F401387

General Info

Members Datasets Scaffolds Average Seq Length
311 160 622 199

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0028363|Ga0495672_0028363_2620_3297
Length 225
Sequence LAQLLINLLKKPAGRKKLKINYMRKITVLTMITLDGVLQAPGGPKEDTSGRFKYGGWTAPYGDEAYSKVVQKELKTATDYLLGRKTFEIWAGYWPEHGDFWPGINEGTKYVFSKNMKKSDPIITGWKKSIVIKNVADIKKLKKSKGPDIQVWGSSKLIQLLLKNDLVDELRLKIHPLTLGNGKKLFNNGTIPAAFTLMDSIVTSKGVIIVSYKRAGKVKTGTVGA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 0.64
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0028363 3300047320 Bacteria 3544
2 rootL2_10004462 3300003322 Bacteria 1578
3 rootL2_10008241 3300003322 Unclassified 2156
4 Ga0065704_10223544 3300005289 Bacteria 1066
5 Ga0065712_10071173 3300005290 Bacteria 5439
6 Ga0065712_10282717 3300005290 Bacteria 874
7 Ga0065712_10412770 3300005290 Bacteria 719
8 Ga0070658_10001614 3300005327 Bacteria 19070
9 Ga0070658_10092299 3300005327 Bacteria 2496
10 Ga0070676_10123414 3300005328 Bacteria 1629
11 Ga0070676_10182922 3300005328 Bacteria 1364
12 Ga0070683_100010096 3300005329 Bacteria 8101
13 Ga0070690_100032549 3300005330 Bacteria 3258
14 Ga0070670_100874785 3300005331 Bacteria 814
15 Ga0068869_100029859 3300005334 Bacteria 3822
16 Ga0070666_10000042 3300005335 Bacteria 112296
17 Ga0070666_10019411 3300005335 Bacteria 4387
18 Ga0070680_100234769 3300005336 Bacteria 1549
19 Ga0070680_100253969 3300005336 Bacteria 1487
20 Ga0070680_100442985 3300005336 Bacteria 1109
21 Ga0070682_100217566 3300005337 Bacteria 1358
22 Ga0068868_100011877 3300005338 Bacteria 6349
23 Ga0068868_100045700 3300005338 Bacteria 3427
24 Ga0070660_100029501 3300005339 Bacteria 4112
25 Ga0070689_100038671 3300005340 Bacteria 3651
26 Ga0070689_100240205 3300005340 Bacteria 1492
27 Ga0070689_100290955 3300005340 Bacteria 1357
28 Ga0070689_100764030 3300005340 Bacteria 848
29 Ga0070687_100021071 3300005343 Bacteria 3057
30 Ga0070687_100091203 3300005343 Bacteria 1686
31 Ga0070661_100001575 3300005344 Bacteria 15817
32 Ga0070661_100170623 3300005344 Bacteria 1652
33 Ga0070668_100372296 3300005347 Bacteria 1214
34 Ga0070669_100483808 3300005353 Bacteria 1025
35 Ga0070671_100360449 3300005355 Unclassified 1241
36 Ga0070671_101232862 3300005355 Bacteria 659
37 Ga0070673_100099673 3300005364 Bacteria 2390
38 Ga0070673_100203878 3300005364 Bacteria 1704
39 Ga0070659_100046549 3300005366 Bacteria 3400
40 Ga0070667_100030009 3300005367 Bacteria 4535
41 Ga0070667_100188830 3300005367 Bacteria 1825
42 Ga0070667_100213764 3300005367 Bacteria 1715
43 Ga0070667_100734416 3300005367 Bacteria 915
44 Ga0070663_100384631 3300005455 Bacteria 1144
45 Ga0070662_100051116 3300005457 Bacteria 2983
46 Ga0070662_100200109 3300005457 Bacteria 1584
47 Ga0070662_100845830 3300005457 Bacteria 779
48 Ga0070681_10323761 3300005458 Bacteria 1451
49 Ga0068867_100232541 3300005459 Bacteria 1491
50 Ga0068867_100543975 3300005459 Bacteria 1005
51 Ga0070685_10020865 3300005466 Bacteria 3551
52 Ga0070679_100002897 3300005530 Bacteria 15586
53 Ga0070684_100047554 3300005535 Bacteria 3717
54 Ga0070684_100503571 3300005535 Bacteria 1122
55 Ga0070684_101341904 3300005535 Bacteria 673
56 Ga0068853_100001770 3300005539 Bacteria 15876
57 Ga0068853_100085615 3300005539 Bacteria 2763
58 Ga0068853_100785633 3300005539 Bacteria 911
59 Ga0070686_100040959 3300005544 Bacteria 2892
60 Ga0070686_100853357 3300005544 Bacteria 738
61 Ga0070693_100144426 3300005547 Unclassified 1501
62 Ga0070693_100265310 3300005547 Bacteria 1144
63 Ga0070693_100547278 3300005547 Bacteria 828
64 Ga0070665_100263958 3300005548 Bacteria 1723
65 Ga0070664_100004100 3300005564 Bacteria 11701
66 Ga0068857_100051054 3300005577 Bacteria 3667
67 Ga0068854_100014699 3300005578 Bacteria 5165
68 Ga0068854_100327778 3300005578 Bacteria 1247
69 Ga0068852_100003800 3300005616 Bacteria 10597
70 Ga0068852_100012047 3300005616 Bacteria 6545
71 Ga0068852_100080329 3300005616 Bacteria 2891
72 Ga0068852_100080971 3300005616 Bacteria 2881
73 Ga0068852_100735717 3300005616 Bacteria 998
74 Ga0068859_100000768 3300005617 Bacteria 32376
75 Ga0068859_100015256 3300005617 Bacteria 7716
76 Ga0068859_100037557 3300005617 Bacteria 4861
77 Ga0068859_100240463 3300005617 Bacteria 1899
78 Ga0068864_100082025 3300005618 Bacteria 2829
79 Ga0068861_100052171 3300005719 Bacteria 3108
80 Ga0068861_100444180 3300005719 Bacteria 1161
81 Ga0068851_10000330 3300005834 Bacteria 21529
82 Ga0068851_10094735 3300005834 Bacteria 1577
83 Ga0068863_100009065 3300005841 Bacteria 9715
84 Ga0068863_100128182 3300005841 Bacteria 2421
85 Ga0068863_100145497 3300005841 Bacteria 2266
86 Ga0068863_100147532 3300005841 Bacteria 2250
87 Ga0068863_100292021 3300005841 Bacteria 1580
88 Ga0068858_100066234 3300005842 Bacteria 3343
89 Ga0068858_100378691 3300005842 Bacteria 1358
90 Ga0068860_100001707 3300005843 Bacteria 23468
91 Ga0068860_100059558 3300005843 Bacteria 3629
92 Ga0068860_100083787 3300005843 Bacteria 3033
93 Ga0068860_100784324 3300005843 Bacteria 966
94 Ga0068862_100152151 3300005844 Bacteria 2060
95 Ga0070715_10016818 3300006163 Bacteria 2757
96 Ga0070715_10045234 3300006163 Bacteria 1865
97 Ga0075366_10001550 3300006195 Bacteria 11493
98 Ga0075366_10110642 3300006195 Bacteria 1652
99 Ga0097621_100013530 3300006237 Bacteria 6084
100 Ga0097621_100055710 3300006237 Bacteria 3229
101 Ga0097621_100319979 3300006237 Bacteria 1374
102 Ga0097621_101063687 3300006237 Bacteria 758
103 Ga0068871_100011948 3300006358 Bacteria 6391
104 Ga0068871_100063065 3300006358 Bacteria 3030
105 Ga0068871_100263580 3300006358 Bacteria 1504
106 Ga0068871_100949480 3300006358 Bacteria 799
107 Ga0075428_100212120 3300006844 Bacteria 2092
108 Ga0068865_100107194 3300006881 Bacteria 2055
109 Ga0097620_100000768 3300006931 Bacteria 32376
110 Ga0097620_100015256 3300006931 Bacteria 7716
111 Ga0097620_100037557 3300006931 Bacteria 4861
112 Ga0097620_100240479 3300006931 Bacteria 1899
113 Ga0105240_10001190 3300009093 Bacteria 45471
114 Ga0105240_10325813 3300009093 Bacteria 1749
115 Ga0105241_10000853 3300009174 Bacteria 23134
116 Ga0105241_10171896 3300009174 Bacteria 1790
117 Ga0105241_10321103 3300009174 Bacteria 1335
118 Ga0105242_10066940 3300009176 Bacteria 2968
119 Ga0105242_10101319 3300009176 Bacteria 2440
120 Ga0105242_10172478 3300009176 Bacteria 1902
121 Ga0105242_10800037 3300009176 Bacteria 933
122 Ga0105242_10950092 3300009176 Bacteria 864
123 Ga0105242_11240169 3300009176 Bacteria 767
124 Ga0105248_10174783 3300009177 Bacteria 2421
125 Ga0105237_10000833 3300009545 Bacteria 42120
126 Ga0105237_10124870 3300009545 Bacteria 2568
127 Ga0105249_10001650 3300009553 Bacteria 19547
128 Ga0105249_10002726 3300009553 Bacteria 15275
129 Ga0105249_10162644 3300009553 Bacteria 2158
130 Ga0105239_10019904 3300010375 Bacteria 7407
131 Ga0105239_10448227 3300010375 Bacteria 1464
132 Ga0105239_10454463 3300010375 Bacteria 1453
133 Ga0105246_10003384 3300011119 Bacteria 9663
134 Ga0105246_10024300 3300011119 Bacteria 3935
135 Ga0105246_10306054 3300011119 Bacteria 1285
136 Ga0157373_10027326 3300013100 Bacteria 4116
137 Ga0157373_10095795 3300013100 Bacteria 2089
138 Ga0157371_10134170 3300013102 Bacteria 1763
139 Ga0157369_10161940 3300013105 Bacteria 2362
140 Ga0157369_11104665 3300013105 Bacteria 810
141 Ga0157374_10317536 3300013296 Unclassified 1543
142 Ga0157374_10874571 3300013296 Bacteria 916
143 Ga0157378_10073750 3300013297 Unclassified 3069
144 Ga0157378_10083322 3300013297 Bacteria 2893
145 Ga0157378_10588883 3300013297 Bacteria 1122
146 Ga0163162_10025120 3300013306 Bacteria 5888
147 Ga0163162_10054907 3300013306 Bacteria 4008
148 Ga0163162_10335311 3300013306 Bacteria 1645
149 Ga0157372_10000683 3300013307 Bacteria 37283
150 Ga0157372_10562779 3300013307 Bacteria 1329
151 Ga0157372_10639775 3300013307 Bacteria 1239
152 Ga0157372_11246969 3300013307 Bacteria 859
153 Ga0157375_10033149 3300013308 Bacteria 4905
154 Ga0157375_10211795 3300013308 Bacteria 2095
155 Ga0157375_10358342 3300013308 Bacteria 1625
156 Ga0157375_10835293 3300013308 Bacteria 1068
157 Ga0163163_10341892 3300014325 Bacteria 1552
158 Ga0163163_10734176 3300014325 Bacteria 1051
159 Ga0163163_11032066 3300014325 Bacteria 886
160 Ga0157380_10301054 3300014326 Bacteria 1477
161 Ga0157380_10381624 3300014326 Bacteria 1330
162 Ga0157377_10013010 3300014745 Bacteria 4201
163 Ga0157379_10738155 3300014968 Bacteria 926
164 Ga0157376_10051608 3300014969 Bacteria 3417
165 Ga0157376_10100474 3300014969 Bacteria 2526
166 Ga0157376_10142939 3300014969 Bacteria 2149
167 Ga0157376_10250581 3300014969 Bacteria 1653
168 Ga0163161_10010043 3300017792 Bacteria 6554
169 Ga0163161_10028739 3300017792 Bacteria 3949
170 Ga0163161_10289904 3300017792 Bacteria 1286
171 Ga0207426_1000002 3300025302 Bacteria 1249660
172 Ga0207656_10000197 3300025321 Bacteria 21633
173 Ga0207688_10457810 3300025901 Bacteria 796
174 Ga0207680_10000448 3300025903 Bacteria 19470
175 Ga0207680_10443268 3300025903 Bacteria 921
176 Ga0207685_10078228 3300025905 Bacteria 1361
177 Ga0207645_10013783 3300025907 Bacteria 5424
178 Ga0207705_10002124 3300025909 Bacteria 15378
179 Ga0207705_10118878 3300025909 Bacteria 1959
180 Ga0207654_10013270 3300025911 Bacteria 4236
181 Ga0207654_10206714 3300025911 Bacteria 1296
182 Ga0207707_10109298 3300025912 Bacteria 2417
183 Ga0207707_10132747 3300025912 Bacteria 2177
184 Ga0207695_10000039 3300025913 Bacteria 454801
185 Ga0207671_10009669 3300025914 Bacteria 8031
186 Ga0207671_10073130 3300025914 Bacteria 2560
187 Ga0207671_10506177 3300025914 Bacteria 963
188 Ga0207660_10020274 3300025917 Bacteria 4458
189 Ga0207660_10231381 3300025917 Bacteria 1453
190 Ga0207662_10131201 3300025918 Bacteria 1580
191 Ga0207662_10222033 3300025918 Bacteria 1231
192 Ga0207657_10019311 3300025919 Bacteria 6476
193 Ga0207649_10005637 3300025920 Bacteria 6775
194 Ga0207649_10234708 3300025920 Bacteria 1313
195 Ga0207652_10000768 3300025921 Bacteria 30720
196 Ga0207644_10074215 3300025931 Bacteria 2496
197 Ga0207644_10653851 3300025931 Bacteria 875
198 Ga0207706_10010475 3300025933 Bacteria 8471
199 Ga0207706_10071782 3300025933 Bacteria 3045
200 Ga0207706_10819825 3300025933 Bacteria 789
201 Ga0207686_10000793 3300025934 Bacteria 19399
202 Ga0207686_10512125 3300025934 Bacteria 933
203 Ga0207686_10628343 3300025934 Bacteria 848
204 Ga0207670_10109205 3300025936 Bacteria 1990
205 Ga0207670_10365686 3300025936 Bacteria 1145
206 Ga0207669_10067624 3300025937 Bacteria 2228
207 Ga0207669_10069749 3300025937 Bacteria 2201
208 Ga0207704_10055389 3300025938 Bacteria 2423
209 Ga0207691_10274068 3300025940 Bacteria 1452
210 Ga0207689_10008911 3300025942 Bacteria 8701
211 Ga0207689_10021899 3300025942 Bacteria 5375
212 Ga0207689_10036403 3300025942 Bacteria 4086
213 Ga0207689_10038760 3300025942 Bacteria 3945
214 Ga0207661_10293603 3300025944 Bacteria 1455
215 Ga0207679_10058769 3300025945 Bacteria 2851
216 Ga0207667_10557014 3300025949 Bacteria 1159
217 Ga0207667_10595993 3300025949 Bacteria 1115
218 Ga0207651_10126863 3300025960 Bacteria 1946
219 Ga0207651_10168375 3300025960 Bacteria 1725
220 Ga0207651_11040361 3300025960 Bacteria 733
221 Ga0207712_10001133 3300025961 Bacteria 18560
222 Ga0207712_10108346 3300025961 Bacteria 2079
223 Ga0207712_10319984 3300025961 Bacteria 1279
224 Ga0207640_10031980 3300025981 Bacteria 3259
225 Ga0207658_10140244 3300025986 Bacteria 1955
226 Ga0207658_10149251 3300025986 Bacteria 1902
227 Ga0207658_10202248 3300025986 Bacteria 1659
228 Ga0207658_10495293 3300025986 Bacteria 1088
229 Ga0207677_10391189 3300026023 Bacteria 1176
230 Ga0207677_10576363 3300026023 Bacteria 984
231 Ga0207703_10006254 3300026035 Bacteria 9523
232 Ga0207639_10128558 3300026041 Bacteria 2094
233 Ga0207639_10284886 3300026041 Bacteria 1454
234 Ga0207639_11460695 3300026041 Bacteria 642
235 Ga0207678_10161683 3300026067 Bacteria 1912
236 Ga0207702_10144818 3300026078 Bacteria 2155
237 Ga0207641_10000368 3300026088 Bacteria 53493
238 Ga0207641_10005736 3300026088 Bacteria 10545
239 Ga0207676_10323393 3300026095 Bacteria 1417
240 Ga0207674_10004912 3300026116 Bacteria 15987
241 Ga0207675_100110326 3300026118 Bacteria 2596
242 Ga0207675_100239392 3300026118 Unclassified 1753
243 Ga0207675_100492450 3300026118 Bacteria 1220
244 Ga0207698_10002653 3300026142 Bacteria 10637
245 Ga0207698_10004090 3300026142 Bacteria 8854
246 Ga0207698_10061191 3300026142 Bacteria 2933
247 Ga0207698_10358490 3300026142 Bacteria 1380
248 Ga0207698_10669487 3300026142 Bacteria 1030
249 Ga0268265_10683737 3300028380 Bacteria 990
250 Ga0268265_10855253 3300028380 Bacteria 890
251 Ga0268264_10002457 3300028381 Bacteria 16284
252 Ga0268264_10395018 3300028381 Bacteria 1327
253 Ga0268264_10411666 3300028381 Bacteria 1302
254 Ga0268264_10558528 3300028381 Bacteria 1124
255 Ga0307515_10000002 3300028794 Bacteria 1231751
256 Ga0265327_10010853 3300031251 Bacteria 6348
257 Ga0265327_10015738 3300031251 Bacteria 4859
258 Ga0307414_10000016 3300032004 Bacteria 249029
259 Ga0307414_10586847 3300032004 Bacteria 998
260 Ga0307414_10742304 3300032004 Bacteria 892
261 Ga0307414_10828237 3300032004 Bacteria 845
262 Ga0373947_0047414 3300035725 Bacteria 2575
263 Ga0373937_0296846 3300036401 Bacteria 1527
264 Ga0373937_1288335 3300036401 Bacteria 679
265 Ga0395899_0114501 3300037312 Unclassified 1936
266 Ga0395899_0285785 3300037312 Bacteria 1120
267 Ga0395900_0224956 3300037418 Bacteria 1889
268 Ga0395900_0289054 3300037418 Unclassified 1628
269 Ga0395898_0138152 3300037466 Unclassified 2333
270 Ga0395898_0200854 3300037466 Bacteria 1903
271 Ga0395898_0976913 3300037466 Bacteria 783
272 Ga0395905_0001555 3300037471 Bacteria 27418
273 Ga0395901_0134469 3300038443 Bacteria 2599
274 Ga0395901_0147077 3300038443 Bacteria 2476
275 Ga0436365_0010910 3300039437 Bacteria 2468
276 Ga0451807_1035199 3300041486 Unclassified 941
277 Ga0451843_1063484 3300041509 Bacteria 711
278 Ga0439454_038792 3300042011 Bacteria 773
279 Ga0450894_008015 3300042131 Bacteria 1365
280 Ga0450898_006538 3300042134 Bacteria 1792
281 Ga0451577_0313638 3300042876 Bacteria 1422
282 Ga0451577_0707696 3300042876 Bacteria 912
283 Ga0453683_0000090 3300044673 Bacteria 137022
284 Ga0453683_0002145 3300044673 Bacteria 15718
285 Ga0453683_0406944 3300044673 Bacteria 877
286 Ga0453684_0001905 3300044712 Bacteria 54154
287 Ga0453684_0104662 3300044712 Bacteria 3454
288 Ga0451576_0032928 3300045051 Bacteria 5511
289 Ga0495638_0287513 3300046460 Bacteria 891
290 Ga0495639_0352357 3300046475 Bacteria 739
291 Ga0495630_0885886 3300046517 Bacteria 680
292 Ga0495586_0462813 3300046535 Bacteria 731
293 Ga0495645_0554388 3300046543 Bacteria 712
294 Ga0495634_0349868 3300046642 Bacteria 885
295 Ga0495635_0162320 3300046663 Bacteria 1521
296 Ga0495658_0526482 3300046683 Bacteria 757
297 Ga0495600_0315648 3300046809 Bacteria 984
298 Ga0495676_0099121 3300047321 Bacteria 2160
299 Ga0495686_0026406 3300047472 Unclassified 3799
300 Ga0496115_0002270 3300048918 Bacteria 13755
301 Ga0501034_0015190 3300049571 Bacteria 7915
302 Ga0501209_162639 3300049656 Bacteria 676
303 Ga0501044_0419037 3300049823 Bacteria 1249
304 nmdc:mga0k408_3656_c1 3300050493 Bacteria 8138
305 nmdc:mga0k408_37528_c1 3300050493 Bacteria 2782
306 nmdc:mga08y16_142949_c1 3300050511 Bacteria 2487
307 nmdc:mga08y16_708958_c1 3300050511 Bacteria 1005
308 Ga0500562_000038 3300053108 Bacteria 72186
309 Ga0500568_0000231 3300053139 Bacteria 47879
310 Ga0500622_0000340 3300053156 Bacteria 45986
311 2881362129 2881359912 Bacteria 4935907
312 Ga0495672_0028363
313 rootL2_10004462
314 rootL2_10008241
315 Ga0065704_10223544
316 Ga0065712_10071173
317 Ga0065712_10282717
318 Ga0065712_10412770
319 Ga0070658_10001614
320 Ga0070658_10092299
321 Ga0070676_10123414
322 Ga0070676_10182922
323 Ga0070683_100010096
324 Ga0070690_100032549
325 Ga0070670_100874785
326 Ga0068869_100029859
327 Ga0070666_10000042
328 Ga0070666_10019411
329 Ga0070680_100234769
330 Ga0070680_100253969
331 Ga0070680_100442985
332 Ga0070682_100217566
333 Ga0068868_100011877
334 Ga0068868_100045700
335 Ga0070660_100029501
336 Ga0070689_100038671
337 Ga0070689_100240205
338 Ga0070689_100290955
339 Ga0070689_100764030
340 Ga0070687_100021071
341 Ga0070687_100091203
342 Ga0070661_100001575
343 Ga0070661_100170623
344 Ga0070668_100372296
345 Ga0070669_100483808
346 Ga0070671_100360449
347 Ga0070671_101232862
348 Ga0070673_100099673
349 Ga0070673_100203878
350 Ga0070659_100046549
351 Ga0070667_100030009
352 Ga0070667_100188830
353 Ga0070667_100213764
354 Ga0070667_100734416
355 Ga0070663_100384631
356 Ga0070662_100051116
357 Ga0070662_100200109
358 Ga0070662_100845830
359 Ga0070681_10323761
360 Ga0068867_100232541
361 Ga0068867_100543975
362 Ga0070685_10020865
363 Ga0070679_100002897
364 Ga0070684_100047554
365 Ga0070684_100503571
366 Ga0070684_101341904
367 Ga0068853_100001770
368 Ga0068853_100085615
369 Ga0068853_100785633
370 Ga0070686_100040959
371 Ga0070686_100853357
372 Ga0070693_100144426
373 Ga0070693_100265310
374 Ga0070693_100547278
375 Ga0070665_100263958
376 Ga0070664_100004100
377 Ga0068857_100051054
378 Ga0068854_100014699
379 Ga0068854_100327778
380 Ga0068852_100003800
381 Ga0068852_100012047
382 Ga0068852_100080329
383 Ga0068852_100080971
384 Ga0068852_100735717
385 Ga0068859_100000768
386 Ga0068859_100015256
387 Ga0068859_100037557
388 Ga0068859_100240463
389 Ga0068864_100082025
390 Ga0068861_100052171
391 Ga0068861_100444180
392 Ga0068851_10000330
393 Ga0068851_10094735
394 Ga0068863_100009065
395 Ga0068863_100128182
396 Ga0068863_100145497
397 Ga0068863_100147532
398 Ga0068863_100292021
399 Ga0068858_100066234
400 Ga0068858_100378691
401 Ga0068860_100001707
402 Ga0068860_100059558
403 Ga0068860_100083787
404 Ga0068860_100784324
405 Ga0068862_100152151
406 Ga0070715_10016818
407 Ga0070715_10045234
408 Ga0075366_10001550
409 Ga0075366_10110642
410 Ga0097621_100013530
411 Ga0097621_100055710
412 Ga0097621_100319979
413 Ga0097621_101063687
414 Ga0068871_100011948
415 Ga0068871_100063065
416 Ga0068871_100263580
417 Ga0068871_100949480
418 Ga0075428_100212120
419 Ga0068865_100107194
420 Ga0097620_100000768
421 Ga0097620_100015256
422 Ga0097620_100037557
423 Ga0097620_100240479
424 Ga0105240_10001190
425 Ga0105240_10325813
426 Ga0105241_10000853
427 Ga0105241_10171896
428 Ga0105241_10321103
429 Ga0105242_10066940
430 Ga0105242_10101319
431 Ga0105242_10172478
432 Ga0105242_10800037
433 Ga0105242_10950092
434 Ga0105242_11240169
435 Ga0105248_10174783
436 Ga0105237_10000833
437 Ga0105237_10124870
438 Ga0105249_10001650
439 Ga0105249_10002726
440 Ga0105249_10162644
441 Ga0105239_10019904
442 Ga0105239_10448227
443 Ga0105239_10454463
444 Ga0105246_10003384
445 Ga0105246_10024300
446 Ga0105246_10306054
447 Ga0157373_10027326
448 Ga0157373_10095795
449 Ga0157371_10134170
450 Ga0157369_10161940
451 Ga0157369_11104665
452 Ga0157374_10317536
453 Ga0157374_10874571
454 Ga0157378_10073750
455 Ga0157378_10083322
456 Ga0157378_10588883
457 Ga0163162_10025120
458 Ga0163162_10054907
459 Ga0163162_10335311
460 Ga0157372_10000683
461 Ga0157372_10562779
462 Ga0157372_10639775
463 Ga0157372_11246969
464 Ga0157375_10033149
465 Ga0157375_10211795
466 Ga0157375_10358342
467 Ga0157375_10835293
468 Ga0163163_10341892
469 Ga0163163_10734176
470 Ga0163163_11032066
471 Ga0157380_10301054
472 Ga0157380_10381624
473 Ga0157377_10013010
474 Ga0157379_10738155
475 Ga0157376_10051608
476 Ga0157376_10100474
477 Ga0157376_10142939
478 Ga0157376_10250581
479 Ga0163161_10010043
480 Ga0163161_10028739
481 Ga0163161_10289904
482 Ga0207426_1000002
483 Ga0207656_10000197
484 Ga0207688_10457810
485 Ga0207680_10000448
486 Ga0207680_10443268
487 Ga0207685_10078228
488 Ga0207645_10013783
489 Ga0207705_10002124
490 Ga0207705_10118878
491 Ga0207654_10013270
492 Ga0207654_10206714
493 Ga0207707_10109298
494 Ga0207707_10132747
495 Ga0207695_10000039
496 Ga0207671_10009669
497 Ga0207671_10073130
498 Ga0207671_10506177
499 Ga0207660_10020274
500 Ga0207660_10231381
501 Ga0207662_10131201
502 Ga0207662_10222033
503 Ga0207657_10019311
504 Ga0207649_10005637
505 Ga0207649_10234708
506 Ga0207652_10000768
507 Ga0207644_10074215
508 Ga0207644_10653851
509 Ga0207706_10010475
510 Ga0207706_10071782
511 Ga0207706_10819825
512 Ga0207686_10000793
513 Ga0207686_10512125
514 Ga0207686_10628343
515 Ga0207670_10109205
516 Ga0207670_10365686
517 Ga0207669_10067624
518 Ga0207669_10069749
519 Ga0207704_10055389
520 Ga0207691_10274068
521 Ga0207689_10008911
522 Ga0207689_10021899
523 Ga0207689_10036403
524 Ga0207689_10038760
525 Ga0207661_10293603
526 Ga0207679_10058769
527 Ga0207667_10557014
528 Ga0207667_10595993
529 Ga0207651_10126863
530 Ga0207651_10168375
531 Ga0207651_11040361
532 Ga0207712_10001133
533 Ga0207712_10108346
534 Ga0207712_10319984
535 Ga0207640_10031980
536 Ga0207658_10140244
537 Ga0207658_10149251
538 Ga0207658_10202248
539 Ga0207658_10495293
540 Ga0207677_10391189
541 Ga0207677_10576363
542 Ga0207703_10006254
543 Ga0207639_10128558
544 Ga0207639_10284886
545 Ga0207639_11460695
546 Ga0207678_10161683
547 Ga0207702_10144818
548 Ga0207641_10000368
549 Ga0207641_10005736
550 Ga0207676_10323393
551 Ga0207674_10004912
552 Ga0207675_100110326
553 Ga0207675_100239392
554 Ga0207675_100492450
555 Ga0207698_10002653
556 Ga0207698_10004090
557 Ga0207698_10061191
558 Ga0207698_10358490
559 Ga0207698_10669487
560 Ga0268265_10683737
561 Ga0268265_10855253
562 Ga0268264_10002457
563 Ga0268264_10395018
564 Ga0268264_10411666
565 Ga0268264_10558528
566 Ga0307515_10000002
567 Ga0265327_10010853
568 Ga0265327_10015738
569 Ga0307414_10000016
570 Ga0307414_10586847
571 Ga0307414_10742304
572 Ga0307414_10828237
573 Ga0373947_0047414
574 Ga0373937_0296846
575 Ga0373937_1288335
576 Ga0395899_0114501
577 Ga0395899_0285785
578 Ga0395900_0224956
579 Ga0395900_0289054
580 Ga0395898_0138152
581 Ga0395898_0200854
582 Ga0395898_0976913
583 Ga0395905_0001555
584 Ga0395901_0134469
585 Ga0395901_0147077
586 Ga0436365_0010910
587 Ga0451807_1035199
588 Ga0451843_1063484
589 Ga0439454_038792
590 Ga0450894_008015
591 Ga0450898_006538
592 Ga0451577_0313638
593 Ga0451577_0707696
594 Ga0453683_0000090
595 Ga0453683_0002145
596 Ga0453683_0406944
597 Ga0453684_0001905
598 Ga0453684_0104662
599 Ga0451576_0032928
600 Ga0495638_0287513
601 Ga0495639_0352357
602 Ga0495630_0885886
603 Ga0495586_0462813
604 Ga0495645_0554388
605 Ga0495634_0349868
606 Ga0495635_0162320
607 Ga0495658_0526482
608 Ga0495600_0315648
609 Ga0495676_0099121
610 Ga0495686_0026406
611 Ga0496115_0002270
612 Ga0501034_0015190
613 Ga0501209_162639
614 Ga0501044_0419037
615 nmdc:mga0k408_3656_c1
616 nmdc:mga0k408_37528_c1
617 nmdc:mga08y16_142949_c1
618 nmdc:mga08y16_708958_c1
619 Ga0500562_000038
620 Ga0500568_0000231
621 Ga0500622_0000340
622 2881362129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

24

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7407 30 179
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7371 2 179
2jyb-assembly1.cif.gz_A binary hvdhfr1:folate complex 0.731 2 184
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7179 2 180
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7177 2 179
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7497 25 179 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7179 2 180 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.715 2 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7117 2 177 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7062 2 180 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9163 47 181 GO:0008703
GO:0009231
AF-A0A537J602-F1-model_v4 Deaminase 0.9055 85 182 GO:0008703
GO:0009231
AF-A0A1I2JP79-F1-model_v4 RibD C-terminal domain-containing protein 0.903 100 182 GO:0008703
GO:0009231
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9026 34 182 GO:0008703
GO:0009231
AF-A0A534PLK5-F1-model_v4 Dihydrofolate reductase 0.9012 87 182 GO:0008703
GO:0009231

Map