F401330

General Info

Members Datasets Scaffolds Average Seq Length
311 177 622 315

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0104465|Ga0451577_0104465_71_1129
Length 352
Sequence MDPFNVQRFSRENLMQSAKNISRRQWLKMGAAAGGAAAMGPLRSAWAQPAPRIERLDPALDRILSAAQPIQELGSGYGGPMGPAEGPLWWKEGGYLLFSDIHNDRRMKYTPGQGVTLFQQGVNRANGLTRDMKGRLVACEHDTRRVTRQELDGSITVVANNFQGKRLNRPNDVIVKSDGSMYFTDPNHNFVPEQWDIQHPGVYRVTPDLGTMTLLFDNFAGPNGLAFSPDEKILYVNDVRRRHIRAFDMAPNGMPVKESDRLFADLGGAEPGNPDGMKVDVEGNVYCGGSGGLWIMDAKGRKLGRIAHGQPATTNIGFGGDDWKTLFITTRTHLLAVNVNIPGMPVPTVVTK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 3.22
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0104465 3300042876 Bacteria 2532
2 Ga0058860_11870402 3300004801 Bacteria 1725
3 Ga0070690_100056461 3300005330 Bacteria 2518
4 Ga0070670_100009141 3300005331 Bacteria 8469
5 Ga0070677_10020460 3300005333 Bacteria 2411
6 Ga0070666_10269982 3300005335 Bacteria 1207
7 Ga0070680_100141174 3300005336 Bacteria 2020
8 Ga0070675_100156350 3300005354 Bacteria 1958
9 Ga0070675_100250761 3300005354 Bacteria 1549
10 Ga0070671_100039437 3300005355 Bacteria 3921
11 Ga0070671_100243910 3300005355 Bacteria 1525
12 Ga0070674_100015036 3300005356 Bacteria 4823
13 Ga0070673_100062642 3300005364 Bacteria 2956
14 Ga0070709_10067219 3300005434 Bacteria 2301
15 Ga0070714_100022041 3300005435 Bacteria 5220
16 Ga0070713_100005326 3300005436 Bacteria 8777
17 Ga0070713_100383993 3300005436 Bacteria 1309
18 Ga0070710_10004565 3300005437 Bacteria 6546
19 Ga0070710_10090660 3300005437 Bacteria 1802
20 Ga0070710_10336185 3300005437 Bacteria 996
21 Ga0070711_100002914 3300005439 Bacteria 9863
22 Ga0070708_100052015 3300005445 Bacteria 3631
23 Ga0070708_100056066 3300005445 Bacteria 3504
24 Ga0070678_100015868 3300005456 Bacteria 4799
25 Ga0070678_100034093 3300005456 Bacteria 3542
26 Ga0070681_10184050 3300005458 Bacteria 2010
27 Ga0070681_10232721 3300005458 Bacteria 1757
28 Ga0068867_100022728 3300005459 Bacteria 4485
29 Ga0070706_100004219 3300005467 Bacteria 13949
30 Ga0070706_100061611 3300005467 Bacteria 3464
31 Ga0070707_100016437 3300005468 Bacteria 6943
32 Ga0070707_100018131 3300005468 Bacteria 6623
33 Ga0070707_100130605 3300005468 Bacteria 2443
34 Ga0070707_100132214 3300005468 Bacteria 2427
35 Ga0070707_100293585 3300005468 Bacteria 1579
36 Ga0070698_100001975 3300005471 Bacteria 22794
37 Ga0070698_100051612 3300005471 Bacteria 4188
38 Ga0070698_100342057 3300005471 Bacteria 1427
39 Ga0070699_100007681 3300005518 Bacteria 9377
40 Ga0070699_100034479 3300005518 Bacteria 4374
41 Ga0070699_100112958 3300005518 Bacteria 2386
42 Ga0070699_100206133 3300005518 Bacteria 1749
43 Ga0070679_100106682 3300005530 Bacteria 2787
44 Ga0070697_100036194 3300005536 Bacteria 3986
45 Ga0070697_100121071 3300005536 Bacteria 2189
46 Ga0070696_100050949 3300005546 Bacteria 2879
47 Ga0070664_100133818 3300005564 Bacteria 2179
48 Ga0068857_100089526 3300005577 Bacteria 2754
49 Ga0068864_100319736 3300005618 Bacteria 1457
50 Ga0068864_100440330 3300005618 Bacteria 1245
51 Ga0068860_100508259 3300005843 Bacteria 1204
52 Ga0081455_10009455 3300005937 Bacteria 10028
53 Ga0081455_10018407 3300005937 Bacteria 6657
54 Ga0081538_10001310 3300005981 Bacteria 25709
55 Ga0081538_10020587 3300005981 Bacteria 4847
56 Ga0081538_10025924 3300005981 Bacteria 4118
57 Ga0081540_1004407 3300005983 Bacteria 10748
58 Ga0081540_1028260 3300005983 Bacteria 3154
59 Ga0081539_10034328 3300005985 Bacteria 3070
60 Ga0070717_10085565 3300006028 Bacteria 2653
61 Ga0070712_100074198 3300006175 Bacteria 2443
62 Ga0070712_100100355 3300006175 Unclassified 2139
63 Ga0070712_100115532 3300006175 Bacteria 2011
64 Ga0070712_100127317 3300006175 Bacteria 1926
65 Ga0097621_100062556 3300006237 Bacteria 3056
66 Ga0068871_100117466 3300006358 Bacteria 2243
67 Ga0075428_100012765 3300006844 Bacteria 9341
68 Ga0075428_100054156 3300006844 Bacteria 4396
69 Ga0075428_100158185 3300006844 Bacteria 2460
70 Ga0075428_100262507 3300006844 Bacteria 1859
71 Ga0075430_100036029 3300006846 Bacteria 4195
72 Ga0075430_100229456 3300006846 Bacteria 1540
73 Ga0075431_100000033 3300006847 Bacteria 72175
74 Ga0075431_100055394 3300006847 Bacteria 4090
75 Ga0075431_100185397 3300006847 Bacteria 2134
76 Ga0075431_100211118 3300006847 Bacteria 1983
77 Ga0075433_10067453 3300006852 Bacteria 3140
78 Ga0075433_10147001 3300006852 Bacteria 2095
79 Ga0075433_10171838 3300006852 Bacteria 1928
80 Ga0075433_10544384 3300006852 Bacteria 1021
81 Ga0075434_100026640 3300006871 Bacteria 5666
82 Ga0075434_100047127 3300006871 Bacteria 4278
83 Ga0075434_100307724 3300006871 Unclassified 1605
84 Ga0075429_100002956 3300006880 Bacteria 14420
85 Ga0075429_100066407 3300006880 Bacteria 3140
86 Ga0075429_100186358 3300006880 Bacteria 1818
87 Ga0068865_100061178 3300006881 Bacteria 2639
88 Ga0097620_100103436 3300006931 Bacteria 2906
89 Ga0075435_100042995 3300007076 Bacteria 3616
90 Ga0075435_100043695 3300007076 Bacteria 3588
91 Ga0075435_100147725 3300007076 Bacteria 1975
92 Ga0099794_10041290 3300007265 Bacteria 2196
93 Ga0099794_10041541 3300007265 Bacteria 2190
94 Ga0099795_10002777 3300007788 Bacteria 4209
95 Ga0099795_10055232 3300007788 Bacteria 1458
96 Ga0111539_10003638 3300009094 Bacteria 20303
97 Ga0111539_10032041 3300009094 Bacteria 6386
98 Ga0111539_10127979 3300009094 Bacteria 2974
99 Ga0111539_10220499 3300009094 Bacteria 2209
100 Ga0111539_10455378 3300009094 Bacteria 1490
101 Ga0114129_10000413 3300009147 Bacteria 50468
102 Ga0114129_10045876 3300009147 Bacteria 6142
103 Ga0114129_10118336 3300009147 Bacteria 3649
104 Ga0114129_10119240 3300009147 Bacteria 3634
105 Ga0114129_10149019 3300009147 Bacteria 3203
106 Ga0114129_10149896 3300009147 Bacteria 3192
107 Ga0114129_10162369 3300009147 Bacteria 3051
108 Ga0114129_10315010 3300009147 Bacteria 2082
109 Ga0114129_10726661 3300009147 Bacteria 1274
110 Ga0105243_10183671 3300009148 Bacteria 1821
111 Ga0105243_10184745 3300009148 Bacteria 1816
112 Ga0105242_10083309 3300009176 Bacteria 2678
113 Ga0105248_10088196 3300009177 Bacteria 3492
114 Ga0099796_10019881 3300010159 Unclassified 2043
115 Ga0099796_10027602 3300010159 Bacteria 1815
116 Ga0099796_10028644 3300010159 Bacteria 1790
117 Ga0099796_10057730 3300010159 Bacteria 1366
118 Ga0157374_10053467 3300013296 Bacteria 3765
119 Ga0157378_10028757 3300013297 Bacteria 4908
120 Ga0163162_10042277 3300013306 Bacteria 4560
121 Ga0157375_10229144 3300013308 Bacteria 2017
122 Ga0157377_10220479 3300014745 Bacteria 1214
123 Ga0157379_10031867 3300014968 Bacteria 4697
124 Ga0157379_10408157 3300014968 Bacteria 1249
125 Ga0157376_10026696 3300014969 Bacteria 4567
126 Ga0163161_10123442 3300017792 Bacteria 1948
127 Ga0213875_10001147 3300021388 Bacteria 18209
128 Ga0207682_10084117 3300025893 Bacteria 1369
129 Ga0207692_10207766 3300025898 Unclassified 1154
130 Ga0207642_10083757 3300025899 Bacteria 1556
131 Ga0207680_10011743 3300025903 Bacteria 4436
132 Ga0207699_10016506 3300025906 Bacteria 3865
133 Ga0207643_10027002 3300025908 Bacteria 3182
134 Ga0207684_10003299 3300025910 Bacteria 15836
135 Ga0207684_10023578 3300025910 Bacteria 5254
136 Ga0207684_10070745 3300025910 Bacteria 2965
137 Ga0207707_10016871 3300025912 Bacteria 6361
138 Ga0207693_10001412 3300025915 Bacteria 21305
139 Ga0207693_10028640 3300025915 Bacteria 4402
140 Ga0207693_10127143 3300025915 Bacteria 2003
141 Ga0207663_10074646 3300025916 Bacteria 2198
142 Ga0207663_10172086 3300025916 Bacteria 1539
143 Ga0207652_10104124 3300025921 Bacteria 2510
144 Ga0207646_10015468 3300025922 Bacteria 7206
145 Ga0207646_10055498 3300025922 Bacteria 3541
146 Ga0207650_10040755 3300025925 Bacteria 3400
147 Ga0207650_10126569 3300025925 Bacteria 1995
148 Ga0207659_10239185 3300025926 Bacteria 1468
149 Ga0207700_10027987 3300025928 Bacteria 3955
150 Ga0207700_10055192 3300025928 Bacteria 2986
151 Ga0207700_10125696 3300025928 Bacteria 2086
152 Ga0207664_10206523 3300025929 Bacteria 1698
153 Ga0207664_10456935 3300025929 Bacteria 1140
154 Ga0207644_10157577 3300025931 Bacteria 1762
155 Ga0207686_10016850 3300025934 Bacteria 4105
156 Ga0207665_10220553 3300025939 Bacteria 1390
157 Ga0207691_10218827 3300025940 Bacteria 1652
158 Ga0207711_10108212 3300025941 Bacteria 2469
159 Ga0207711_10112718 3300025941 Bacteria 2421
160 Ga0207689_10234082 3300025942 Bacteria 1518
161 Ga0207679_10179448 3300025945 Bacteria 1750
162 Ga0207651_10044432 3300025960 Bacteria 2973
163 Ga0207708_10095004 3300026075 Bacteria 2302
164 Ga0207641_10220481 3300026088 Bacteria 1759
165 Ga0207648_10033886 3300026089 Bacteria 4503
166 Ga0207674_10153447 3300026116 Bacteria 2259
167 Ga0207675_100021603 3300026118 Bacteria 5994
168 Ga0207683_10012758 3300026121 Bacteria 7171
169 Ga0207683_10049426 3300026121 Bacteria 3682
170 Ga0207428_10000036 3300027907 Bacteria 223539
171 Ga0207428_10008052 3300027907 Bacteria 9565
172 Ga0207428_10061120 3300027907 Bacteria 2984
173 Ga0268265_10344169 3300028380 Bacteria 1359
174 Ga0268265_10365267 3300028380 Bacteria 1323
175 Ga0268264_10403981 3300028381 Bacteria 1313
176 Ga0265338_10013007 3300028800 Bacteria 9439
177 Ga0373958_0032175 3300034819 Unclassified 1035
178 Ga0373940_0007791 3300035088 Bacteria 2431
179 Ga0373923_0003812 3300035111 Bacteria 4902
180 Ga0373954_0044097 3300035118 Bacteria 2081
181 Ga0373943_0087179 3300035170 Bacteria 1611
182 Ga0373955_0011276 3300035172 Bacteria 4253
183 Ga0373924_0011023 3300035410 Bacteria 3349
184 Ga0373931_0055030 3300035691 Bacteria 2128
185 Ga0373935_0053776 3300035692 Bacteria 2562
186 Ga0373935_0059208 3300035692 Bacteria 2448
187 Ga0373935_0085964 3300035692 Bacteria 2052
188 Ga0373935_0098251 3300035692 Bacteria 1927
189 Ga0373933_0022794 3300035724 Bacteria 3570
190 Ga0373933_0073629 3300035724 Bacteria 2081
191 Ga0373937_0000975 3300036401 Bacteria 24290
192 Ga0373937_0025780 3300036401 Bacteria 5309
193 Ga0373937_0031896 3300036401 Bacteria 4776
194 Ga0373937_0036511 3300036401 Bacteria 4478
195 Ga0373937_0065055 3300036401 Bacteria 3356
196 Ga0373937_0113313 3300036401 Bacteria 2523
197 Ga0373937_0225373 3300036401 Bacteria 1765
198 Ga0373937_0603929 3300036401 Bacteria 1041
199 Ga0373925_0015781 3300037068 Bacteria 5466
200 Ga0373925_0021356 3300037068 Bacteria 4716
201 Ga0373925_0140050 3300037068 Bacteria 1892
202 Ga0436364_0858825 3300037853 Bacteria 170378
203 Ga0436365_1742912 3300039437 Bacteria 2347
204 Ga0436360_0049453 3300039438 Bacteria 1298
205 Ga0436360_1171493 3300039438 Bacteria 1402
206 Ga0436361_0140944 3300039447 Unclassified 1676
207 Ga0436363_0113487 3300039450 Bacteria 1335
208 Ga0436363_0608301 3300039450 Bacteria 1187
209 Ga0436362_0071038 3300039453 Unclassified 1855
210 Ga0436362_0372473 3300039453 Unclassified 1540
211 Ga0436362_0594759 3300039453 Bacteria 1842
212 Ga0436362_0640153 3300039453 Unclassified 1337
213 Ga0495592_0031235 3300046454 Bacteria 4026
214 Ga0495592_0116325 3300046454 Bacteria 1887
215 Ga0495651_0002316 3300046462 Bacteria 14697
216 Ga0495651_0072670 3300046462 Bacteria 2612
217 Ga0495580_0038323 3300046472 Bacteria 3433
218 Ga0495664_0007349 3300046477 Bacteria 6117
219 Ga0495585_0051874 3300046492 Unclassified 2272
220 Ga0495608_0012809 3300046511 Bacteria 5820
221 Ga0495608_0149168 3300046511 Bacteria 1491
222 Ga0495618_0106792 3300046514 Bacteria 1793
223 Ga0495618_0109358 3300046514 Bacteria 1770
224 Ga0495640_0042538 3300046533 Bacteria 3168
225 Ga0495640_0063061 3300046533 Bacteria 2512
226 Ga0495586_0034756 3300046535 Bacteria 2708
227 Ga0495598_0033931 3300046537 Unclassified 1452
228 Ga0495645_0001747 3300046543 Bacteria 14772
229 Ga0495667_0023513 3300046559 Bacteria 4152
230 Ga0495667_0025732 3300046559 Bacteria 3964
231 Ga0495667_0079428 3300046559 Bacteria 2133
232 Ga0495656_0007108 3300046615 Bacteria 3949
233 Ga0495657_0051451 3300046675 Bacteria 2766
234 Ga0495599_0010299 3300046678 Bacteria 5720
235 Ga0495646_0028683 3300046680 Bacteria 3483
236 Ga0495658_0213764 3300046683 Bacteria 1206
237 Ga0495669_0085348 3300046684 Bacteria 1453
238 Ga0495604_0255815 3300047317 Bacteria 1192
239 Ga0495674_0010414 3300047319 Bacteria 8803
240 Ga0495674_0045592 3300047319 Bacteria 3893
241 Ga0495680_0049951 3300047322 Bacteria 3273
242 Ga0495680_0098921 3300047322 Bacteria 2176
243 Ga0495680_0340457 3300047322 Bacteria 1046
244 Ga0495602_0006050 3300048088 Bacteria 12695
245 Ga0496100_0327620 3300048903 Bacteria 1152
246 Ga0496104_0022768 3300048907 Bacteria 5755
247 Ga0496106_0324330 3300048909 Bacteria 1236
248 Ga0496107_0069591 3300048910 Bacteria 2555
249 Ga0496107_0217794 3300048910 Bacteria 1420
250 Ga0496109_0201492 3300048912 Bacteria 1871
251 Ga0496109_0456477 3300048912 Bacteria 1207
252 Ga0496112_0293640 3300048915 Bacteria 1571
253 Ga0496114_0147101 3300048917 Bacteria 2043
254 Ga0496114_0168276 3300048917 Bacteria 1909
255 Ga0501033_0037018 3300049570 Bacteria 3654
256 Ga0501041_0242337 3300049577 Bacteria 1133
257 Ga0501043_0097379 3300049579 Bacteria 2313
258 Ga0501047_0049231 3300049581 Bacteria 4069
259 Ga0501070_0047575 3300049586 Bacteria 3564
260 Ga0501072_0209213 3300049588 Bacteria 1555
261 Ga0501072_0370186 3300049588 Bacteria 1137
262 Ga0501073_0038802 3300049589 Bacteria 3377
263 Ga0501074_0150221 3300049590 Bacteria 1666
264 Ga0501075_0073975 3300049591 Bacteria 2577
265 Ga0501076_0053152 3300049592 Bacteria 3209
266 Ga0501077_0002579 3300049593 Bacteria 10867
267 Ga0501080_0045179 3300049742 Bacteria 4100
268 Ga0501081_0008658 3300049743 Bacteria 6610
269 Ga0501044_0076133 3300049823 Bacteria 3407
270 Ga0501045_0258183 3300049824 Bacteria 1297
271 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
272 nmdc:mga05p37_16149_c1 3300050507 Bacteria 8990
273 nmdc:mga05p37_21456_c1 3300050507 Bacteria 7823
274 nmdc:mga05p37_230719_c1 3300050507 Bacteria 2231
275 nmdc:mga05p37_38619_c1 3300050507 Bacteria 5857
276 nmdc:mga05p37_49823_c1 3300050507 Bacteria 5151
277 nmdc:mga05p37_49988_c1 3300050507 Bacteria 5142
278 nmdc:mga09592_288219_c1 3300050508 Bacteria 1424
279 nmdc:mga09592_331421_c1 3300050508 Unclassified 1318
280 nmdc:mga09592_346_c1 3300050508 Bacteria 33997
281 nmdc:mga09592_406274_c1 3300050508 Bacteria 1177
282 nmdc:mga09592_49691_c1 3300050508 Bacteria 3536
283 nmdc:mga09592_74211_c1 3300050508 Bacteria 2891
284 nmdc:mga0qj67_533645_c1 3300050509 Bacteria 942
285 nmdc:mga06r32_11266_c1 3300050510 Bacteria 8054
286 nmdc:mga06r32_178224_c1 3300050510 Bacteria 2110
287 nmdc:mga06r32_317_c1 3300050510 Bacteria 40324
288 nmdc:mga08y16_113405_c1 3300050511 Bacteria 2822
289 nmdc:mga08y16_11744_c1 3300050511 Bacteria 9202
290 nmdc:mga08y16_239824_c1 3300050511 Unclassified 1874
291 nmdc:mga08y16_6517_c1 3300050511 Bacteria 12243
292 nmdc:mga08y16_79733_c1 3300050511 Bacteria 3413
293 nmdc:mga0n895_125472_c1 3300050512 Bacteria 2590
294 nmdc:mga0n895_217806_c1 3300050512 Bacteria 1938
295 nmdc:mga0n895_489230_c1 3300050512 Bacteria 1240
296 nmdc:mga0rr50_33580_c2 3300050513 Bacteria 1757
297 nmdc:mga0rr50_36700_c1 3300050513 Bacteria 3532
298 nmdc:mga0rr50_59993_c1 3300050513 Bacteria 2859
299 nmdc:mga0a205_13596_c1 3300050515 Bacteria 7583
300 nmdc:mga0a205_205736_c1 3300050515 Bacteria 1857
301 Ga0495601_0000903 3300053077 Bacteria 16187
302 Ga0495601_0026280 3300053077 Bacteria 3593
303 Ga0495595_0024502 3300053084 Bacteria 2666
304 Ga0495595_0038600 3300053084 Bacteria 2176
305 Ga0495619_0013598 3300053085 Bacteria 5128
306 Ga0495619_0032081 3300053085 Bacteria 3406
307 Ga0500642_0106764 3300053130 Bacteria 1306
308 Ga0501084_0110605 3300054114 Bacteria 2308
309 Ga0587071_017049 3300060344 Unclassified 1291
310 Ga0501082_0023254 3300060353 Bacteria 5347
311 Ga0530510_0028766 3300061734 Bacteria 3984
312 Ga0451577_0104465
313 Ga0058860_11870402
314 Ga0070690_100056461
315 Ga0070670_100009141
316 Ga0070677_10020460
317 Ga0070666_10269982
318 Ga0070680_100141174
319 Ga0070675_100156350
320 Ga0070675_100250761
321 Ga0070671_100039437
322 Ga0070671_100243910
323 Ga0070674_100015036
324 Ga0070673_100062642
325 Ga0070709_10067219
326 Ga0070714_100022041
327 Ga0070713_100005326
328 Ga0070713_100383993
329 Ga0070710_10004565
330 Ga0070710_10090660
331 Ga0070710_10336185
332 Ga0070711_100002914
333 Ga0070708_100052015
334 Ga0070708_100056066
335 Ga0070678_100015868
336 Ga0070678_100034093
337 Ga0070681_10184050
338 Ga0070681_10232721
339 Ga0068867_100022728
340 Ga0070706_100004219
341 Ga0070706_100061611
342 Ga0070707_100016437
343 Ga0070707_100018131
344 Ga0070707_100130605
345 Ga0070707_100132214
346 Ga0070707_100293585
347 Ga0070698_100001975
348 Ga0070698_100051612
349 Ga0070698_100342057
350 Ga0070699_100007681
351 Ga0070699_100034479
352 Ga0070699_100112958
353 Ga0070699_100206133
354 Ga0070679_100106682
355 Ga0070697_100036194
356 Ga0070697_100121071
357 Ga0070696_100050949
358 Ga0070664_100133818
359 Ga0068857_100089526
360 Ga0068864_100319736
361 Ga0068864_100440330
362 Ga0068860_100508259
363 Ga0081455_10009455
364 Ga0081455_10018407
365 Ga0081538_10001310
366 Ga0081538_10020587
367 Ga0081538_10025924
368 Ga0081540_1004407
369 Ga0081540_1028260
370 Ga0081539_10034328
371 Ga0070717_10085565
372 Ga0070712_100074198
373 Ga0070712_100100355
374 Ga0070712_100115532
375 Ga0070712_100127317
376 Ga0097621_100062556
377 Ga0068871_100117466
378 Ga0075428_100012765
379 Ga0075428_100054156
380 Ga0075428_100158185
381 Ga0075428_100262507
382 Ga0075430_100036029
383 Ga0075430_100229456
384 Ga0075431_100000033
385 Ga0075431_100055394
386 Ga0075431_100185397
387 Ga0075431_100211118
388 Ga0075433_10067453
389 Ga0075433_10147001
390 Ga0075433_10171838
391 Ga0075433_10544384
392 Ga0075434_100026640
393 Ga0075434_100047127
394 Ga0075434_100307724
395 Ga0075429_100002956
396 Ga0075429_100066407
397 Ga0075429_100186358
398 Ga0068865_100061178
399 Ga0097620_100103436
400 Ga0075435_100042995
401 Ga0075435_100043695
402 Ga0075435_100147725
403 Ga0099794_10041290
404 Ga0099794_10041541
405 Ga0099795_10002777
406 Ga0099795_10055232
407 Ga0111539_10003638
408 Ga0111539_10032041
409 Ga0111539_10127979
410 Ga0111539_10220499
411 Ga0111539_10455378
412 Ga0114129_10000413
413 Ga0114129_10045876
414 Ga0114129_10118336
415 Ga0114129_10119240
416 Ga0114129_10149019
417 Ga0114129_10149896
418 Ga0114129_10162369
419 Ga0114129_10315010
420 Ga0114129_10726661
421 Ga0105243_10183671
422 Ga0105243_10184745
423 Ga0105242_10083309
424 Ga0105248_10088196
425 Ga0099796_10019881
426 Ga0099796_10027602
427 Ga0099796_10028644
428 Ga0099796_10057730
429 Ga0157374_10053467
430 Ga0157378_10028757
431 Ga0163162_10042277
432 Ga0157375_10229144
433 Ga0157377_10220479
434 Ga0157379_10031867
435 Ga0157379_10408157
436 Ga0157376_10026696
437 Ga0163161_10123442
438 Ga0213875_10001147
439 Ga0207682_10084117
440 Ga0207692_10207766
441 Ga0207642_10083757
442 Ga0207680_10011743
443 Ga0207699_10016506
444 Ga0207643_10027002
445 Ga0207684_10003299
446 Ga0207684_10023578
447 Ga0207684_10070745
448 Ga0207707_10016871
449 Ga0207693_10001412
450 Ga0207693_10028640
451 Ga0207693_10127143
452 Ga0207663_10074646
453 Ga0207663_10172086
454 Ga0207652_10104124
455 Ga0207646_10015468
456 Ga0207646_10055498
457 Ga0207650_10040755
458 Ga0207650_10126569
459 Ga0207659_10239185
460 Ga0207700_10027987
461 Ga0207700_10055192
462 Ga0207700_10125696
463 Ga0207664_10206523
464 Ga0207664_10456935
465 Ga0207644_10157577
466 Ga0207686_10016850
467 Ga0207665_10220553
468 Ga0207691_10218827
469 Ga0207711_10108212
470 Ga0207711_10112718
471 Ga0207689_10234082
472 Ga0207679_10179448
473 Ga0207651_10044432
474 Ga0207708_10095004
475 Ga0207641_10220481
476 Ga0207648_10033886
477 Ga0207674_10153447
478 Ga0207675_100021603
479 Ga0207683_10012758
480 Ga0207683_10049426
481 Ga0207428_10000036
482 Ga0207428_10008052
483 Ga0207428_10061120
484 Ga0268265_10344169
485 Ga0268265_10365267
486 Ga0268264_10403981
487 Ga0265338_10013007
488 Ga0373958_0032175
489 Ga0373940_0007791
490 Ga0373923_0003812
491 Ga0373954_0044097
492 Ga0373943_0087179
493 Ga0373955_0011276
494 Ga0373924_0011023
495 Ga0373931_0055030
496 Ga0373935_0053776
497 Ga0373935_0059208
498 Ga0373935_0085964
499 Ga0373935_0098251
500 Ga0373933_0022794
501 Ga0373933_0073629
502 Ga0373937_0000975
503 Ga0373937_0025780
504 Ga0373937_0031896
505 Ga0373937_0036511
506 Ga0373937_0065055
507 Ga0373937_0113313
508 Ga0373937_0225373
509 Ga0373937_0603929
510 Ga0373925_0015781
511 Ga0373925_0021356
512 Ga0373925_0140050
513 Ga0436364_0858825
514 Ga0436365_1742912
515 Ga0436360_0049453
516 Ga0436360_1171493
517 Ga0436361_0140944
518 Ga0436363_0113487
519 Ga0436363_0608301
520 Ga0436362_0071038
521 Ga0436362_0372473
522 Ga0436362_0594759
523 Ga0436362_0640153
524 Ga0495592_0031235
525 Ga0495592_0116325
526 Ga0495651_0002316
527 Ga0495651_0072670
528 Ga0495580_0038323
529 Ga0495664_0007349
530 Ga0495585_0051874
531 Ga0495608_0012809
532 Ga0495608_0149168
533 Ga0495618_0106792
534 Ga0495618_0109358
535 Ga0495640_0042538
536 Ga0495640_0063061
537 Ga0495586_0034756
538 Ga0495598_0033931
539 Ga0495645_0001747
540 Ga0495667_0023513
541 Ga0495667_0025732
542 Ga0495667_0079428
543 Ga0495656_0007108
544 Ga0495657_0051451
545 Ga0495599_0010299
546 Ga0495646_0028683
547 Ga0495658_0213764
548 Ga0495669_0085348
549 Ga0495604_0255815
550 Ga0495674_0010414
551 Ga0495674_0045592
552 Ga0495680_0049951
553 Ga0495680_0098921
554 Ga0495680_0340457
555 Ga0495602_0006050
556 Ga0496100_0327620
557 Ga0496104_0022768
558 Ga0496106_0324330
559 Ga0496107_0069591
560 Ga0496107_0217794
561 Ga0496109_0201492
562 Ga0496109_0456477
563 Ga0496112_0293640
564 Ga0496114_0147101
565 Ga0496114_0168276
566 Ga0501033_0037018
567 Ga0501041_0242337
568 Ga0501043_0097379
569 Ga0501047_0049231
570 Ga0501070_0047575
571 Ga0501072_0209213
572 Ga0501072_0370186
573 Ga0501073_0038802
574 Ga0501074_0150221
575 Ga0501075_0073975
576 Ga0501076_0053152
577 Ga0501077_0002579
578 Ga0501080_0045179
579 Ga0501081_0008658
580 Ga0501044_0076133
581 Ga0501045_0258183
582 nmdc:mga05p37_14_c1
583 nmdc:mga05p37_16149_c1
584 nmdc:mga05p37_21456_c1
585 nmdc:mga05p37_230719_c1
586 nmdc:mga05p37_38619_c1
587 nmdc:mga05p37_49823_c1
588 nmdc:mga05p37_49988_c1
589 nmdc:mga09592_288219_c1
590 nmdc:mga09592_331421_c1
591 nmdc:mga09592_346_c1
592 nmdc:mga09592_406274_c1
593 nmdc:mga09592_49691_c1
594 nmdc:mga09592_74211_c1
595 nmdc:mga0qj67_533645_c1
596 nmdc:mga06r32_11266_c1
597 nmdc:mga06r32_178224_c1
598 nmdc:mga06r32_317_c1
599 nmdc:mga08y16_113405_c1
600 nmdc:mga08y16_11744_c1
601 nmdc:mga08y16_239824_c1
602 nmdc:mga08y16_6517_c1
603 nmdc:mga08y16_79733_c1
604 nmdc:mga0n895_125472_c1
605 nmdc:mga0n895_217806_c1
606 nmdc:mga0n895_489230_c1
607 nmdc:mga0rr50_33580_c2
608 nmdc:mga0rr50_36700_c1
609 nmdc:mga0rr50_59993_c1
610 nmdc:mga0a205_13596_c1
611 nmdc:mga0a205_205736_c1
612 Ga0495601_0000903
613 Ga0495601_0026280
614 Ga0495595_0024502
615 Ga0495595_0038600
616 Ga0495619_0013598
617 Ga0495619_0032081
618 Ga0500642_0106764
619 Ga0501084_0110605
620 Ga0587071_017049
621 Ga0501082_0023254
622 Ga0530510_0028766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

83

332

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9193 1 291
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9128 3 294
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9093 1 291
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8977 3 294
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8747 1 291
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.914 3 294 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9093 1 291 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8987 3 294 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8627 1 291 2.120.10.30
af_A0A2R8Q900_1_232_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8407 31 269 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V6WVW6-F1-model_v4 Gluconolactonase 0.9957 161 298 GO:0016787
GO:0046872
AF-A0A537PQD8-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9951 2 271 GO:0016787
GO:0046872
AF-A0A5N9GC87-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9942 38 302 GO:0016787
GO:0046872
AF-A0A5N9GC87-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9905 38 302 GO:0016787
GO:0046872
AF-A0A1F2U057-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9893 2 302 GO:0016787
GO:0046872

Map