F401271

General Info

Members Datasets Scaffolds Average Seq Length
311 158 622 77

Family's Representative Sequence

Representative Sequence 3300031242|Ga0265329_10197792|Ga0265329_101977922
Length 88
Sequence MLLCYPLRRCDITTLNKRTTIYLDPELHKALRLKAAANSKSVTELINDAVRESLAEDAEDMEAFTVREKEPLISYDEMVRRLKKDGLL

Samples

Sample ID Description Type Environment
1 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
87 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 0
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 30.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265329_10197792 3300031242 Unclassified 661
2 Ga0065707_10170890 3300005295 Unclassified 1481
3 Ga0070683_100143784 3300005329 Bacteria 2260
4 Ga0070683_101894657 3300005329 Unclassified 573
5 Ga0070680_100953187 3300005336 Unclassified 741
6 Ga0070661_100372007 3300005344 Bacteria 1125
7 Ga0070692_10001809 3300005345 Bacteria 7995
8 Ga0070659_100191824 3300005366 Bacteria 1680
9 Ga0070694_100000098 3300005444 Bacteria 42100
10 Ga0070694_100030188 3300005444 Bacteria 3544
11 Ga0070694_100596062 3300005444 Unclassified 889
12 Ga0070694_100691300 3300005444 Bacteria 829
13 Ga0070708_100288470 3300005445 Bacteria 1545
14 Ga0070708_100914007 3300005445 Bacteria 824
15 Ga0070707_100274119 3300005468 Bacteria 1640
16 Ga0070698_100190271 3300005471 Unclassified 1990
17 Ga0070698_100252503 3300005471 Unclassified 1696
18 Ga0070698_100707532 3300005471 Unclassified 950
19 Ga0070699_101485445 3300005518 Unclassified 621
20 Ga0070699_102039063 3300005518 Unclassified 524
21 Ga0070699_102130171 3300005518 Unclassified 512
22 Ga0070679_100822395 3300005530 Bacteria 872
23 Ga0070684_100496063 3300005535 Unclassified 1131
24 Ga0070697_100017036 3300005536 Bacteria 5714
25 Ga0070697_100050166 3300005536 Bacteria 3387
26 Ga0070697_100411772 3300005536 Bacteria 1174
27 Ga0070697_101705986 3300005536 Bacteria 563
28 Ga0068853_100065750 3300005539 Bacteria 3147
29 Ga0070686_100384383 3300005544 Unclassified 1063
30 Ga0070695_100288911 3300005545 Unclassified 1208
31 Ga0070695_100583146 3300005545 Unclassified 876
32 Ga0070696_100899802 3300005546 Unclassified 734
33 Ga0070696_101950489 3300005546 Unclassified 509
34 Ga0070665_100033312 3300005548 Bacteria 5185
35 Ga0070704_100014232 3300005549 Bacteria 4965
36 Ga0070704_100052402 3300005549 Bacteria 2878
37 Ga0070704_100065859 3300005549 Unclassified 2610
38 Ga0070704_100248234 3300005549 Bacteria 1460
39 Ga0068855_100008653 3300005563 Bacteria 12297
40 Ga0068857_100277441 3300005577 Bacteria 1541
41 Ga0068864_101816876 3300005618 Unclassified 615
42 Ga0068860_100867289 3300005843 Archaea 918
43 Ga0075432_10299498 3300006058 Unclassified 667
44 Ga0075428_100318548 3300006844 Bacteria 1671
45 Ga0075428_100348099 3300006844 Bacteria 1591
46 Ga0075428_100455729 3300006844 Bacteria 1370
47 Ga0075430_101228687 3300006846 Unclassified 617
48 Ga0075431_100004954 3300006847 Bacteria 13108
49 Ga0075431_100013151 3300006847 Bacteria 8360
50 Ga0075431_100187493 3300006847 Bacteria 2120
51 Ga0075431_100509603 3300006847 Bacteria 1193
52 Ga0075431_102148745 3300006847 Bacteria 513
53 Ga0075433_10066375 3300006852 Bacteria 3166
54 Ga0075433_10254699 3300006852 Bacteria 1557
55 Ga0075434_100134070 3300006871 Bacteria 2496
56 Ga0075434_101380677 3300006871 Bacteria 715
57 Ga0075434_101791120 3300006871 Unclassified 621
58 Ga0075429_100202263 3300006880 Bacteria 1740
59 Ga0075429_100370105 3300006880 Bacteria 1254
60 Ga0075429_101760099 3300006880 Unclassified 538
61 Ga0075436_100557480 3300006914 Bacteria 842
62 Ga0075436_101510663 3300006914 Bacteria 510
63 Ga0075435_100434478 3300007076 Bacteria 1131
64 Ga0075435_101381595 3300007076 Unclassified 617
65 Ga0105240_10017675 3300009093 Bacteria 9602
66 Ga0111539_10206469 3300009094 Bacteria 2290
67 Ga0114129_10105190 3300009147 Bacteria 3901
68 Ga0114129_10408021 3300009147 Bacteria 1790
69 Ga0114129_11108944 3300009147 Bacteria 990
70 Ga0114129_12708789 3300009147 Unclassified 591
71 Ga0105238_10026484 3300009551 Bacteria 5913
72 Ga0105249_10998786 3300009553 Unclassified 906
73 Ga0105239_11084574 3300010375 Unclassified 921
74 Ga0157370_10828472 3300013104 Unclassified 841
75 Ga0157370_11401440 3300013104 Unclassified 629
76 Ga0157369_10009484 3300013105 Bacteria 11129
77 Ga0157372_10001999 3300013307 Bacteria 22142
78 Ga0157372_12196846 3300013307 Unclassified 634
79 Ga0157375_10663302 3300013308 Unclassified 1199
80 Ga0207695_11385116 3300025913 Bacteria 584
81 Ga0207660_10368005 3300025917 Unclassified 1154
82 Ga0207657_10203013 3300025919 Bacteria 1594
83 Ga0207649_10284363 3300025920 Bacteria 1204
84 Ga0207652_10653757 3300025921 Bacteria 940
85 Ga0207646_10415363 3300025922 Bacteria 1215
86 Ga0207694_10025368 3300025924 Bacteria 4506
87 Ga0207690_10136466 3300025932 Bacteria 1802
88 Ga0207661_11601962 3300025944 Unclassified 596
89 Ga0207661_11795592 3300025944 Unclassified 559
90 Ga0207674_10113146 3300026116 Bacteria 2687
91 Ga0268266_10197811 3300028379 Bacteria 1838
92 Ga0268264_10292243 3300028381 Bacteria 1531
93 Ga0265323_10047141 3300028653 Bacteria 1542
94 Ga0265322_10002945 3300028654 Bacteria 5188
95 Ga0265322_10244405 3300028654 Bacteria 515
96 Ga0265330_10052792 3300031235 Bacteria 1780
97 Ga0265330_10266280 3300031235 Bacteria 722
98 Ga0265340_10377999 3300031247 Bacteria 625
99 Ga0265339_10430717 3300031249 Bacteria 614
100 Ga0265316_10011999 3300031344 Bacteria 7788
101 Ga0265316_10020851 3300031344 Bacteria 5566
102 Ga0307408_101056173 3300031548 Bacteria 751
103 Ga0307408_101162207 3300031548 Unclassified 718
104 Ga0316575_10000568 3300031665 Bacteria 10832
105 Ga0316575_10289701 3300031665 Bacteria 691
106 Ga0316579_10074257 3300031691 Bacteria 1614
107 Ga0316579_10099081 3300031691 Bacteria 1395
108 Ga0316579_10461490 3300031691 Unclassified 614
109 Ga0265342_10057716 3300031712 Bacteria 2296
110 Ga0316576_10016077 3300031727 Bacteria 5044
111 Ga0316576_10029356 3300031727 Unclassified 3887
112 Ga0316576_10074606 3300031727 Bacteria 2508
113 Ga0316576_10655664 3300031727 Bacteria 763
114 Ga0316576_11210220 3300031727 Unclassified 533
115 Ga0316578_10035787 3300031728 Unclassified 2855
116 Ga0316578_10078030 3300031728 Bacteria 1967
117 Ga0316578_10137907 3300031728 Bacteria 1469
118 Ga0316578_10183387 3300031728 Unclassified 1261
119 Ga0316578_10226095 3300031728 Unclassified 1124
120 Ga0316578_10831083 3300031728 Unclassified 535
121 Ga0316577_10014405 3300031733 Bacteria 4339
122 Ga0316577_10028606 3300031733 Bacteria 3110
123 Ga0316577_10167988 3300031733 Bacteria 1238
124 Ga0316577_10315118 3300031733 Unclassified 887
125 Ga0316577_10645667 3300031733 Unclassified 602
126 Ga0316577_10897074 3300031733 Bacteria 502
127 Ga0316583_10004803 3300032133 Bacteria 4827
128 Ga0316583_10006684 3300032133 Bacteria 4155
129 Ga0316583_10024066 3300032133 Unclassified 2174
130 Ga0316585_10019958 3300032137 Unclassified 2047
131 Ga0316585_10022123 3300032137 Bacteria 1955
132 Ga0316585_10024596 3300032137 Unclassified 1864
133 Ga0316592_1019717 3300033524 Bacteria 1428
134 Ga0316588_1018604 3300033528 Bacteria 1557
135 Ga0316596_1037069 3300033541 Unclassified 1275
136 Ga0373926_0036281 3300035083 Bacteria 1751
137 Ga0373943_0068882 3300035170 Bacteria 1787
138 Ga0316574_0002517 3300035398 Bacteria 9209
139 Ga0316574_0039529 3300035398 Unclassified 2901
140 Ga0316574_0072718 3300035398 Bacteria 2173
141 Ga0316574_0096550 3300035398 Bacteria 1888
142 Ga0316574_0235426 3300035398 Unclassified 1171
143 Ga0316574_0831234 3300035398 Unclassified 561
144 Ga0373935_0576400 3300035692 Bacteria 822
145 Ga0373927_0811284 3300035695 Unclassified 618
146 Ga0373947_0287362 3300035725 Bacteria 1094
147 Ga0373947_0555071 3300035725 Unclassified 782
148 Ga0373947_0798607 3300035725 Bacteria 644
149 Ga0373937_0147122 3300036401 Bacteria 2206
150 Ga0316582_0026452 3300036647 Unclassified 3493
151 Ga0316582_0043332 3300036647 Bacteria 2822
152 Ga0316582_0081422 3300036647 Bacteria 2115
153 Ga0316582_0111748 3300036647 Unclassified 1819
154 Ga0316582_0121374 3300036647 Unclassified 1749
155 Ga0316584_0023949 3300036712 Bacteria 4463
156 Ga0316584_0025852 3300036712 Bacteria 4308
157 Ga0316584_0049925 3300036712 Bacteria 3127
158 Ga0316584_0056745 3300036712 Bacteria 2931
159 Ga0316584_0326298 3300036712 Unclassified 1106
160 Ga0316584_0619023 3300036712 Bacteria 749
161 Ga0316584_1094221 3300036712 Bacteria 529
162 Ga0373925_0054750 3300037068 Bacteria 2984
163 Ga0373925_0089378 3300037068 Bacteria 2353
164 Ga0316581_0079851 3300037588 Unclassified 1006
165 Ga0400486_22449 3300038742 Unclassified 2821
166 Ga0400489_79430 3300039093 Bacteria 2493
167 Ga0439439_0038837 3300041406 Unclassified 1229
168 Ga0451577_0000147 3300042876 Bacteria 155979
169 Ga0451577_0279173 3300042876 Bacteria 1513
170 Ga0451577_0441752 3300042876 Bacteria 1181
171 Ga0453683_0000569 3300044673 Bacteria 40862
172 Ga0453683_0057683 3300044673 Unclassified 2429
173 Ga0453683_0475586 3300044673 Unclassified 810
174 Ga0453683_0892582 3300044673 Unclassified 587
175 Ga0453684_0000490 3300044712 Bacteria 155979
176 Ga0453684_0016373 3300044712 Bacteria 11602
177 Ga0453684_0073740 3300044712 Bacteria 4301
178 Ga0453684_0080778 3300044712 Bacteria 4058
179 Ga0453684_0442165 3300044712 Bacteria 1449
180 Ga0453684_0564069 3300044712 Unclassified 1252
181 Ga0453684_1328447 3300044712 Unclassified 749
182 Ga0451576_0424126 3300045051 Bacteria 1396
183 Ga0451576_0486967 3300045051 Unclassified 1296
184 Ga0451576_0495765 3300045051 Bacteria 1283
185 Ga0451576_2594905 3300045051 Bacteria 517
186 Ga0495603_0062856 3300046455 Bacteria 2191
187 Ga0495629_0000010 3300046459 Bacteria 340114
188 Ga0495629_0000315 3300046459 Bacteria 41389
189 Ga0495629_0411973 3300046459 Unclassified 918
190 Ga0495641_0098857 3300046461 Bacteria 1302
191 Ga0495641_0206144 3300046461 Bacteria 881
192 Ga0495641_0521321 3300046461 Unclassified 542
193 Ga0495580_0019896 3300046472 Bacteria 4979
194 Ga0495580_0174700 3300046472 Bacteria 1484
195 Ga0495580_0233610 3300046472 Unclassified 1262
196 Ga0495580_0985840 3300046472 Unclassified 538
197 Ga0495582_0059385 3300046473 Bacteria 2110
198 Ga0495582_0140285 3300046473 Bacteria 1369
199 Ga0495582_0822326 3300046473 Unclassified 537
200 Ga0495639_0002775 3300046475 Bacteria 7614
201 Ga0495639_0003006 3300046475 Bacteria 7342
202 Ga0495639_0025034 3300046475 Bacteria 2630
203 Ga0495639_0245403 3300046475 Unclassified 884
204 Ga0495662_0024268 3300046476 Bacteria 2926
205 Ga0495662_0118239 3300046476 Bacteria 1300
206 Ga0495664_0541525 3300046477 Unclassified 694
207 Ga0495594_0007784 3300046499 Bacteria 5511
208 Ga0495618_0022889 3300046514 Bacteria 3860
209 Ga0495628_0623508 3300046516 Bacteria 768
210 Ga0495630_0027383 3300046517 Bacteria 4228
211 Ga0495666_0037675 3300046526 Bacteria 2352
212 Ga0495666_0067235 3300046526 Bacteria 1707
213 Ga0495666_0184460 3300046526 Unclassified 963
214 Ga0495666_0232525 3300046526 Bacteria 842
215 Ga0495665_0018913 3300046531 Bacteria 3702
216 Ga0495665_0109884 3300046531 Unclassified 1446
217 Ga0495640_0013382 3300046533 Bacteria 6233
218 Ga0495586_0002987 3300046535 Bacteria 9120
219 Ga0495586_0004041 3300046535 Bacteria 7866
220 Ga0495586_0008275 3300046535 Bacteria 5539
221 Ga0495586_0108226 3300046535 Bacteria 1546
222 Ga0495586_0108835 3300046535 Archaea 1541
223 Ga0495598_0404870 3300046537 Unclassified 534
224 Ga0495621_0302908 3300046539 Bacteria 663
225 Ga0495622_0020623 3300046557 Bacteria 3069
226 Ga0495622_0387262 3300046557 Unclassified 603
227 Ga0495667_0434103 3300046559 Bacteria 826
228 Ga0495634_0008465 3300046642 Bacteria 7654
229 Ga0495634_0190826 3300046642 Bacteria 1278
230 Ga0495635_0011042 3300046663 Bacteria 6333
231 Ga0495647_0041438 3300046681 Bacteria 1753
232 Ga0495647_0072286 3300046681 Bacteria 1383
233 Ga0495647_0422576 3300046681 Unclassified 614
234 Ga0495658_0000708 3300046683 Bacteria 18050
235 Ga0495658_0053520 3300046683 Bacteria 2293
236 Ga0495613_0005467 3300046689 Bacteria 9542
237 Ga0495613_0362245 3300046689 Unclassified 994
238 Ga0495613_0379941 3300046689 Bacteria 966
239 Ga0495613_0663690 3300046689 Unclassified 689
240 Ga0495624_0348810 3300046690 Bacteria 890
241 Ga0495600_0707389 3300046809 Bacteria 606
242 Ga0495581_0000556 3300047315 Bacteria 19333
243 Ga0495581_0044962 3300047315 Unclassified 2553
244 Ga0495581_0221429 3300047315 Bacteria 1106
245 Ga0495674_0031523 3300047319 Bacteria 4816
246 Ga0495676_0023266 3300047321 Bacteria 5381
247 Ga0495676_0201563 3300047321 Bacteria 1382
248 Ga0495676_0239933 3300047321 Bacteria 1241
249 Ga0495676_0559029 3300047321 Bacteria 747
250 Ga0495680_0005933 3300047322 Bacteria 11416
251 Ga0495680_0044288 3300047322 Bacteria 3519
252 Ga0495680_0070780 3300047322 Unclassified 2658
253 Ga0495680_0564397 3300047322 Bacteria 765
254 Ga0495684_0041786 3300047471 Bacteria 3513
255 Ga0495593_0649275 3300047673 Unclassified 530
256 Ga0495614_0002981 3300048089 Bacteria 7543
257 Ga0495614_0303543 3300048089 Unclassified 738
258 Ga0501033_0130206 3300049570 Bacteria 1823
259 Ga0501036_0018184 3300049572 Bacteria 5886
260 Ga0501037_0764798 3300049573 Unclassified 639
261 Ga0501038_0009683 3300049574 Bacteria 8838
262 Ga0501040_0004372 3300049576 Bacteria 9184
263 Ga0501040_1052561 3300049576 Unclassified 590
264 Ga0501042_0084098 3300049578 Unclassified 2281
265 Ga0501043_0527213 3300049579 Unclassified 880
266 Ga0501048_0053228 3300049582 Bacteria 2880
267 Ga0501068_0052062 3300049584 Bacteria 2478
268 Ga0501071_0081854 3300049587 Bacteria 2363
269 Ga0501073_0338956 3300049589 Bacteria 1038
270 Ga0501074_0032462 3300049590 Bacteria 3783
271 Ga0501075_0003541 3300049591 Bacteria 10449
272 Ga0501075_0094458 3300049591 Bacteria 2270
273 Ga0501075_0127100 3300049591 Unclassified 1941
274 Ga0501075_0277607 3300049591 Unclassified 1277
275 Ga0501075_0617670 3300049591 Unclassified 827
276 Ga0501076_0000714 3300049592 Bacteria 21429
277 Ga0501076_0208795 3300049592 Bacteria 1595
278 Ga0501077_0140084 3300049593 Bacteria 1534
279 Ga0501235_094781 3300049669 Bacteria 724
280 Ga0501079_0594861 3300049741 Unclassified 870
281 Ga0501079_0948913 3300049741 Bacteria 677
282 Ga0501080_0063949 3300049742 Bacteria 3424
283 Ga0501081_0000733 3300049743 Bacteria 19116
284 Ga0501081_0232803 3300049743 Bacteria 1342
285 Ga0501081_0495231 3300049743 Bacteria 910
286 Ga0501081_0532885 3300049743 Bacteria 876
287 Ga0501045_0005082 3300049824 Bacteria 9105
288 Ga0501045_0458685 3300049824 Bacteria 947
289 nmdc:mga05p37_198722_c1 3300050507 Bacteria 2430
290 nmdc:mga05p37_87248_c1 3300050507 Bacteria 3846
291 nmdc:mga09592_1554135_c1 3300050508 Unclassified 537
292 nmdc:mga09592_320494_c1 3300050508 Bacteria 1343
293 nmdc:mga06r32_245163_c1 3300050510 Unclassified 1779
294 nmdc:mga06r32_368448_c1 3300050510 Bacteria 1420
295 nmdc:mga06r32_377119_c1 3300050510 Bacteria 1401
296 nmdc:mga0n895_1196812_c1 3300050512 Bacteria 734
297 nmdc:mga0n895_160530_c1 3300050512 Bacteria 2280
298 nmdc:mga0n895_90415_c1 3300050512 Bacteria 643
299 nmdc:mga0rr50_654250_c1 3300050513 Bacteria 897
300 nmdc:mga08x19_1233684_c1 3300050514 Bacteria 530
301 nmdc:mga08x19_38237_c1 3300050514 Bacteria 3048
302 nmdc:mga0a205_324025_c1 3300050515 Bacteria 1411
303 Ga0495619_0002595 3300053085 Bacteria 11807
304 Ga0495619_0189163 3300053085 Unclassified 1425
305 Ga0500566_0019816 3300053094 Bacteria 3950
306 Ga0501084_0001969 3300054114 Bacteria 16397
307 Ga0501084_0485104 3300054114 Bacteria 1045
308 Ga0501084_0738896 3300054114 Bacteria 829
309 Ga0501082_0853709 3300060353 Bacteria 796
310 Ga0530510_0000282 3300061734 Bacteria 32221
311 Ga0530510_0001111 3300061734 Bacteria 17863
312 Ga0265329_10197792
313 Ga0065707_10170890
314 Ga0070683_100143784
315 Ga0070683_101894657
316 Ga0070680_100953187
317 Ga0070661_100372007
318 Ga0070692_10001809
319 Ga0070659_100191824
320 Ga0070694_100000098
321 Ga0070694_100030188
322 Ga0070694_100596062
323 Ga0070694_100691300
324 Ga0070708_100288470
325 Ga0070708_100914007
326 Ga0070707_100274119
327 Ga0070698_100190271
328 Ga0070698_100252503
329 Ga0070698_100707532
330 Ga0070699_101485445
331 Ga0070699_102039063
332 Ga0070699_102130171
333 Ga0070679_100822395
334 Ga0070684_100496063
335 Ga0070697_100017036
336 Ga0070697_100050166
337 Ga0070697_100411772
338 Ga0070697_101705986
339 Ga0068853_100065750
340 Ga0070686_100384383
341 Ga0070695_100288911
342 Ga0070695_100583146
343 Ga0070696_100899802
344 Ga0070696_101950489
345 Ga0070665_100033312
346 Ga0070704_100014232
347 Ga0070704_100052402
348 Ga0070704_100065859
349 Ga0070704_100248234
350 Ga0068855_100008653
351 Ga0068857_100277441
352 Ga0068864_101816876
353 Ga0068860_100867289
354 Ga0075432_10299498
355 Ga0075428_100318548
356 Ga0075428_100348099
357 Ga0075428_100455729
358 Ga0075430_101228687
359 Ga0075431_100004954
360 Ga0075431_100013151
361 Ga0075431_100187493
362 Ga0075431_100509603
363 Ga0075431_102148745
364 Ga0075433_10066375
365 Ga0075433_10254699
366 Ga0075434_100134070
367 Ga0075434_101380677
368 Ga0075434_101791120
369 Ga0075429_100202263
370 Ga0075429_100370105
371 Ga0075429_101760099
372 Ga0075436_100557480
373 Ga0075436_101510663
374 Ga0075435_100434478
375 Ga0075435_101381595
376 Ga0105240_10017675
377 Ga0111539_10206469
378 Ga0114129_10105190
379 Ga0114129_10408021
380 Ga0114129_11108944
381 Ga0114129_12708789
382 Ga0105238_10026484
383 Ga0105249_10998786
384 Ga0105239_11084574
385 Ga0157370_10828472
386 Ga0157370_11401440
387 Ga0157369_10009484
388 Ga0157372_10001999
389 Ga0157372_12196846
390 Ga0157375_10663302
391 Ga0207695_11385116
392 Ga0207660_10368005
393 Ga0207657_10203013
394 Ga0207649_10284363
395 Ga0207652_10653757
396 Ga0207646_10415363
397 Ga0207694_10025368
398 Ga0207690_10136466
399 Ga0207661_11601962
400 Ga0207661_11795592
401 Ga0207674_10113146
402 Ga0268266_10197811
403 Ga0268264_10292243
404 Ga0265323_10047141
405 Ga0265322_10002945
406 Ga0265322_10244405
407 Ga0265330_10052792
408 Ga0265330_10266280
409 Ga0265340_10377999
410 Ga0265339_10430717
411 Ga0265316_10011999
412 Ga0265316_10020851
413 Ga0307408_101056173
414 Ga0307408_101162207
415 Ga0316575_10000568
416 Ga0316575_10289701
417 Ga0316579_10074257
418 Ga0316579_10099081
419 Ga0316579_10461490
420 Ga0265342_10057716
421 Ga0316576_10016077
422 Ga0316576_10029356
423 Ga0316576_10074606
424 Ga0316576_10655664
425 Ga0316576_11210220
426 Ga0316578_10035787
427 Ga0316578_10078030
428 Ga0316578_10137907
429 Ga0316578_10183387
430 Ga0316578_10226095
431 Ga0316578_10831083
432 Ga0316577_10014405
433 Ga0316577_10028606
434 Ga0316577_10167988
435 Ga0316577_10315118
436 Ga0316577_10645667
437 Ga0316577_10897074
438 Ga0316583_10004803
439 Ga0316583_10006684
440 Ga0316583_10024066
441 Ga0316585_10019958
442 Ga0316585_10022123
443 Ga0316585_10024596
444 Ga0316592_1019717
445 Ga0316588_1018604
446 Ga0316596_1037069
447 Ga0373926_0036281
448 Ga0373943_0068882
449 Ga0316574_0002517
450 Ga0316574_0039529
451 Ga0316574_0072718
452 Ga0316574_0096550
453 Ga0316574_0235426
454 Ga0316574_0831234
455 Ga0373935_0576400
456 Ga0373927_0811284
457 Ga0373947_0287362
458 Ga0373947_0555071
459 Ga0373947_0798607
460 Ga0373937_0147122
461 Ga0316582_0026452
462 Ga0316582_0043332
463 Ga0316582_0081422
464 Ga0316582_0111748
465 Ga0316582_0121374
466 Ga0316584_0023949
467 Ga0316584_0025852
468 Ga0316584_0049925
469 Ga0316584_0056745
470 Ga0316584_0326298
471 Ga0316584_0619023
472 Ga0316584_1094221
473 Ga0373925_0054750
474 Ga0373925_0089378
475 Ga0316581_0079851
476 Ga0400486_22449
477 Ga0400489_79430
478 Ga0439439_0038837
479 Ga0451577_0000147
480 Ga0451577_0279173
481 Ga0451577_0441752
482 Ga0453683_0000569
483 Ga0453683_0057683
484 Ga0453683_0475586
485 Ga0453683_0892582
486 Ga0453684_0000490
487 Ga0453684_0016373
488 Ga0453684_0073740
489 Ga0453684_0080778
490 Ga0453684_0442165
491 Ga0453684_0564069
492 Ga0453684_1328447
493 Ga0451576_0424126
494 Ga0451576_0486967
495 Ga0451576_0495765
496 Ga0451576_2594905
497 Ga0495603_0062856
498 Ga0495629_0000010
499 Ga0495629_0000315
500 Ga0495629_0411973
501 Ga0495641_0098857
502 Ga0495641_0206144
503 Ga0495641_0521321
504 Ga0495580_0019896
505 Ga0495580_0174700
506 Ga0495580_0233610
507 Ga0495580_0985840
508 Ga0495582_0059385
509 Ga0495582_0140285
510 Ga0495582_0822326
511 Ga0495639_0002775
512 Ga0495639_0003006
513 Ga0495639_0025034
514 Ga0495639_0245403
515 Ga0495662_0024268
516 Ga0495662_0118239
517 Ga0495664_0541525
518 Ga0495594_0007784
519 Ga0495618_0022889
520 Ga0495628_0623508
521 Ga0495630_0027383
522 Ga0495666_0037675
523 Ga0495666_0067235
524 Ga0495666_0184460
525 Ga0495666_0232525
526 Ga0495665_0018913
527 Ga0495665_0109884
528 Ga0495640_0013382
529 Ga0495586_0002987
530 Ga0495586_0004041
531 Ga0495586_0008275
532 Ga0495586_0108226
533 Ga0495586_0108835
534 Ga0495598_0404870
535 Ga0495621_0302908
536 Ga0495622_0020623
537 Ga0495622_0387262
538 Ga0495667_0434103
539 Ga0495634_0008465
540 Ga0495634_0190826
541 Ga0495635_0011042
542 Ga0495647_0041438
543 Ga0495647_0072286
544 Ga0495647_0422576
545 Ga0495658_0000708
546 Ga0495658_0053520
547 Ga0495613_0005467
548 Ga0495613_0362245
549 Ga0495613_0379941
550 Ga0495613_0663690
551 Ga0495624_0348810
552 Ga0495600_0707389
553 Ga0495581_0000556
554 Ga0495581_0044962
555 Ga0495581_0221429
556 Ga0495674_0031523
557 Ga0495676_0023266
558 Ga0495676_0201563
559 Ga0495676_0239933
560 Ga0495676_0559029
561 Ga0495680_0005933
562 Ga0495680_0044288
563 Ga0495680_0070780
564 Ga0495680_0564397
565 Ga0495684_0041786
566 Ga0495593_0649275
567 Ga0495614_0002981
568 Ga0495614_0303543
569 Ga0501033_0130206
570 Ga0501036_0018184
571 Ga0501037_0764798
572 Ga0501038_0009683
573 Ga0501040_0004372
574 Ga0501040_1052561
575 Ga0501042_0084098
576 Ga0501043_0527213
577 Ga0501048_0053228
578 Ga0501068_0052062
579 Ga0501071_0081854
580 Ga0501073_0338956
581 Ga0501074_0032462
582 Ga0501075_0003541
583 Ga0501075_0094458
584 Ga0501075_0127100
585 Ga0501075_0277607
586 Ga0501075_0617670
587 Ga0501076_0000714
588 Ga0501076_0208795
589 Ga0501077_0140084
590 Ga0501235_094781
591 Ga0501079_0594861
592 Ga0501079_0948913
593 Ga0501080_0063949
594 Ga0501081_0000733
595 Ga0501081_0232803
596 Ga0501081_0495231
597 Ga0501081_0532885
598 Ga0501045_0005082
599 Ga0501045_0458685
600 nmdc:mga05p37_198722_c1
601 nmdc:mga05p37_87248_c1
602 nmdc:mga09592_1554135_c1
603 nmdc:mga09592_320494_c1
604 nmdc:mga06r32_245163_c1
605 nmdc:mga06r32_368448_c1
606 nmdc:mga06r32_377119_c1
607 nmdc:mga0n895_1196812_c1
608 nmdc:mga0n895_160530_c1
609 nmdc:mga0n895_90415_c1
610 nmdc:mga0rr50_654250_c1
611 nmdc:mga08x19_1233684_c1
612 nmdc:mga08x19_38237_c1
613 nmdc:mga0a205_324025_c1
614 Ga0495619_0002595
615 Ga0495619_0189163
616 Ga0500566_0019816
617 Ga0501084_0001969
618 Ga0501084_0485104
619 Ga0501084_0738896
620 Ga0501082_0853709
621 Ga0530510_0000282
622 Ga0530510_0001111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

18

56

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iya-assembly2.cif.gz_C structure of the dna binding domain of antitoxin copaso 0.9597 5 48
6iya-assembly3.cif.gz_E-2 structure of the dna binding domain of antitoxin copaso 0.9424 3 48
6iya-assembly4.cif.gz_F-2 structure of the dna binding domain of antitoxin copaso 0.9416 3 50
6iya-assembly1.cif.gz_B structure of the dna binding domain of antitoxin copaso 0.9369 2 48
6iya-assembly2.cif.gz_D structure of the dna binding domain of antitoxin copaso 0.9341 3 48
ID Description Score Start End Superfamily
1p94A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.918 5 45 1.10.1220.10
1p94B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8936 5 45 1.10.1220.10
2hzaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8797 5 48 1.10.1220.10
2hzvG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8748 5 48 1.10.1220.10
2k9iA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8705 3 44 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A534EVL8-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.9169 1 53 GO:0006355
AF-A0A2W6ZNG3-F1-model_v4 CopG family transcriptional regulator 0.9053 1 76 GO:0006355
AF-A0A0F3GV19-F1-model_v4 Uncharacterized protein 0.9033 1 45
AF-A0A350FUX4-F1-model_v4 Uncharacterized protein 0.8957 1 52
AF-A0A1F9HZF2-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8953 4 44 GO:0006355

Map