F401340

General Info

Members Datasets Scaffolds Average Seq Length
311 193 622 290

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0026995|Ga0466963_0026995_1673_2704
Length 323
Sequence LPADGQRHRGRGRVQADLRRPLNERVAFLVNPASDNGATGKRWPELAHRATRLGLSGETLLSERPGHLIELARQAVDGGTELVVAVGGDGTLNEVVNGVAGTGAELATIPLGTGMDFGRTYGIPTKFDEAVRVALDGTTRTIDAGRVRYRTWAGDDAERWFANVGSVGMSGTVAQRANGMSKVLGGKVTFFYALTRVFLEWQNTEVTVRVDGGERRGRMHDVIVANGVWHGGGMKLAPDATPDDGVFDVVLIGDVSKVDFLTTAPKIYKGRHVHHPKVEVLRSARVEVDAPEILPIELEGEQVGTTPATFEVVPGALRIRVPG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0026995 3300044694 Bacteria 3673
2 Ga0070658_10342936 3300005327 Bacteria 1278
3 Ga0070683_100009700 3300005329 Bacteria 8243
4 Ga0070683_100157992 3300005329 Bacteria 2151
5 Ga0070683_100247151 3300005329 Bacteria 1697
6 Ga0070670_100103843 3300005331 Bacteria 2448
7 Ga0068869_100032989 3300005334 Bacteria 3653
8 Ga0070680_100024864 3300005336 Bacteria 4787
9 Ga0070680_100048592 3300005336 Bacteria 3458
10 Ga0070680_100207015 3300005336 Bacteria 1655
11 Ga0070682_100017324 3300005337 Bacteria 4198
12 Ga0070660_100033559 3300005339 Bacteria 3869
13 Ga0070660_100036981 3300005339 Bacteria 3700
14 Ga0070660_100050918 3300005339 Bacteria 3187
15 Ga0070661_100041553 3300005344 Bacteria 3356
16 Ga0070661_100079997 3300005344 Bacteria 2412
17 Ga0070661_100109467 3300005344 Bacteria 2062
18 Ga0070692_10002767 3300005345 Bacteria 6907
19 Ga0070668_100006156 3300005347 Bacteria 8889
20 Ga0070709_10360816 3300005434 Bacteria 1076
21 Ga0070714_100004907 3300005435 Bacteria 10160
22 Ga0070714_100007131 3300005435 Bacteria 8671
23 Ga0070708_100014184 3300005445 Bacteria 6548
24 Ga0070663_100094069 3300005455 Bacteria 2225
25 Ga0070663_100486022 3300005455 Bacteria 1023
26 Ga0070678_100056276 3300005456 Bacteria 2876
27 Ga0070678_100297810 3300005456 Bacteria 1370
28 Ga0070681_10000749 3300005458 Bacteria 26980
29 Ga0070681_10039135 3300005458 Unclassified 4753
30 Ga0070681_10047094 3300005458 Bacteria 4309
31 Ga0070681_10082113 3300005458 Unclassified 3178
32 Ga0070681_10213090 3300005458 Bacteria 1848
33 Ga0070706_100440582 3300005467 Bacteria 1213
34 Ga0070698_100102685 3300005471 Bacteria 2830
35 Ga0070698_100173782 3300005471 Bacteria 2094
36 Ga0070699_100020721 3300005518 Bacteria 5671
37 Ga0070699_100258190 3300005518 Bacteria 1558
38 Ga0070679_100186474 3300005530 Bacteria 2045
39 Ga0070684_100094756 3300005535 Bacteria 2659
40 Ga0070684_100292068 3300005535 Bacteria 1495
41 Ga0068853_100082155 3300005539 Bacteria 2822
42 Ga0068855_100019092 3300005563 Bacteria 8239
43 Ga0068855_100484817 3300005563 Bacteria 1345
44 Ga0068852_100012754 3300005616 Bacteria 6399
45 Ga0068852_100075877 3300005616 Bacteria 2967
46 Ga0068870_10007103 3300005840 Bacteria 4977
47 Ga0070717_10025828 3300006028 Bacteria 4678
48 Ga0097621_100182394 3300006237 Bacteria 1814
49 Ga0068871_100167301 3300006358 Archaea 1883
50 Ga0075428_100551565 3300006844 Bacteria 1232
51 Ga0075430_100027229 3300006846 Bacteria 4860
52 Ga0105240_10311033 3300009093 Bacteria 1799
53 Ga0105240_10560993 3300009093 Bacteria 1262
54 Ga0105245_10193397 3300009098 Bacteria 1950
55 Ga0105242_10036689 3300009176 Bacteria 3934
56 Ga0105238_10039642 3300009551 Bacteria 4776
57 Ga0105249_10000139 3300009553 Bacteria 94384
58 Ga0105239_10196324 3300010375 Bacteria 2260
59 Ga0157373_10024509 3300013100 Bacteria 4369
60 Ga0157373_10081326 3300013100 Bacteria 2284
61 Ga0157371_10138347 3300013102 Unclassified 1735
62 Ga0157370_10192841 3300013104 Bacteria 1891
63 Ga0157369_10003856 3300013105 Bacteria 17824
64 Ga0157369_10078926 3300013105 Bacteria 3526
65 Ga0157369_10121781 3300013105 Unclassified 2767
66 Ga0157374_10149875 3300013296 Unclassified 2267
67 Ga0163162_10000045 3300013306 Bacteria 127819
68 Ga0157372_10365387 3300013307 Bacteria 1682
69 Ga0157375_10293090 3300013308 Bacteria 1790
70 Ga0157380_10072503 3300014326 Bacteria 2790
71 Ga0206354_10755600 3300020081 Bacteria 1938
72 Ga0206354_11410605 3300020081 Bacteria 2003
73 Ga0206353_10342178 3300020082 Bacteria 2612
74 Ga0206353_11117654 3300020082 Bacteria 5681
75 Ga0206353_11175675 3300020082 Bacteria 3870
76 Ga0207705_10383375 3300025909 Bacteria 1086
77 Ga0207654_10042579 3300025911 Unclassified 2571
78 Ga0207707_10023124 3300025912 Bacteria 5439
79 Ga0207707_10201494 3300025912 Unclassified 1735
80 Ga0207693_10128095 3300025915 Bacteria 1996
81 Ga0207660_10008175 3300025917 Bacteria 6769
82 Ga0207660_10079599 3300025917 Bacteria 2404
83 Ga0207657_10004929 3300025919 Bacteria 14033
84 Ga0207657_10051886 3300025919 Unclassified 3563
85 Ga0207649_10171094 3300025920 Bacteria 1513
86 Ga0207652_10006427 3300025921 Bacteria 9475
87 Ga0207652_10069815 3300025921 Bacteria 3050
88 Ga0207652_10080801 3300025921 Unclassified 2843
89 Ga0207659_10285994 3300025926 Bacteria 1350
90 Ga0207664_10372587 3300025929 Bacteria 1266
91 Ga0207664_10382180 3300025929 Bacteria 1250
92 Ga0207644_10071320 3300025931 Bacteria 2541
93 Ga0207661_10158826 3300025944 Bacteria 1960
94 Ga0207712_10000139 3300025961 Bacteria 76388
95 Ga0207668_10010417 3300025972 Bacteria 5615
96 Ga0207678_10086611 3300026067 Bacteria 2677
97 Ga0207678_10230116 3300026067 Bacteria 1587
98 Ga0207702_10031145 3300026078 Bacteria 4446
99 Ga0207674_10078247 3300026116 Bacteria 3312
100 Ga0207674_10316441 3300026116 Bacteria 1510
101 Ga0207683_10156409 3300026121 Bacteria 2059
102 Ga0207683_10238721 3300026121 Bacteria 1658
103 Ga0207698_10008070 3300026142 Bacteria 6639
104 Ga0207698_10060354 3300026142 Bacteria 2949
105 Ga0265337_1026012 3300028556 Bacteria 1777
106 Ga0265319_1000793 3300028563 Bacteria 20469
107 Ga0265334_10000386 3300028573 Bacteria 23500
108 Ga0265318_10000286 3300028577 Bacteria 41428
109 Ga0265318_10022142 3300028577 Bacteria 2544
110 Ga0265323_10018459 3300028653 Bacteria 2699
111 Ga0265322_10004433 3300028654 Bacteria 4184
112 Ga0265336_10004057 3300028666 Bacteria 5579
113 Ga0265338_10004582 3300028800 Bacteria 18589
114 Ga0265338_10054962 3300028800 Bacteria 3545
115 Ga0265324_10035997 3300029957 Bacteria 1722
116 Ga0265330_10000170 3300031235 Bacteria 51357
117 Ga0265330_10015881 3300031235 Bacteria 3479
118 Ga0265332_10001371 3300031238 Bacteria 13785
119 Ga0265328_10000396 3300031239 Bacteria 20417
120 Ga0265320_10012728 3300031240 Bacteria 4879
121 Ga0265320_10013367 3300031240 Bacteria 4726
122 Ga0265325_10000058 3300031241 Bacteria 76250
123 Ga0265325_10025529 3300031241 Bacteria 3207
124 Ga0265325_10027998 3300031241 Bacteria 3042
125 Ga0265329_10001018 3300031242 Bacteria 13981
126 Ga0265340_10001302 3300031247 Bacteria 14295
127 Ga0265340_10061046 3300031247 Unclassified 1804
128 Ga0265339_10001168 3300031249 Bacteria 19822
129 Ga0265339_10002081 3300031249 Bacteria 14653
130 Ga0265331_10000568 3300031250 Bacteria 33224
131 Ga0265331_10046125 3300031250 Bacteria 2102
132 Ga0265327_10004500 3300031251 Bacteria 12303
133 Ga0265316_10000700 3300031344 Bacteria 37322
134 Ga0265316_10009407 3300031344 Bacteria 9002
135 Ga0265313_10000754 3300031595 Bacteria 33060
136 Ga0265313_10004167 3300031595 Bacteria 11226
137 Ga0265313_10017720 3300031595 Bacteria 4030
138 Ga0265314_10000982 3300031711 Bacteria 33556
139 Ga0265314_10009563 3300031711 Bacteria 8168
140 Ga0265314_10010725 3300031711 Bacteria 7625
141 Ga0265342_10001473 3300031712 Bacteria 21888
142 Ga0307405_10119924 3300031731 Bacteria 1798
143 Ga0307405_10385666 3300031731 Unclassified 1092
144 Ga0307413_10403076 3300031824 Bacteria 1072
145 Ga0307406_10009482 3300031901 Bacteria 5460
146 Ga0307407_10142693 3300031903 Unclassified 1547
147 Ga0307412_10085904 3300031911 Bacteria 2188
148 Ga0307412_10441231 3300031911 Bacteria 1070
149 Ga0307409_100030991 3300031995 Bacteria 3852
150 Ga0307416_100099823 3300032002 Unclassified 2522
151 Ga0307415_100001620 3300032126 Bacteria 10876
152 Ga0373926_0033976 3300035083 Bacteria 1804
153 Ga0373944_0003460 3300035089 Bacteria 4078
154 Ga0373943_0004770 3300035170 Bacteria 6128
155 Ga0373935_0018087 3300035692 Bacteria 4284
156 Ga0373927_0028847 3300035695 Bacteria 3619
157 Ga0373947_0000833 3300035725 Bacteria 18617
158 Ga0373937_0231758 3300036401 Unclassified 1739
159 Ga0373925_0015724 3300037068 Bacteria 5477
160 Ga0395900_0013885 3300037418 Bacteria 8219
161 Ga0395900_0017733 3300037418 Bacteria 7265
162 Ga0395900_0036175 3300037418 Bacteria 5089
163 Ga0395900_0132106 3300037418 Bacteria 2558
164 Ga0395900_0161793 3300037418 Bacteria 2283
165 Ga0395905_0009477 3300037471 Bacteria 9513
166 Ga0395901_0025462 3300038443 Bacteria 6074
167 Ga0395901_0032513 3300038443 Bacteria 5382
168 Ga0395901_0057250 3300038443 Unclassified 4054
169 Ga0395901_0079067 3300038443 Bacteria 3434
170 Ga0395901_0104986 3300038443 Bacteria 2965
171 Ga0395901_0173644 3300038443 Bacteria 2261
172 Ga0395901_0344121 3300038443 Bacteria 1540
173 Ga0466961_0076396 3300044693 Bacteria 2123
174 Ga0466961_0287233 3300044693 Bacteria 1006
175 Ga0466963_0055724 3300044694 Bacteria 2629
176 Ga0466963_0145791 3300044694 Bacteria 1642
177 Ga0466957_0193665 3300044842 Bacteria 1333
178 Ga0466959_0008653 3300045049 Bacteria 7204
179 Ga0466959_0287001 3300045049 Unclassified 1129
180 Ga0466958_0021364 3300045836 Bacteria 3781
181 Ga0466967_0012033 3300045976 Bacteria 6594
182 Ga0466967_0012582 3300045976 Bacteria 6484
183 Ga0466967_0014542 3300045976 Bacteria 6135
184 Ga0466967_0020228 3300045976 Bacteria 5374
185 Ga0466967_0025019 3300045976 Bacteria 4916
186 Ga0466967_0039559 3300045976 Bacteria 4055
187 Ga0466967_0160985 3300045976 Unclassified 2106
188 Ga0495592_0080210 3300046454 Bacteria 2362
189 Ga0495603_0087607 3300046455 Bacteria 1822
190 Ga0495629_0000983 3300046459 Bacteria 22888
191 Ga0495629_0170881 3300046459 Bacteria 1508
192 Ga0495641_0000513 3300046461 Bacteria 32468
193 Ga0495641_0079495 3300046461 Bacteria 1469
194 Ga0495651_0085130 3300046462 Bacteria 2381
195 Ga0495651_0092323 3300046462 Bacteria 2268
196 Ga0495582_0000553 3300046473 Bacteria 20635
197 Ga0495582_0219171 3300046473 Bacteria 1088
198 Ga0495639_0009403 3300046475 Bacteria 4192
199 Ga0495639_0096850 3300046475 Bacteria 1390
200 Ga0495662_0007890 3300046476 Bacteria 5240
201 Ga0495664_0287307 3300046477 Bacteria 993
202 Ga0495594_0020401 3300046499 Bacteria 3530
203 Ga0495594_0113935 3300046499 Bacteria 1526
204 Ga0495608_0204591 3300046511 Bacteria 1242
205 Ga0495618_0074661 3300046514 Bacteria 2159
206 Ga0495628_0049357 3300046516 Bacteria 3333
207 Ga0495630_0012886 3300046517 Bacteria 6074
208 Ga0495630_0039587 3300046517 Bacteria 3524
209 Ga0495652_0127865 3300046529 Bacteria 2016
210 Ga0495652_0199301 3300046529 Bacteria 1520
211 Ga0495652_0215135 3300046529 Bacteria 1448
212 Ga0495652_0223529 3300046529 Bacteria 1413
213 Ga0495665_0005465 3300046531 Bacteria 6844
214 Ga0495640_0024123 3300046533 Bacteria 4425
215 Ga0495587_0011402 3300046536 Bacteria 5635
216 Ga0495587_0192601 3300046536 Unclassified 1154
217 Ga0495645_0161401 3300046543 Bacteria 1549
218 Ga0495645_0169086 3300046543 Bacteria 1506
219 Ga0495667_0016085 3300046559 Bacteria 5057
220 Ga0495667_0028440 3300046559 Bacteria 3764
221 Ga0495667_0035465 3300046559 Bacteria 3333
222 Ga0495634_0015592 3300046642 Bacteria 5454
223 Ga0495634_0066753 3300046642 Bacteria 2381
224 Ga0495635_0050451 3300046663 Bacteria 2868
225 Ga0495635_0267642 3300046663 Unclassified 1150
226 Ga0495657_0019102 3300046675 Bacteria 4950
227 Ga0495657_0109654 3300046675 Bacteria 1750
228 Ga0495623_0104830 3300046679 Unclassified 1719
229 Ga0495647_0007902 3300046681 Bacteria 3573
230 Ga0495658_0002075 3300046683 Bacteria 10156
231 Ga0495624_0007147 3300046690 Bacteria 7857
232 Ga0495600_0061348 3300046809 Bacteria 2456
233 Ga0495600_0065733 3300046809 Bacteria 2371
234 Ga0495581_0001833 3300047315 Bacteria 11890
235 Ga0495604_0027208 3300047317 Bacteria 4550
236 Ga0495604_0064863 3300047317 Bacteria 2782
237 Ga0495604_0085022 3300047317 Bacteria 2361
238 Ga0495674_0003155 3300047319 Bacteria 16010
239 Ga0495674_0049237 3300047319 Bacteria 3724
240 Ga0495674_0118262 3300047319 Bacteria 2241
241 Ga0495674_0243076 3300047319 Bacteria 1483
242 Ga0495676_0002145 3300047321 Bacteria 17448
243 Ga0495680_0004330 3300047322 Bacteria 13597
244 Ga0495680_0007287 3300047322 Bacteria 10179
245 Ga0495680_0019817 3300047322 Bacteria 5672
246 Ga0495680_0083713 3300047322 Bacteria 2405
247 Ga0495684_0021761 3300047471 Bacteria 4936
248 Ga0495684_0039238 3300047471 Bacteria 3630
249 Ga0495684_0060358 3300047471 Bacteria 2887
250 Ga0495593_0009203 3300047673 Bacteria 5726
251 Ga0495602_0253950 3300048088 Bacteria 1308
252 Ga0496101_0016057 3300048904 Bacteria 5054
253 Ga0496101_0082091 3300048904 Bacteria 2385
254 Ga0496103_0036852 3300048906 Bacteria 2996
255 Ga0496104_0352337 3300048907 Bacteria 1385
256 Ga0496105_0199191 3300048908 Bacteria 1635
257 Ga0496106_0049037 3300048909 Bacteria 3180
258 Ga0496107_0027172 3300048910 Bacteria 4063
259 Ga0496108_0039313 3300048911 Bacteria 3943
260 Ga0496109_0101248 3300048912 Bacteria 2674
261 Ga0496112_0028531 3300048915 Bacteria 5387
262 Ga0496112_0031121 3300048915 Bacteria 5172
263 Ga0496112_0121171 3300048915 Bacteria 2585
264 Ga0496112_0348754 3300048915 Unclassified 1423
265 Ga0496114_0004918 3300048917 Bacteria 10410
266 Ga0496114_0013266 3300048917 Bacteria 6606
267 Ga0496115_0071485 3300048918 Bacteria 2814
268 Ga0496115_0316998 3300048918 Unclassified 1276
269 Ga0501031_0012897 3300049568 Bacteria 5460
270 Ga0501034_0005913 3300049571 Bacteria 13279
271 Ga0501036_0025184 3300049572 Bacteria 5019
272 Ga0501038_0034145 3300049574 Bacteria 4475
273 Ga0501039_0005311 3300049575 Bacteria 9743
274 Ga0501040_0017308 3300049576 Bacteria 4782
275 Ga0501041_0002135 3300049577 Bacteria 11143
276 Ga0501047_0135806 3300049581 Bacteria 2340
277 Ga0501048_0012388 3300049582 Bacteria 6343
278 Ga0501067_0007804 3300049583 Bacteria 5951
279 Ga0501067_0016686 3300049583 Bacteria 4058
280 Ga0501068_0167314 3300049584 Bacteria 1387
281 Ga0501069_0025485 3300049585 Bacteria 3233
282 Ga0501069_0030717 3300049585 Bacteria 2952
283 Ga0501070_0000932 3300049586 Bacteria 26359
284 Ga0501070_0192474 3300049586 Bacteria 1676
285 Ga0501073_0010184 3300049589 Bacteria 6906
286 Ga0501073_0217190 3300049589 Bacteria 1321
287 Ga0501074_0008573 3300049590 Bacteria 7406
288 Ga0501074_0080119 3300049590 Bacteria 2343
289 Ga0501074_0084479 3300049590 Bacteria 2275
290 Ga0501075_0021028 3300049591 Bacteria 4754
291 Ga0501075_0446837 3300049591 Bacteria 986
292 Ga0501076_0005885 3300049592 Bacteria 8845
293 Ga0501076_0092590 3300049592 Bacteria 2432
294 Ga0501077_0032233 3300049593 Bacteria 3336
295 Ga0501079_0017819 3300049741 Bacteria 5425
296 Ga0501080_0025463 3300049742 Bacteria 5491
297 Ga0501080_0056124 3300049742 Bacteria 3668
298 Ga0501081_0132096 3300049743 Bacteria 1784
299 Ga0501035_0200277 3300049822 Bacteria 1713
300 Ga0501044_0377559 3300049823 Bacteria 1333
301 Ga0501045_0008744 3300049824 Bacteria 7063
302 nmdc:mga05p37_77345_c1 3300050507 Bacteria 4096
303 nmdc:mga06r32_415254_c1 3300050510 Bacteria 1327
304 Ga0495601_0041360 3300053077 Bacteria 2889
305 Ga0495612_0065946 3300053078 Bacteria 1504
306 Ga0495612_0070451 3300053078 Unclassified 1457
307 Ga0495595_0120925 3300053084 Bacteria 1275
308 Ga0495619_0010604 3300053085 Bacteria 5797
309 Ga0501084_0028833 3300054114 Bacteria 4640
310 Ga0501084_0177529 3300054114 Bacteria 1798
311 Ga0530510_0049726 3300061734 Bacteria 3028
312 Ga0466963_0026995
313 Ga0070658_10342936
314 Ga0070683_100009700
315 Ga0070683_100157992
316 Ga0070683_100247151
317 Ga0070670_100103843
318 Ga0068869_100032989
319 Ga0070680_100024864
320 Ga0070680_100048592
321 Ga0070680_100207015
322 Ga0070682_100017324
323 Ga0070660_100033559
324 Ga0070660_100036981
325 Ga0070660_100050918
326 Ga0070661_100041553
327 Ga0070661_100079997
328 Ga0070661_100109467
329 Ga0070692_10002767
330 Ga0070668_100006156
331 Ga0070709_10360816
332 Ga0070714_100004907
333 Ga0070714_100007131
334 Ga0070708_100014184
335 Ga0070663_100094069
336 Ga0070663_100486022
337 Ga0070678_100056276
338 Ga0070678_100297810
339 Ga0070681_10000749
340 Ga0070681_10039135
341 Ga0070681_10047094
342 Ga0070681_10082113
343 Ga0070681_10213090
344 Ga0070706_100440582
345 Ga0070698_100102685
346 Ga0070698_100173782
347 Ga0070699_100020721
348 Ga0070699_100258190
349 Ga0070679_100186474
350 Ga0070684_100094756
351 Ga0070684_100292068
352 Ga0068853_100082155
353 Ga0068855_100019092
354 Ga0068855_100484817
355 Ga0068852_100012754
356 Ga0068852_100075877
357 Ga0068870_10007103
358 Ga0070717_10025828
359 Ga0097621_100182394
360 Ga0068871_100167301
361 Ga0075428_100551565
362 Ga0075430_100027229
363 Ga0105240_10311033
364 Ga0105240_10560993
365 Ga0105245_10193397
366 Ga0105242_10036689
367 Ga0105238_10039642
368 Ga0105249_10000139
369 Ga0105239_10196324
370 Ga0157373_10024509
371 Ga0157373_10081326
372 Ga0157371_10138347
373 Ga0157370_10192841
374 Ga0157369_10003856
375 Ga0157369_10078926
376 Ga0157369_10121781
377 Ga0157374_10149875
378 Ga0163162_10000045
379 Ga0157372_10365387
380 Ga0157375_10293090
381 Ga0157380_10072503
382 Ga0206354_10755600
383 Ga0206354_11410605
384 Ga0206353_10342178
385 Ga0206353_11117654
386 Ga0206353_11175675
387 Ga0207705_10383375
388 Ga0207654_10042579
389 Ga0207707_10023124
390 Ga0207707_10201494
391 Ga0207693_10128095
392 Ga0207660_10008175
393 Ga0207660_10079599
394 Ga0207657_10004929
395 Ga0207657_10051886
396 Ga0207649_10171094
397 Ga0207652_10006427
398 Ga0207652_10069815
399 Ga0207652_10080801
400 Ga0207659_10285994
401 Ga0207664_10372587
402 Ga0207664_10382180
403 Ga0207644_10071320
404 Ga0207661_10158826
405 Ga0207712_10000139
406 Ga0207668_10010417
407 Ga0207678_10086611
408 Ga0207678_10230116
409 Ga0207702_10031145
410 Ga0207674_10078247
411 Ga0207674_10316441
412 Ga0207683_10156409
413 Ga0207683_10238721
414 Ga0207698_10008070
415 Ga0207698_10060354
416 Ga0265337_1026012
417 Ga0265319_1000793
418 Ga0265334_10000386
419 Ga0265318_10000286
420 Ga0265318_10022142
421 Ga0265323_10018459
422 Ga0265322_10004433
423 Ga0265336_10004057
424 Ga0265338_10004582
425 Ga0265338_10054962
426 Ga0265324_10035997
427 Ga0265330_10000170
428 Ga0265330_10015881
429 Ga0265332_10001371
430 Ga0265328_10000396
431 Ga0265320_10012728
432 Ga0265320_10013367
433 Ga0265325_10000058
434 Ga0265325_10025529
435 Ga0265325_10027998
436 Ga0265329_10001018
437 Ga0265340_10001302
438 Ga0265340_10061046
439 Ga0265339_10001168
440 Ga0265339_10002081
441 Ga0265331_10000568
442 Ga0265331_10046125
443 Ga0265327_10004500
444 Ga0265316_10000700
445 Ga0265316_10009407
446 Ga0265313_10000754
447 Ga0265313_10004167
448 Ga0265313_10017720
449 Ga0265314_10000982
450 Ga0265314_10009563
451 Ga0265314_10010725
452 Ga0265342_10001473
453 Ga0307405_10119924
454 Ga0307405_10385666
455 Ga0307413_10403076
456 Ga0307406_10009482
457 Ga0307407_10142693
458 Ga0307412_10085904
459 Ga0307412_10441231
460 Ga0307409_100030991
461 Ga0307416_100099823
462 Ga0307415_100001620
463 Ga0373926_0033976
464 Ga0373944_0003460
465 Ga0373943_0004770
466 Ga0373935_0018087
467 Ga0373927_0028847
468 Ga0373947_0000833
469 Ga0373937_0231758
470 Ga0373925_0015724
471 Ga0395900_0013885
472 Ga0395900_0017733
473 Ga0395900_0036175
474 Ga0395900_0132106
475 Ga0395900_0161793
476 Ga0395905_0009477
477 Ga0395901_0025462
478 Ga0395901_0032513
479 Ga0395901_0057250
480 Ga0395901_0079067
481 Ga0395901_0104986
482 Ga0395901_0173644
483 Ga0395901_0344121
484 Ga0466961_0076396
485 Ga0466961_0287233
486 Ga0466963_0055724
487 Ga0466963_0145791
488 Ga0466957_0193665
489 Ga0466959_0008653
490 Ga0466959_0287001
491 Ga0466958_0021364
492 Ga0466967_0012033
493 Ga0466967_0012582
494 Ga0466967_0014542
495 Ga0466967_0020228
496 Ga0466967_0025019
497 Ga0466967_0039559
498 Ga0466967_0160985
499 Ga0495592_0080210
500 Ga0495603_0087607
501 Ga0495629_0000983
502 Ga0495629_0170881
503 Ga0495641_0000513
504 Ga0495641_0079495
505 Ga0495651_0085130
506 Ga0495651_0092323
507 Ga0495582_0000553
508 Ga0495582_0219171
509 Ga0495639_0009403
510 Ga0495639_0096850
511 Ga0495662_0007890
512 Ga0495664_0287307
513 Ga0495594_0020401
514 Ga0495594_0113935
515 Ga0495608_0204591
516 Ga0495618_0074661
517 Ga0495628_0049357
518 Ga0495630_0012886
519 Ga0495630_0039587
520 Ga0495652_0127865
521 Ga0495652_0199301
522 Ga0495652_0215135
523 Ga0495652_0223529
524 Ga0495665_0005465
525 Ga0495640_0024123
526 Ga0495587_0011402
527 Ga0495587_0192601
528 Ga0495645_0161401
529 Ga0495645_0169086
530 Ga0495667_0016085
531 Ga0495667_0028440
532 Ga0495667_0035465
533 Ga0495634_0015592
534 Ga0495634_0066753
535 Ga0495635_0050451
536 Ga0495635_0267642
537 Ga0495657_0019102
538 Ga0495657_0109654
539 Ga0495623_0104830
540 Ga0495647_0007902
541 Ga0495658_0002075
542 Ga0495624_0007147
543 Ga0495600_0061348
544 Ga0495600_0065733
545 Ga0495581_0001833
546 Ga0495604_0027208
547 Ga0495604_0064863
548 Ga0495604_0085022
549 Ga0495674_0003155
550 Ga0495674_0049237
551 Ga0495674_0118262
552 Ga0495674_0243076
553 Ga0495676_0002145
554 Ga0495680_0004330
555 Ga0495680_0007287
556 Ga0495680_0019817
557 Ga0495680_0083713
558 Ga0495684_0021761
559 Ga0495684_0039238
560 Ga0495684_0060358
561 Ga0495593_0009203
562 Ga0495602_0253950
563 Ga0496101_0016057
564 Ga0496101_0082091
565 Ga0496103_0036852
566 Ga0496104_0352337
567 Ga0496105_0199191
568 Ga0496106_0049037
569 Ga0496107_0027172
570 Ga0496108_0039313
571 Ga0496109_0101248
572 Ga0496112_0028531
573 Ga0496112_0031121
574 Ga0496112_0121171
575 Ga0496112_0348754
576 Ga0496114_0004918
577 Ga0496114_0013266
578 Ga0496115_0071485
579 Ga0496115_0316998
580 Ga0501031_0012897
581 Ga0501034_0005913
582 Ga0501036_0025184
583 Ga0501038_0034145
584 Ga0501039_0005311
585 Ga0501040_0017308
586 Ga0501041_0002135
587 Ga0501047_0135806
588 Ga0501048_0012388
589 Ga0501067_0007804
590 Ga0501067_0016686
591 Ga0501068_0167314
592 Ga0501069_0025485
593 Ga0501069_0030717
594 Ga0501070_0000932
595 Ga0501070_0192474
596 Ga0501073_0010184
597 Ga0501073_0217190
598 Ga0501074_0008573
599 Ga0501074_0080119
600 Ga0501074_0084479
601 Ga0501075_0021028
602 Ga0501075_0446837
603 Ga0501076_0005885
604 Ga0501076_0092590
605 Ga0501077_0032233
606 Ga0501079_0017819
607 Ga0501080_0025463
608 Ga0501080_0056124
609 Ga0501081_0132096
610 Ga0501035_0200277
611 Ga0501044_0377559
612 Ga0501045_0008744
613 nmdc:mga05p37_77345_c1
614 nmdc:mga06r32_415254_c1
615 Ga0495601_0041360
616 Ga0495612_0065946
617 Ga0495612_0070451
618 Ga0495595_0120925
619 Ga0495619_0010604
620 Ga0501084_0028833
621 Ga0501084_0177529
622 Ga0530510_0049726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

25

147

0.98

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

163

321

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qvl-assembly1.cif.gz_A crystal structure of diacylglycerol kinase 0.8697 1 303
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8655 1 302
2qv7-assembly1.cif.gz_A crystal structure of diacylglycerol kinase dgkb in complex with adp and mg 0.8569 1 303
4wer-assembly1.cif.gz_A-2 crystal structure of diacylglycerol kinase catalytic domain protein from enterococcus faecalis v583 0.8544 6 303
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8508 4 303
ID Description Score Start End Superfamily
af_Q10SE4_189_349_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.915 141 295 2.60.200.40
af_P9WP29_144_297_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8847 139 296 2.60.200.40
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8836 6 117 3.40.50.10330
af_Q10SE4_189_349_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8773 141 295 2.60.200.40
af_P9WP29_144_297_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8741 139 296 2.60.200.40
ID Description Score Start End GO Terms
AF-A0A538MBE6-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9888 5 304 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A538MBE6-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9823 5 304 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A538G5W8-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9803 1 303 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A538G5W8-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.974 1 303 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A520PLY8-F1-model_v4 YegS/Rv2252/BmrU family lipid kinase 0.9614 6 302 GO:0005524
GO:0005886
GO:0008654
GO:0016301

Map