRVSDFLFVAARAVNDNGAKDVLWVPGKNR

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
6 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
7 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
8 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
9 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
10 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
11 2643221558 Rhizobium sp. Root149 Isolate Unclassified
12 2643221582 Rhizobium sp. Root651 Isolate Unclassified
13 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
14 2643221693 Rhizobium sp. Root491 Isolate Unclassified
15 2643221719 Rhizobium sp. Root274 Isolate Unclassified
16 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
17 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
18 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
19 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
20 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
21 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
22 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
23 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
24 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
25 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
26 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
27 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
28 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
29 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
30 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
31 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
32 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
33 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
34 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
35 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
36 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
37 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
38 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
39 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
40 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
41 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
42 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
43 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
44 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
45 2902330777 Methylobacterium sp. 2A Isolate Unclassified
46 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
47 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
48 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
49 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
50 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
51 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
52 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
53 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
54 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
55 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
56 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
57 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
58 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
59 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
60 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
61 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
66 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
72 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
241 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
242 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
243 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
244 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
245 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.46
Metatranscriptomes 0
Isolates 21.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 9.32
Rhizoplane 2.57
Rhizosphere 61.41
Stem 0
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000006 3300001979 Bacteria 86112
2 JGI25155J39150_1000010 3300002704 Bacteria 207717
3 JGI25156J39149_1000033 3300002705 Bacteria 114688
4 JGI25156J39149_1000186 3300002705 Bacteria 45132
5 JGI25162J39368_1000413 3300002737 Bacteria 34872
6 JGI25154J39366_1000058 3300002738 Bacteria 107363
7 JGI25154J39366_1000187 3300002738 Bacteria 46590
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25151J46595_10011077 3300003187 Bacteria 4160
10 JGI25165J46597_1000675 3300003214 Bacteria 27458
11 rootL2_10034535 3300003322 Bacteria 3661
12 Ga0055539_1005928 3300003752 Bacteria 1574
13 Ga0058692_1003402 3300003856 Bacteria 4918
14 Ga0058692_1003685 3300003856 Bacteria 4680
15 Ga0070683_100454455 3300005329 Bacteria 1222
16 Ga0070691_10000521 3300005341 Bacteria 14493
17 Ga0070709_10001436 3300005434 Bacteria 12862
18 Ga0070709_10304499 3300005434 Bacteria 1165
19 Ga0070714_100148562 3300005435 Bacteria 2109
20 Ga0070714_100487092 3300005435 Bacteria 1175
21 Ga0070713_100000199 3300005436 Bacteria 40083
22 Ga0070711_100025595 3300005439 Bacteria 3863
23 Ga0070711_100046190 3300005439 Bacteria 2966
24 Ga0070711_101322009 3300005439 Bacteria 626
25 Ga0070705_100112226 3300005440 Bacteria 1744
26 Ga0070663_100047823 3300005455 Bacteria 3031
27 Ga0070707_100269915 3300005468 Bacteria 1654
28 Ga0070707_100564782 3300005468 Bacteria 1100
29 Ga0070697_100331637 3300005536 Bacteria 1312
30 Ga0068853_100019990 3300005539 Bacteria 5563
31 Ga0070695_100010283 3300005545 Bacteria 5584
32 Ga0070693_100083144 3300005547 Bacteria 1913
33 Ga0070693_100203620 3300005547 Bacteria 1287
34 Ga0070665_100624043 3300005548 Bacteria 1091
35 Ga0068857_100002551 3300005577 Bacteria 14915
36 Ga0068854_100249107 3300005578 Bacteria 1418
37 Ga0068854_100280608 3300005578 Bacteria 1341
38 Ga0068856_100004606 3300005614 Bacteria 13715
39 Ga0068856_100010174 3300005614 Bacteria 9143
40 Ga0068856_100491763 3300005614 Bacteria 1248
41 Ga0068852_100030992 3300005616 Bacteria 4407
42 Ga0068858_100048518 3300005842 Bacteria 3934
43 Ga0081540_1001433 3300005983 Bacteria 20635
44 Ga0075365_10136635 3300006038 Bacteria 1699
45 Ga0075368_10008184 3300006042 Bacteria 3716
46 Ga0075368_10158851 3300006042 Bacteria 946
47 Ga0070712_100013632 3300006175 Bacteria 5197
48 Ga0070712_100155236 3300006175 Bacteria 1762
49 Ga0075367_10030893 3300006178 Bacteria 3074
50 Ga0075369_10058771 3300006186 Bacteria 1674
51 Ga0075430_100260944 3300006846 Bacteria 1435
52 Ga0075434_100065293 3300006871 Bacteria 3625
53 Ga0075434_100150428 3300006871 Bacteria 2348
54 Ga0075436_100006588 3300006914 Bacteria 7957
55 Ga0099826_10004861 3300006948 Bacteria 9505
56 Ga0099826_10016860 3300006948 Bacteria 5520
57 Ga0105240_10000013 3300009093 Bacteria 483458
58 Ga0105240_10054675 3300009093 Bacteria 5002
59 Ga0105243_10252111 3300009148 Bacteria 1576
60 Ga0105241_10020835 3300009174 Bacteria 4846
61 Ga0105241_10025795 3300009174 Bacteria 4369
62 Ga0105248_10828238 3300009177 Bacteria 1044
63 Ga0105237_10008030 3300009545 Bacteria 11482
64 Ga0105237_10014957 3300009545 Bacteria 8089
65 Ga0105238_10005724 3300009551 Bacteria 12287
66 Ga0105239_10014384 3300010375 Bacteria 8779
67 Ga0157373_10143042 3300013100 Bacteria 1682
68 Ga0157370_10006398 3300013104 Bacteria 12990
69 Ga0157370_10020300 3300013104 Bacteria 6636
70 Ga0157369_10357325 3300013105 Bacteria 1517
71 Ga0157374_10503636 3300013296 Bacteria 1216
72 Ga0157378_10033076 3300013297 Bacteria 4570
73 Ga0163162_10680648 3300013306 Bacteria 1151
74 Ga0163162_11114346 3300013306 Bacteria 894
75 Ga0157372_10028084 3300013307 Bacteria 6137
76 Ga0163163_10343841 3300014325 Bacteria 1547
77 Ga0182008_10291762 3300014497 Bacteria 851
78 Ga0157379_10001860 3300014968 Bacteria 17473
79 Ga0157379_10018635 3300014968 Bacteria 6120
80 Ga0157379_10052091 3300014968 Bacteria 3655
81 Ga0182007_10002724 3300015262 Bacteria 8647
82 Ga0182005_1031683 3300015265 Bacteria 1440
83 Ga0209435_100009 3300025206 Bacteria 476614
84 Ga0209437_100057 3300025233 Bacteria 362922
85 Ga0209646_1000018 3300025246 Bacteria 476716
86 Ga0209646_1025538 3300025246 Bacteria 824
87 Ga0209026_1000068 3300025250 Bacteria 207601
88 Ga0209677_100629 3300025253 Bacteria 18933
89 Ga0209148_1023078 3300025254 Bacteria 993
90 Ga0209759_1000007 3300025256 Bacteria 476614
91 Ga0209759_1026980 3300025256 Bacteria 1194
92 Ga0209233_1000134 3300025261 Bacteria 202535
93 Ga0209233_1000353 3300025261 Bacteria 42997
94 Ga0209455_1016472 3300025272 Bacteria 1587
95 Ga0209025_1000581 3300025294 Bacteria 66321
96 Ga0209025_1060852 3300025294 Bacteria 1414
97 Ga0207699_10000124 3300025906 Bacteria 54948
98 Ga0207699_10176715 3300025906 Bacteria 1432
99 Ga0207699_10211652 3300025906 Bacteria 1319
100 Ga0207654_10022969 3300025911 Bacteria 3335
101 Ga0207654_10029205 3300025911 Bacteria 3015
102 Ga0207671_10000364 3300025914 Bacteria 64550
103 Ga0207671_10005935 3300025914 Bacteria 11071
104 Ga0207693_10006235 3300025915 Bacteria 9892
105 Ga0207693_10101597 3300025915 Bacteria 2255
106 Ga0207663_10003545 3300025916 Bacteria 7653
107 Ga0207663_10016101 3300025916 Bacteria 4138
108 Ga0207694_10030459 3300025924 Bacteria 4121
109 Ga0207700_10000026 3300025928 Bacteria 139690
110 Ga0207664_10116458 3300025929 Bacteria 2230
111 Ga0207664_10123941 3300025929 Bacteria 2167
112 Ga0207709_10050313 3300025935 Bacteria 2548
113 Ga0207661_10687316 3300025944 Bacteria 941
114 Ga0207667_10041930 3300025949 Bacteria 4867
115 Ga0207640_10123355 3300025981 Bacteria 1860
116 Ga0207640_10254003 3300025981 Bacteria 1366
117 Ga0207658_10086500 3300025986 Bacteria 2418
118 Ga0207703_10030660 3300026035 Bacteria 4251
119 Ga0207678_10663389 3300026067 Bacteria 917
120 Ga0207702_10000021 3300026078 Bacteria 196115
121 Ga0207702_10417400 3300026078 Bacteria 1297
122 Ga0207676_10722180 3300026095 Bacteria 967
123 Ga0207674_10000898 3300026116 Bacteria 38900
124 Ga0209371_1000996 3300027312 Bacteria 21749
125 Ga0209371_1001537 3300027312 Bacteria 15275
126 Ga0209282_1003524 3300027666 Bacteria 9310
127 Ga0209282_1030549 3300027666 Bacteria 3314
128 Ga0265318_10000115 3300028577 Bacteria 74110
129 Ga0265338_10019251 3300028800 Bacteria 7260
130 Ga0265338_10093376 3300028800 Bacteria 2479
131 Ga0265338_10440474 3300028800 Bacteria 924
132 Ga0268256_1000728 3300030500 Bacteria 24256
133 Ga0268256_1001520 3300030500 Bacteria 13708
134 Ga0265328_10000085 3300031239 Bacteria 48380
135 Ga0265320_10000477 3300031240 Bacteria 31277
136 Ga0265325_10000067 3300031241 Bacteria 72846
137 Ga0265340_10034608 3300031247 Bacteria 2511
138 Ga0265339_10002397 3300031249 Bacteria 13434
139 Ga0265339_10030163 3300031249 Bacteria 3072
140 Ga0265331_10056729 3300031250 Bacteria 1859
141 Ga0265316_10008995 3300031344 Bacteria 9211
142 Ga0265316_10152654 3300031344 Bacteria 1730
143 Ga0307513_10055409 3300031456 Bacteria 4243
144 Ga0307408_100893362 3300031548 Bacteria 813
145 Ga0265313_10002160 3300031595 Bacteria 17462
146 Ga0265314_10011835 3300031711 Bacteria 7167
147 Ga0265314_10074190 3300031711 Bacteria 2266
148 Ga0265314_10296199 3300031711 Bacteria 909
149 Ga0265342_10082003 3300031712 Bacteria 1862
150 Ga0265342_10124080 3300031712 Bacteria 1452
151 Ga0307516_10185565 3300031730 Bacteria 1810
152 Ga0307405_11043531 3300031731 Bacteria 700
153 Ga0307410_10495974 3300031852 Bacteria 1004
154 Ga0307409_100571853 3300031995 Bacteria 1113
155 Ga0307409_100928455 3300031995 Bacteria 885
156 Ga0373926_0132188 3300035083 Bacteria 945
157 Ga0373944_0037474 3300035089 Bacteria 1485
158 Ga0373932_0063067 3300035112 Bacteria 1131
159 Ga0373943_0019854 3300035170 Bacteria 3094
160 Ga0373946_0140116 3300035171 Bacteria 1120
161 Ga0373955_0008291 3300035172 Bacteria 4820
162 Ga0373935_0006310 3300035692 Bacteria 7065
163 Ga0373935_0074770 3300035692 Bacteria 2191
164 Ga0373927_0331310 3300035695 Bacteria 1003
165 Ga0373933_0050112 3300035724 Bacteria 2491
166 Ga0373933_0203032 3300035724 Bacteria 1269
167 Ga0373947_0003799 3300035725 Bacteria 8905
168 Ga0373947_0127568 3300035725 Bacteria 1622
169 Ga0373947_0429397 3300035725 Bacteria 893
170 Ga0373937_0000477 3300036401 Bacteria 36794
171 Ga0373937_0539866 3300036401 Bacteria 1108
172 Ga0373937_1019240 3300036401 Bacteria 776
173 Ga0373925_0001546 3300037068 Bacteria 19580
174 Ga0373925_0079589 3300037068 Bacteria 2490
175 Ga0373925_0302634 3300037068 Bacteria 1291
176 Ga0395899_0000107 3300037312 Bacteria 144087
177 Ga0395900_0000101 3300037418 Bacteria 153550
178 Ga0395900_0292634 3300037418 Bacteria 1617
179 Ga0395898_0000043 3300037466 Bacteria 301783
180 Ga0395905_0000101 3300037471 Bacteria 144115
181 Ga0395901_0000068 3300038443 Bacteria 144095
182 Ga0395901_0138022 3300038443 Bacteria 2563
183 Ga0436365_0186666 3300039437 Bacteria 1085
184 Ga0436365_0772433 3300039437 Bacteria 2583
185 Ga0436365_1070125 3300039437 Bacteria 29375
186 Ga0466963_0074512 3300044694 Bacteria 2289
187 Ga0466971_0307571 3300044719 Bacteria 762
188 Ga0466970_0008038 3300044765 Bacteria 5295
189 Ga0466959_0394320 3300045049 Bacteria 941
190 Ga0466958_0030801 3300045836 Bacteria 3188
191 Ga0495629_0174860 3300046459 Bacteria 1489
192 Ga0495580_0033396 3300046472 Bacteria 3708
193 Ga0495580_0066436 3300046472 Bacteria 2524
194 Ga0495664_0595254 3300046477 Bacteria 657
195 Ga0495625_0031485 3300046660 Bacteria 3945
196 Ga0495588_0001014 3300046674 Bacteria 12199
197 Ga0495623_0145289 3300046679 Bacteria 1407
198 Ga0495658_0007243 3300046683 Bacteria 5482
199 Ga0495613_0337493 3300046689 Bacteria 1037
200 Ga0495581_0467119 3300047315 Bacteria 734
201 Ga0495674_0061971 3300047319 Bacteria 3258
202 Ga0495681_0015189 3300047470 Bacteria 4367
203 Ga0495602_0098133 3300048088 Bacteria 2412
204 Ga0496100_0061578 3300048903 Bacteria 2473
205 Ga0496103_0294871 3300048906 Bacteria 1043
206 Ga0496110_0673196 3300048913 Bacteria 935
207 Ga0496116_0021780 3300048919 Bacteria 4824
208 Ga0496117_0047305 3300048920 Bacteria 3086
209 Ga0496118_0019261 3300048921 Bacteria 6108
210 Ga0496119_0017910 3300048922 Bacteria 5304
211 Ga0496119_0040907 3300048922 Bacteria 2958
212 Ga0496120_0038778 3300048923 Bacteria 2816
213 Ga0496121_0006814 3300048924 Bacteria 13991
214 Ga0496121_0407047 3300048924 Bacteria 889
215 Ga0496123_0013339 3300048926 Bacteria 6911
216 Ga0496124_0013703 3300048927 Bacteria 7896
217 Ga0496124_0084160 3300048927 Bacteria 2609
218 Ga0496125_0046864 3300048928 Bacteria 3622
219 Ga0496125_0160779 3300048928 Bacteria 1526
220 Ga0501038_0044495 3300049574 Bacteria 3856
221 Ga0501047_0690305 3300049581 Bacteria 839
222 Ga0501067_0338306 3300049583 Bacteria 839
223 Ga0501070_0100289 3300049586 Bacteria 2395
224 Ga0501074_0653548 3300049590 Bacteria 743
225 Ga0501080_1130697 3300049742 Bacteria 675
226 Ga0501081_0625083 3300049743 Bacteria 807
227 Ga0501280_003445 3300049776 Bacteria 2433
228 nmdc:mga00v17_202747_c1 3300050491 Bacteria 1282
229 nmdc:mga0yw44_353544_c1 3300050492 Bacteria 989
230 nmdc:mga06z11_20784_c1 3300050494 Bacteria 3040
231 nmdc:mga04h51_3830_c1 3300050495 Bacteria 3693
232 nmdc:mga0qj67_266178_c1 3300050509 Bacteria 1390
233 nmdc:mga0n895_21759_c1 3300050512 Bacteria 6002
234 nmdc:mga0n895_92286_c1 3300050512 Bacteria 3031
235 nmdc:mga0rr50_14023_c1 3300050513 Bacteria 5240
236 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
237 nmdc:mga0sz30_35204_c1 3300050516 Bacteria 2088
238 nmdc:mga0sz30_52420_c2 3300050516 Bacteria 1068
239 Ga0500643_043218 3300053087 Bacteria 1315
240 Ga0500651_0112391 3300053093 Bacteria 1661
241 Ga0500560_000603 3300053107 Bacteria 5231
242 Ga0500616_0099629 3300053153 Bacteria 1423
243 Ga0500624_012080 3300053157 Bacteria 1271
244 Ga0501084_0000366 3300054114 Bacteria 34534

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0539866 Ga0373937_0539866_19_582 162
2 3300047470 Ga0495681_0015189 Ga0495681_0015189_3299_3877 165
3 3300009148 Ga0105243_10252111 Ga0105243_102521112 167
4 3300003322 rootL2_10034535 rootL2_100345351 168
5 3300009545 Ga0105237_10008030 Ga0105237_1000803013 168
6 3300046674 Ga0495588_0001014 Ga0495588_0001014_9294_9872 168
7 3300048926 Ga0496123_0013339 Ga0496123_0013339_2439_3017 168
8 iso_pu_bacteria 2902330777 2902336626 168
9 3300005329 Ga0070683_100454455 Ga0070683_1004544552 169
10 3300005341 Ga0070691_10000521 Ga0070691_100005211 169
11 3300005434 Ga0070709_10001436 Ga0070709_1000143612 169
12 3300005434 Ga0070709_10304499 Ga0070709_103044993 169
13 3300005435 Ga0070714_100148562 Ga0070714_1001485623 169
14 3300005435 Ga0070714_100487092 Ga0070714_1004870922 169
15 3300005436 Ga0070713_100000199 Ga0070713_10000019927 169
16 3300005439 Ga0070711_100025595 Ga0070711_1000255953 169
17 3300005439 Ga0070711_100046190 Ga0070711_1000461903 169
18 3300005439 Ga0070711_101322009 Ga0070711_1013220091 169
19 3300005440 Ga0070705_100112226 Ga0070705_1001122263 169
20 3300005468 Ga0070707_100564782 Ga0070707_1005647823 169
21 3300005536 Ga0070697_100331637 Ga0070697_1003316372 169
22 3300005539 Ga0068853_100019990 Ga0068853_1000199905 169
23 3300005545 Ga0070695_100010283 Ga0070695_1000102833 169
24 3300005547 Ga0070693_100083144 Ga0070693_1000831443 169
25 3300005547 Ga0070693_100203620 Ga0070693_1002036202 169
26 3300005548 Ga0070665_100624043 Ga0070665_1006240432 169
27 3300005577 Ga0068857_100002551 Ga0068857_10000255110 169
28 3300005578 Ga0068854_100249107 Ga0068854_1002491073 169
29 3300005614 Ga0068856_100004606 Ga0068856_10000460610 169
30 3300005614 Ga0068856_100010174 Ga0068856_1000101742 169
31 3300005616 Ga0068852_100030992 Ga0068852_1000309923 169
32 3300005842 Ga0068858_100048518 Ga0068858_1000485184 169
33 3300006175 Ga0070712_100013632 Ga0070712_1000136323 169
34 3300006175 Ga0070712_100155236 Ga0070712_1001552362 169
35 3300006846 Ga0075430_100260944 Ga0075430_1002609442 169
36 3300006871 Ga0075434_100065293 Ga0075434_1000652933 169
37 3300006871 Ga0075434_100150428 Ga0075434_1001504283 169
38 3300006914 Ga0075436_100006588 Ga0075436_1000065888 169
39 3300009093 Ga0105240_10000013 Ga0105240_1000001344 169
40 3300009093 Ga0105240_10054675 Ga0105240_100546753 169
41 3300009174 Ga0105241_10020835 Ga0105241_100208354 169
42 3300009174 Ga0105241_10025795 Ga0105241_100257953 169
43 3300009177 Ga0105248_10828238 Ga0105248_108282381 169
44 3300009545 Ga0105237_10014957 Ga0105237_100149573 169
45 3300009551 Ga0105238_10005724 Ga0105238_100057249 169
46 3300013104 Ga0157370_10006398 Ga0157370_1000639812 169
47 3300013104 Ga0157370_10020300 Ga0157370_100203003 169
48 3300013105 Ga0157369_10357325 Ga0157369_103573251 169
49 3300013296 Ga0157374_10503636 Ga0157374_105036361 169
50 3300013297 Ga0157378_10033076 Ga0157378_100330763 169
51 3300013306 Ga0163162_10680648 Ga0163162_106806481 169
52 3300013307 Ga0157372_10028084 Ga0157372_100280845 169
53 3300014325 Ga0163163_10343841 Ga0163163_103438411 169
54 3300014497 Ga0182008_10291762 Ga0182008_102917622 169
55 3300014968 Ga0157379_10001860 Ga0157379_100018608 169
56 3300014968 Ga0157379_10018635 Ga0157379_100186356 169
57 3300014968 Ga0157379_10052091 Ga0157379_100520914 169
58 3300015262 Ga0182007_10002724 Ga0182007_100027246 169
59 3300015265 Ga0182005_1031683 Ga0182005_10316831 169
60 3300025906 Ga0207699_10000124 Ga0207699_1000012419 169
61 3300025906 Ga0207699_10176715 Ga0207699_101767153 169
62 3300025906 Ga0207699_10211652 Ga0207699_102116522 169
63 3300025911 Ga0207654_10022969 Ga0207654_100229693 169
64 3300025911 Ga0207654_10029205 Ga0207654_100292053 169
65 3300025914 Ga0207671_10005935 Ga0207671_100059358 169
66 3300025915 Ga0207693_10006235 Ga0207693_100062359 169
67 3300025915 Ga0207693_10101597 Ga0207693_101015972 169
68 3300025916 Ga0207663_10003545 Ga0207663_100035456 169
69 3300025916 Ga0207663_10016101 Ga0207663_100161015 169
70 3300025924 Ga0207694_10030459 Ga0207694_100304593 169
71 3300025928 Ga0207700_10000026 Ga0207700_10000026135 169
72 3300025929 Ga0207664_10116458 Ga0207664_101164583 169
73 3300025929 Ga0207664_10123941 Ga0207664_101239413 169
74 3300025944 Ga0207661_10687316 Ga0207661_106873161 169
75 3300025949 Ga0207667_10041930 Ga0207667_100419303 169
76 3300025981 Ga0207640_10123355 Ga0207640_101233553 169
77 3300026035 Ga0207703_10030660 Ga0207703_100306604 169
78 3300026078 Ga0207702_10000021 Ga0207702_10000021112 169
79 3300026116 Ga0207674_10000898 Ga0207674_100008989 169
80 3300028577 Ga0265318_10000115 Ga0265318_1000011525 169
81 3300028800 Ga0265338_10019251 Ga0265338_100192515 169
82 3300028800 Ga0265338_10093376 Ga0265338_100933762 169
83 3300028800 Ga0265338_10440474 Ga0265338_104404741 169
84 3300031240 Ga0265320_10000477 Ga0265320_1000047719 169
85 3300031241 Ga0265325_10000067 Ga0265325_100000675 169
86 3300031247 Ga0265340_10034608 Ga0265340_100346085 169
87 3300031249 Ga0265339_10002397 Ga0265339_100023979 169
88 3300031249 Ga0265339_10030163 Ga0265339_100301633 169
89 3300031250 Ga0265331_10056729 Ga0265331_100567291 169
90 3300031344 Ga0265316_10008995 Ga0265316_100089954 169
91 3300031344 Ga0265316_10152654 Ga0265316_101526542 169
92 3300031595 Ga0265313_10002160 Ga0265313_100021606 169
93 3300031711 Ga0265314_10011835 Ga0265314_100118355 169
94 3300031711 Ga0265314_10074190 Ga0265314_100741903 169
95 3300031711 Ga0265314_10296199 Ga0265314_102961991 169
96 3300031712 Ga0265342_10082003 Ga0265342_100820033 169
97 3300031712 Ga0265342_10124080 Ga0265342_101240802 169
98 3300035083 Ga0373926_0132188 Ga0373926_0132188_169_732 169
99 3300035089 Ga0373944_0037474 Ga0373944_0037474_434_997 169
100 3300035112 Ga0373932_0063067 Ga0373932_0063067_460_1023 169
101 3300035170 Ga0373943_0019854 Ga0373943_0019854_2170_2733 169
102 3300035171 Ga0373946_0140116 Ga0373946_0140116_356_919 169
103 3300035172 Ga0373955_0008291 Ga0373955_0008291_2758_3321 169
104 3300035692 Ga0373935_0006310 Ga0373935_0006310_1735_2298 169
105 3300035692 Ga0373935_0074770 Ga0373935_0074770_1338_1970 169
106 3300035695 Ga0373927_0331310 Ga0373927_0331310_147_710 169
107 3300035724 Ga0373933_0050112 Ga0373933_0050112_1665_2228 169
108 3300035724 Ga0373933_0203032 Ga0373933_0203032_695_1258 169
109 3300035725 Ga0373947_0003799 Ga0373947_0003799_770_1333 169
110 3300035725 Ga0373947_0127568 Ga0373947_0127568_368_931 169
111 3300035725 Ga0373947_0429397 Ga0373947_0429397_273_836 169
112 3300036401 Ga0373937_0000477 Ga0373937_0000477_17385_17948 169
113 3300036401 Ga0373937_1019240 Ga0373937_1019240_30_593 169
114 3300037068 Ga0373925_0001546 Ga0373925_0001546_16725_17288 169
115 3300037068 Ga0373925_0079589 Ga0373925_0079589_1432_2064 169
116 3300037068 Ga0373925_0302634 Ga0373925_0302634_470_1033 169
117 3300037418 Ga0395900_0292634 Ga0395900_0292634_559_1122 169
118 3300038443 Ga0395901_0138022 Ga0395901_0138022_1319_1882 169
119 3300039437 Ga0436365_0186666 Ga0436365_0186666_506_1069 169
120 3300039437 Ga0436365_0772433 Ga0436365_0772433_620_1183 169
121 3300039437 Ga0436365_1070125 Ga0436365_1070125_14236_14799 169
122 3300046459 Ga0495629_0174860 Ga0495629_0174860_95_658 169
123 3300046472 Ga0495580_0033396 Ga0495580_0033396_1839_2402 169
124 3300046472 Ga0495580_0066436 Ga0495580_0066436_292_855 169
125 3300046477 Ga0495664_0595254 Ga0495664_0595254_52_615 169
126 3300046679 Ga0495623_0145289 Ga0495623_0145289_641_1204 169
127 3300046683 Ga0495658_0007243 Ga0495658_0007243_1018_1581 169
128 3300046689 Ga0495613_0337493 Ga0495613_0337493_281_844 169
129 3300047315 Ga0495581_0467119 Ga0495581_0467119_78_641 169
130 3300047319 Ga0495674_0061971 Ga0495674_0061971_1273_1836 169
131 3300048088 Ga0495602_0098133 Ga0495602_0098133_1376_1939 169
132 3300048906 Ga0496103_0294871 Ga0496103_0294871_97_660 169
133 3300048913 Ga0496110_0673196 Ga0496110_0673196_279_842 169
134 3300049574 Ga0501038_0044495 Ga0501038_0044495_2806_3369 169
135 3300049583 Ga0501067_0338306 Ga0501067_0338306_123_686 169
136 3300049586 Ga0501070_0100289 Ga0501070_0100289_949_1512 169
137 3300049743 Ga0501081_0625083 Ga0501081_0625083_80_643 169
138 3300050509 nmdc:mga0qj67_266178_c1 nmdc:mga0qj67_266178_c1_544_1107 169
139 3300050512 nmdc:mga0n895_21759_c1 nmdc:mga0n895_21759_c1_2719_3282 169
140 3300050512 nmdc:mga0n895_92286_c1 nmdc:mga0n895_92286_c1_1883_2446 169
141 3300050513 nmdc:mga0rr50_14023_c1 nmdc:mga0rr50_14023_c1_909_1472 169
142 3300050514 nmdc:mga08x19_54_c1 nmdc:mga08x19_54_c1_1465_2028 169
143 3300050516 nmdc:mga0sz30_52420_c2 nmdc:mga0sz30_52420_c2_42_605 169
144 3300054114 Ga0501084_0000366 Ga0501084_0000366_25989_26552 169
145 3300003752 Ga0055539_1005928 Ga0055539_10059283 170
146 3300003856 Ga0058692_1003402 Ga0058692_10034025 170
147 3300005468 Ga0070707_100269915 Ga0070707_1002699152 170
148 3300005578 Ga0068854_100280608 Ga0068854_1002806082 170
149 3300010375 Ga0105239_10014384 Ga0105239_100143842 170
150 3300025253 Ga0209677_100629 Ga0209677_1006293 170
151 3300025256 Ga0209759_1026980 Ga0209759_10269802 170
152 3300025261 Ga0209233_1000353 Ga0209233_100035343 170
153 3300025914 Ga0207671_10000364 Ga0207671_1000036418 170
154 3300025981 Ga0207640_10254003 Ga0207640_102540032 170
155 3300025986 Ga0207658_10086500 Ga0207658_100865003 170
156 3300027312 Ga0209371_1001537 Ga0209371_10015372 170
157 3300030500 Ga0268256_1000728 Ga0268256_10007282 170
158 3300048903 Ga0496100_0061578 Ga0496100_0061578_242_820 170
159 3300048924 Ga0496121_0006814 Ga0496121_0006814_8732_9310 170
160 3300048927 Ga0496124_0013703 Ga0496124_0013703_6780_7358 170
161 3300049581 Ga0501047_0690305 Ga0501047_0690305_73_645 170
162 3300049742 Ga0501080_1130697 Ga0501080_1130697_36_608 170
163 3300053107 Ga0500560_000603 Ga0500560_000603_2529_3107 170
164 iso_pu_bacteria 2585427634 2586002206 170
165 3300025254 Ga0209148_1023078 Ga0209148_10230781 171
166 iso_pu_bacteria 2510461069 2510843507 172
167 iso_pu_bacteria 2511231027 2511392244 172
168 iso_pu_bacteria 2537561587 2537874183 172
169 iso_pu_bacteria 2554235003 2554245310 172
170 iso_pu_bacteria 2558860242 2559296860 172
171 iso_pu_bacteria 2599185210 2599604550 172
172 iso_pu_bacteria 2600255279 2601610259 172
173 iso_pu_bacteria 2600255308 2601747411 172
174 iso_pu_bacteria 2615840698 2616557762 172
175 iso_pu_bacteria 2643221558 2643813592 172
176 iso_pu_bacteria 2643221582 2643917053 172
177 iso_pu_bacteria 2643221653 2644300049 172
178 iso_pu_bacteria 2643221693 2644520989 172
179 iso_pu_bacteria 2643221719 2644658275 172
180 iso_pu_bacteria 2765235802 2765467925 172
181 iso_pu_bacteria 2767802442 2770198576 172
182 iso_pu_bacteria 2775506902 2776270106 172
183 iso_pu_bacteria 2775506904 2776281231 172
184 iso_pu_bacteria 2808606387 2808987318 172
185 iso_pu_bacteria 2818991272 2819243618 172
186 iso_pu_bacteria 2838029111 2838030762 172
187 iso_pu_bacteria 2838675328 2838678149 172
188 iso_pu_bacteria 2838714209 2838716944 172
189 iso_pu_bacteria 2838719591 2838722445 172
190 iso_pu_bacteria 2838724970 2838727694 172
191 iso_pu_bacteria 2839993093 2839997888 172
192 iso_pu_bacteria 2840764183 2840765525 172
193 iso_pu_bacteria 2841846520 2841849350 172
194 iso_pu_bacteria 2842124991 2842127901 172
195 iso_pu_bacteria 2842130223 2842133042 172
196 iso_pu_bacteria 2842152218 2842155036 172
197 iso_pu_bacteria 2842170452 2842173535 172
198 iso_pu_bacteria 2842175837 2842178657 172
199 iso_pu_bacteria 2842187318 2842190052 172
200 iso_pu_bacteria 2842211629 2842214366 172
201 iso_pu_bacteria 2842224351 2842227085 172
202 iso_pu_bacteria 2842475841 2842477494 172
203 iso_pu_bacteria 2842502639 2842504633 172
204 iso_pu_bacteria 2842509118 2842511886 172
205 iso_pu_bacteria 2842871566 2842875877 172
206 iso_pu_bacteria 2876392853 2876396149 172
207 iso_pu_bacteria 2899792073 2899792719 172
208 iso_pu_bacteria 2899845264 2899845603 172
209 iso_pu_bacteria 2904659560 2904662925 172
210 iso_pu_bacteria 2919114240 2919117201 172
211 iso_pu_bacteria 2926754445 2926758649 172
212 iso_pu_bacteria 2926760298 2926763817 172
213 iso_pu_bacteria 2928521798 2928526638 172
214 iso_pu_bacteria 2933006813 2933009584 172
215 iso_pu_bacteria 2933594066 2933595563 172
216 iso_pu_bacteria 2954011201 2954013372 172
217 iso_pu_bacteria 2961114664 2961117951 172
218 iso_pu_bacteria 2968110612 2968114012 172
219 iso_pu_bacteria 2979089926 2979091141 172
220 iso_pu_bacteria 2979095461 2979096667 172
221 iso_pu_bacteria 2989776772 2989779891 172
222 iso_pu_bacteria 2996336353 2996341280 172
223 iso_pu_bacteria 3003930520 3003930852 172
224 iso_pu_bacteria 650716007 650843283 172
225 iso_pu_bacteria 8003570095 8003572860 172
226 iso_pu_bacteria 8005658619 8005660642 172
227 iso_pu_bacteria 8005682033 8005687633 172
228 iso_pu_bacteria 8018150411 8018154552 172
229 iso_pu_bacteria 8055431914 8055435751 172
230 3300002704 JGI25155J39150_1000010 JGI25155J39150_1000010168 174
231 3300002705 JGI25156J39149_1000033 JGI25156J39149_100003315 174
232 3300002705 JGI25156J39149_1000186 JGI25156J39149_100018641 174
233 3300002738 JGI25154J39366_1000058 JGI25154J39366_1000058100 174
234 3300002738 JGI25154J39366_1000187 JGI25154J39366_10001875 174
235 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009167 174
236 3300025206 Ga0209435_100009 Ga0209435_100009424 174
237 3300025246 Ga0209646_1000018 Ga0209646_1000018424 174
238 3300025250 Ga0209026_1000068 Ga0209026_1000068166 174
239 3300025256 Ga0209759_1000007 Ga0209759_1000007424 174
240 3300048924 Ga0496121_0407047 Ga0496121_0407047_152_724 174
241 3300013306 Ga0163162_11114346 Ga0163162_111143461 175
242 3300026095 Ga0207676_10722180 Ga0207676_107221801 175
243 3300031239 Ga0265328_10000085 Ga0265328_1000008532 175
244 3300049776 Ga0501280_003445 Ga0501280_003445_871_1449 175
245 3300001979 JGI24740J21852_10000006 JGI24740J21852_1000000642 176
246 3300002737 JGI25162J39368_1000413 JGI25162J39368_100041314 176
247 3300003187 JGI25151J46595_10011077 JGI25151J46595_100110775 176
248 3300003214 JGI25165J46597_1000675 JGI25165J46597_100067525 176
249 3300003856 Ga0058692_1003685 Ga0058692_10036853 176
250 3300005455 Ga0070663_100047823 Ga0070663_1000478231 176
251 3300005614 Ga0068856_100491763 Ga0068856_1004917631 176
252 3300005983 Ga0081540_1001433 Ga0081540_100143320 176
253 3300006038 Ga0075365_10136635 Ga0075365_101366353 176
254 3300006042 Ga0075368_10008184 Ga0075368_100081843 176
255 3300006042 Ga0075368_10158851 Ga0075368_101588512 176
256 3300006178 Ga0075367_10030893 Ga0075367_100308934 176
257 3300006186 Ga0075369_10058771 Ga0075369_100587712 176
258 3300006948 Ga0099826_10004861 Ga0099826_100048617 176
259 3300006948 Ga0099826_10016860 Ga0099826_100168601 176
260 3300013100 Ga0157373_10143042 Ga0157373_101430423 176
261 3300025233 Ga0209437_100057 Ga0209437_10005743 176
262 3300025246 Ga0209646_1025538 Ga0209646_10255382 176
263 3300025261 Ga0209233_1000134 Ga0209233_100013443 176
264 3300025272 Ga0209455_1016472 Ga0209455_10164721 176
265 3300025294 Ga0209025_1000581 Ga0209025_100058121 176
266 3300025294 Ga0209025_1060852 Ga0209025_10608523 176
267 3300025935 Ga0207709_10050313 Ga0207709_100503133 176
268 3300026067 Ga0207678_10663389 Ga0207678_106633891 176
269 3300026078 Ga0207702_10417400 Ga0207702_104174001 176
270 3300027312 Ga0209371_1000996 Ga0209371_100099612 176
271 3300027666 Ga0209282_1003524 Ga0209282_10035246 176
272 3300027666 Ga0209282_1030549 Ga0209282_10305494 176
273 3300030500 Ga0268256_1001520 Ga0268256_100152011 176
274 3300031456 Ga0307513_10055409 Ga0307513_100554091 176
275 3300031548 Ga0307408_100893362 Ga0307408_1008933621 176
276 3300031730 Ga0307516_10185565 Ga0307516_101855653 176
277 3300031731 Ga0307405_11043531 Ga0307405_110435312 176
278 3300031852 Ga0307410_10495974 Ga0307410_104959742 176
279 3300031995 Ga0307409_100571853 Ga0307409_1005718532 176
280 3300031995 Ga0307409_100928455 Ga0307409_1009284551 176
281 3300037312 Ga0395899_0000107 Ga0395899_0000107_33410_33991 176
282 3300037418 Ga0395900_0000101 Ga0395900_0000101_110097_110678 176
283 3300037466 Ga0395898_0000043 Ga0395898_0000043_33438_34019 176
284 3300037471 Ga0395905_0000101 Ga0395905_0000101_33438_34019 176
285 3300038443 Ga0395901_0000068 Ga0395901_0000068_33438_34019 176
286 3300044694 Ga0466963_0074512 Ga0466963_0074512_592_1224 176
287 3300044719 Ga0466971_0307571 Ga0466971_0307571_161_739 176
288 3300044765 Ga0466970_0008038 Ga0466970_0008038_546_1178 176
289 3300045049 Ga0466959_0394320 Ga0466959_0394320_284_916 176
290 3300045836 Ga0466958_0030801 Ga0466958_0030801_497_1129 176
291 3300046660 Ga0495625_0031485 Ga0495625_0031485_2913_3491 176
292 3300048919 Ga0496116_0021780 Ga0496116_0021780_3142_3735 176
293 3300048920 Ga0496117_0047305 Ga0496117_0047305_271_849 176
294 3300048921 Ga0496118_0019261 Ga0496118_0019261_3139_3717 176
295 3300048922 Ga0496119_0017910 Ga0496119_0017910_1705_2283 176
296 3300048922 Ga0496119_0040907 Ga0496119_0040907_487_1065 176
297 3300048923 Ga0496120_0038778 Ga0496120_0038778_388_966 176
298 3300048927 Ga0496124_0084160 Ga0496124_0084160_643_1221 176
299 3300048928 Ga0496125_0046864 Ga0496125_0046864_2360_2938 176
300 3300048928 Ga0496125_0160779 Ga0496125_0160779_618_1196 176
301 3300049590 Ga0501074_0653548 Ga0501074_0653548_27_608 176
302 3300050491 nmdc:mga00v17_202747_c1 nmdc:mga00v17_202747_c1_676_1254 176
303 3300050492 nmdc:mga0yw44_353544_c1 nmdc:mga0yw44_353544_c1_342_920 176
304 3300050494 nmdc:mga06z11_20784_c1 nmdc:mga06z11_20784_c1_2048_2632 176
305 3300050495 nmdc:mga04h51_3830_c1 nmdc:mga04h51_3830_c1_2019_2603 176
306 3300050516 nmdc:mga0sz30_35204_c1 nmdc:mga0sz30_35204_c1_645_1223 176
307 3300053087 Ga0500643_043218 Ga0500643_043218_269_850 176
308 3300053093 Ga0500651_0112391 Ga0500651_0112391_141_722 176
309 3300053153 Ga0500616_0099629 Ga0500616_0099629_273_854 176
310 3300053157 Ga0500624_012080 Ga0500624_012080_66_644 176
311 iso_pu_bacteria 3002141150 3002141200 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

16

186

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gah-assembly1.cif.gz_A structure of a f112h variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp 0.7965 6 165
2r6x-assembly1.cif.gz_A structure of a d35n variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp 0.7959 6 165
3ci1-assembly1.cif.gz_A structure of the pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with four-coordinate cob(ii)alamin and atp 0.7952 6 165
3gai-assembly1.cif.gz_A structure of a f112a variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp 0.7949 6 165
6wgs-assembly1.cif.gz_A mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to adenosylcobalamin 0.7831 12 174
ID Description Score Start End Superfamily
af_A4I133_189_375_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7891 22 163 1.20.1200.10
2idxB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7823 17 164 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7812 16 171 1.20.1200.10
af_Q18218_22_209_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7777 17 165 1.20.1200.10
af_Q54W51_39_259_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7766 17 162 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A2N3DWJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.889 1 79 GO:0005524
GO:0008817
GO:0009236
AF-A0A2N3DWJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.8801 1 79 GO:0005524
GO:0008817
GO:0009236
AF-A0A3B9RGR1-F1-model_v4 deleted 0.88 1 80
AF-A0A7S1NF66-F1-model_v4 Cobalamin adenosyltransferase-like domain-containing protein 0.8676 4 83 GO:0005524
GO:0008817
AF-A0A7G1I9X7-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.8606 1 79 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
69.34 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map