F401267

General Info

Members Datasets Scaffolds Average Seq Length
311 215 622 196

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10113016|Ga0307515_101130163
Length 232
Sequence MYAIPNDEIIILNKKTINKRTFIHLLFYLCKKNRMRIRDIDKEKLVIENAIDQIVQDGFQGFSMNKLAKACNISVATLYIYYKDKDDLILKIGGTIALDFFTNTVKDFSPEMSFEEGLWKQWENRSLFALKNPKEVAFFEIIKHSPYGEAILNSSTKFSDFRTSMHQFIENALRNNELVPMTFEVFWAIAYGPLYTLLNFHKEGKSMGGKPFILTNKMIREAFQAAIKALKP

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
180 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
181 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
197 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
198 2738541284 Pedobacter sp. YR016 Isolate Unclassified
199 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
200 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
201 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
202 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
203 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
204 2818991444 Filimonas endophytica 3197 Isolate Unclassified
205 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
206 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
207 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
208 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
209 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
210 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
211 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
212 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
213 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
214 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
215 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0
Isolates 6.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 0
Rhizoplane 0.32
Rhizosphere 81.35
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10113016 3300028794 Bacteria 3153
2 SwRhRL2b_contig_1482229 2162886007 Bacteria 32470
3 SwRhRL2b_contig_1857681 2162886007 Bacteria 2573
4 JGI24744J21845_10051256 3300002077 Bacteria 760
5 JGI25159J45721_1014540 3300002987 Bacteria 1772
6 rootH1_10090914 3300003316 Unclassified 1269
7 rootH2_10292626 3300003320 Bacteria 2219
8 rootL2_10163645 3300003322 Bacteria 7401
9 rootL2_10209759 3300003322 Bacteria 4090
10 rootH1_10004563 3300003323 Bacteria 12500
11 rootH1_10021304 3300003323 Bacteria 2324
12 rootH1_10064082 3300003323 Bacteria 2471
13 JGI25160J50197_1008058 3300003354 Bacteria 4049
14 Ga0055530_10033960 3300003791 Bacteria 1308
15 Ga0055531_10000018 3300003794 Bacteria 175214
16 Ga0065714_10003162 3300005288 Bacteria 8423
17 Ga0065714_10005451 3300005288 Bacteria 8360
18 Ga0065714_10105033 3300005288 Bacteria 1573
19 Ga0065704_10000482 3300005289 Bacteria 19209
20 Ga0065704_10071568 3300005289 Bacteria 10667
21 Ga0065704_10073266 3300005289 Bacteria 7361
22 Ga0065704_10147578 3300005289 Bacteria 1457
23 Ga0070658_10195782 3300005327 Bacteria 1704
24 Ga0070676_10169645 3300005328 Bacteria 1410
25 Ga0070676_10194413 3300005328 Bacteria 1326
26 Ga0070690_100189463 3300005330 Bacteria 1425
27 Ga0070670_100131320 3300005331 Unclassified 2163
28 Ga0070670_100784347 3300005331 Bacteria 860
29 Ga0068869_100152287 3300005334 Bacteria 1794
30 Ga0070680_100025150 3300005336 Bacteria 4757
31 Ga0070682_100039861 3300005337 Bacteria 2888
32 Ga0068868_100021462 3300005338 Bacteria 4861
33 Ga0068868_100999698 3300005338 Bacteria 765
34 Ga0070691_10003406 3300005341 Bacteria 7152
35 Ga0070668_100038278 3300005347 Bacteria 3665
36 Ga0070669_100044311 3300005353 Bacteria 3241
37 Ga0070669_100889492 3300005353 Bacteria 760
38 Ga0070675_100101626 3300005354 Bacteria 2422
39 Ga0070671_100594068 3300005355 Bacteria 956
40 Ga0070674_100366215 3300005356 Bacteria 1168
41 Ga0070673_100012443 3300005364 Bacteria 5842
42 Ga0070667_100046986 3300005367 Unclassified 3632
43 Ga0070667_100576243 3300005367 Bacteria 1036
44 Ga0070662_100022925 3300005457 Bacteria 4283
45 Ga0068867_100177462 3300005459 Bacteria 1691
46 Ga0070685_10018885 3300005466 Bacteria 3714
47 Ga0070679_100022409 3300005530 Bacteria 6174
48 Ga0068853_100021458 3300005539 Bacteria 5386
49 Ga0068853_100032699 3300005539 Bacteria 4409
50 Ga0068853_100131031 3300005539 Bacteria 2244
51 Ga0068853_100608657 3300005539 Bacteria 1038
52 Ga0070672_100005709 3300005543 Bacteria 8290
53 Ga0070693_100013360 3300005547 Bacteria 4180
54 Ga0070665_100016760 3300005548 Bacteria 7345
55 Ga0068855_100000622 3300005563 Bacteria 43596
56 Ga0068855_100150987 3300005563 Bacteria 2642
57 Ga0068855_100462529 3300005563 Bacteria 1383
58 Ga0068857_101475745 3300005577 Bacteria 662
59 Ga0068854_100117317 3300005578 Bacteria 2015
60 Ga0068856_100052240 3300005614 Bacteria 4030
61 Ga0068856_100361126 3300005614 Bacteria 1471
62 Ga0068852_101038562 3300005616 Bacteria 839
63 Ga0068859_101173224 3300005617 Bacteria 845
64 Ga0068866_10057703 3300005718 Bacteria 2002
65 Ga0068861_100154928 3300005719 Bacteria 1884
66 Ga0068870_10024547 3300005840 Bacteria 2984
67 Ga0068863_100069728 3300005841 Bacteria 3324
68 Ga0068863_100583691 3300005841 Unclassified 1105
69 Ga0068860_100011609 3300005843 Bacteria 8688
70 Ga0068860_100056031 3300005843 Bacteria 3748
71 Ga0068862_100568793 3300005844 Bacteria 1084
72 Ga0097621_100064964 3300006237 Bacteria 3002
73 Ga0097621_100291141 3300006237 Bacteria 1440
74 Ga0068871_100007433 3300006358 Bacteria 7829
75 Ga0068871_100033799 3300006358 Bacteria 4052
76 Ga0075428_100004877 3300006844 Bacteria 14889
77 Ga0075430_100253242 3300006846 Bacteria 1459
78 Ga0068865_100375790 3300006881 Bacteria 1158
79 Ga0097620_101173302 3300006931 Bacteria 845
80 Ga0105240_10014460 3300009093 Bacteria 10777
81 Ga0105240_10015795 3300009093 Bacteria 10244
82 Ga0105240_10017398 3300009093 Bacteria 9689
83 Ga0111539_10015135 3300009094 Bacteria 9612
84 Ga0105245_10874195 3300009098 Bacteria 940
85 Ga0105243_10250797 3300009148 Bacteria 1580
86 Ga0105241_10006388 3300009174 Bacteria 8686
87 Ga0105241_10067710 3300009174 Bacteria 2764
88 Ga0105241_10077193 3300009174 Bacteria 2599
89 Ga0105241_10278023 3300009174 Bacteria 1429
90 Ga0105242_10006670 3300009176 Bacteria 8907
91 Ga0105242_10093409 3300009176 Bacteria 2536
92 Ga0105237_10003779 3300009545 Bacteria 17805
93 Ga0105237_10262403 3300009545 Bacteria 1730
94 Ga0105237_10552774 3300009545 Bacteria 1158
95 Ga0105237_10628668 3300009545 Bacteria 1080
96 Ga0105249_10329814 3300009553 Bacteria 1539
97 Ga0105249_10386874 3300009553 Bacteria 1426
98 Ga0105239_10000004 3300010375 Bacteria 532483
99 Ga0105239_10012391 3300010375 Bacteria 9495
100 Ga0105239_10112501 3300010375 Unclassified 3019
101 Ga0105239_10945611 3300010375 Unclassified 990
102 Ga0105246_10002754 3300011119 Bacteria 10639
103 Ga0157373_10000064 3300013100 Bacteria 94176
104 Ga0157371_10001595 3300013102 Bacteria 23267
105 Ga0157371_10034544 3300013102 Bacteria 3626
106 Ga0157370_10000859 3300013104 Bacteria 38553
107 Ga0157370_10024981 3300013104 Bacteria 5913
108 Ga0157370_10034242 3300013104 Bacteria 4948
109 Ga0157370_10057058 3300013104 Bacteria 3715
110 Ga0157370_10170311 3300013104 Bacteria 2024
111 Ga0157370_11130224 3300013104 Bacteria 708
112 Ga0157369_10479718 3300013105 Bacteria 1287
113 Ga0157374_10142155 3300013296 Bacteria 2330
114 Ga0157374_10235060 3300013296 Bacteria 1801
115 Ga0157378_10124611 3300013297 Bacteria 2379
116 Ga0163162_10000118 3300013306 Bacteria 69834
117 Ga0163162_10009735 3300013306 Bacteria 9353
118 Ga0163162_10052962 3300013306 Bacteria 4078
119 Ga0163162_10266056 3300013306 Bacteria 1846
120 Ga0163162_10403238 3300013306 Unclassified 1500
121 Ga0157372_10028479 3300013307 Bacteria 6096
122 Ga0157375_10050819 3300013308 Bacteria 4068
123 Ga0163163_10619066 3300014325 Bacteria 1146
124 Ga0182008_10000010 3300014497 Bacteria 301527
125 Ga0157376_10011171 3300014969 Bacteria 6607
126 Ga0157376_10025255 3300014969 Bacteria 4678
127 Ga0157376_10244258 3300014969 Bacteria 1674
128 Ga0157376_10862607 3300014969 Bacteria 921
129 Ga0157376_10949142 3300014969 Bacteria 880
130 Ga0182006_1011721 3300015261 Bacteria 3850
131 Ga0182006_1021858 3300015261 Bacteria 2664
132 Ga0163161_10000016 3300017792 Bacteria 235591
133 Ga0163161_10012247 3300017792 Bacteria 5951
134 Ga0163161_10022411 3300017792 Bacteria 4448
135 Ga0163161_10484115 3300017792 Bacteria 1005
136 Ga0209436_103983 3300025208 Bacteria 3742
137 Ga0209455_1001356 3300025272 Bacteria 11243
138 Ga0209130_1002270 3300025284 Bacteria 9921
139 Ga0209050_1001560 3300025298 Bacteria 23881
140 Ga0209050_1012907 3300025298 Bacteria 3779
141 Ga0207426_1000073 3300025302 Bacteria 323756
142 Ga0209257_1000023 3300025304 Bacteria 753019
143 Ga0207655_1000012 3300025728 Bacteria 640488
144 Ga0207642_10045229 3300025899 Bacteria 1953
145 Ga0207688_10029980 3300025901 Bacteria 2999
146 Ga0207680_10174781 3300025903 Bacteria 1448
147 Ga0207647_10052400 3300025904 Bacteria 2519
148 Ga0207645_10000263 3300025907 Bacteria 43560
149 Ga0207643_10030883 3300025908 Bacteria 2985
150 Ga0207705_10699795 3300025909 Bacteria 788
151 Ga0207654_10100031 3300025911 Bacteria 1785
152 Ga0207707_10000160 3300025912 Bacteria 70695
153 Ga0207695_10012553 3300025913 Bacteria 10153
154 Ga0207695_10013090 3300025913 Bacteria 9904
155 Ga0207695_10064115 3300025913 Bacteria 3785
156 Ga0207671_10008228 3300025914 Bacteria 8879
157 Ga0207671_10200841 3300025914 Bacteria 1557
158 Ga0207660_10023096 3300025917 Bacteria 4196
159 Ga0207657_10405821 3300025919 Bacteria 1071
160 Ga0207652_10000406 3300025921 Bacteria 44756
161 Ga0207650_10236279 3300025925 Bacteria 1476
162 Ga0207650_10973354 3300025925 Unclassified 721
163 Ga0207659_10482729 3300025926 Bacteria 1047
164 Ga0207706_10386265 3300025933 Bacteria 1214
165 Ga0207669_10462587 3300025937 Bacteria 1007
166 Ga0207691_10013423 3300025940 Bacteria 7841
167 Ga0207691_11129739 3300025940 Bacteria 651
168 Ga0207689_10003557 3300025942 Bacteria 14240
169 Ga0207667_10009695 3300025949 Bacteria 11327
170 Ga0207667_10395129 3300025949 Bacteria 1408
171 Ga0207651_10410640 3300025960 Bacteria 1153
172 Ga0207668_10072271 3300025972 Bacteria 2467
173 Ga0207640_10580473 3300025981 Bacteria 946
174 Ga0207640_10775129 3300025981 Bacteria 829
175 Ga0207658_10210395 3300025986 Bacteria 1629
176 Ga0207677_10144988 3300026023 Bacteria 1823
177 Ga0207703_10481344 3300026035 Bacteria 1163
178 Ga0207639_10078465 3300026041 Bacteria 2606
179 Ga0207639_10710218 3300026041 Bacteria 933
180 Ga0207639_11064706 3300026041 Bacteria 758
181 Ga0207648_10008743 3300026089 Bacteria 9760
182 Ga0207648_10023149 3300026089 Bacteria 5571
183 Ga0207676_10532493 3300026095 Unclassified 1120
184 Ga0207674_10731969 3300026116 Bacteria 955
185 Ga0207674_11383395 3300026116 Bacteria 673
186 Ga0207675_100060955 3300026118 Bacteria 3522
187 Ga0207698_10400106 3300026142 Bacteria 1312
188 Ga0207428_10204628 3300027907 Unclassified 1485
189 Ga0268266_10368019 3300028379 Bacteria 1353
190 Ga0268266_10648407 3300028379 Bacteria 1016
191 Ga0268265_10562492 3300028380 Bacteria 1084
192 Ga0268264_10016106 3300028381 Bacteria 6125
193 Ga0268264_10614561 3300028381 Bacteria 1072
194 Ga0307515_10000010 3300028794 Bacteria 651586
195 Ga0307515_10180904 3300028794 Bacteria 2059
196 Ga0316177_1082079 3300030731 Bacteria 6565
197 Ga0316177_1186797 3300030731 Bacteria 1314
198 Ga0316176_1173111 3300030732 Bacteria 19449
199 Ga0316183_1048236 3300030742 Bacteria 31406
200 Ga0316181_1192220 3300030744 Bacteria 1282
201 Ga0316181_1248553 3300030744 Bacteria 22193
202 Ga0316182_1164611 3300030745 Bacteria 2421
203 Ga0307513_10212713 3300031456 Bacteria 1763
204 Ga0307513_10331905 3300031456 Bacteria 1275
205 Ga0307509_10041370 3300031507 Bacteria 5001
206 Ga0307509_10077246 3300031507 Unclassified 3453
207 Ga0307509_10224921 3300031507 Bacteria 1685
208 Ga0307408_100002347 3300031548 Bacteria 13373
209 Ga0307508_10005153 3300031616 Bacteria 12515
210 Ga0307508_10068648 3300031616 Bacteria 3115
211 Ga0307405_10000002 3300031731 Bacteria 575196
212 Ga0307405_10122440 3300031731 Bacteria 1782
213 Ga0307413_10034497 3300031824 Bacteria 2893
214 Ga0307410_10000462 3300031852 Bacteria 16434
215 Ga0307406_10000003 3300031901 Bacteria 251998
216 Ga0307406_10027111 3300031901 Bacteria 3448
217 Ga0307407_10025702 3300031903 Bacteria 3107
218 Ga0307412_10000009 3300031911 Bacteria 445987
219 Ga0307412_10138084 3300031911 Bacteria 1781
220 Ga0307414_10000001 3300032004 Bacteria 1352954
221 Ga0307414_10010202 3300032004 Bacteria 5438
222 Ga0307411_10000008 3300032005 Bacteria 321575
223 Ga0307411_10194843 3300032005 Bacteria 1550
224 Ga0307507_10123279 3300033179 Bacteria 2063
225 Ga0307510_10070785 3300033180 Bacteria 3480
226 Ga0373936_0217990 3300035113 Unclassified 846
227 Ga0373955_0108204 3300035172 Bacteria 1605
228 Ga0373937_0174894 3300036401 Unclassified 2015
229 Ga0439439_0042858 3300041406 Bacteria 1176
230 Ga0439447_001609 3300041407 Bacteria 8276
231 Ga0439466_0002118 3300041411 Bacteria 7771
232 Ga0439445_0006592 3300042004 Bacteria 2672
233 Ga0439445_0090569 3300042004 Bacteria 861
234 Ga0439432_079006 3300042006 Bacteria 998
235 Ga0466969_0055977 3300044656 Bacteria 1927
236 Ga0451576_0000003 3300045051 Bacteria 1550573
237 Ga0495638_0000004 3300046460 Bacteria 700795
238 Ga0495580_0213205 3300046472 Bacteria 1328
239 Ga0495639_0080110 3300046475 Bacteria 1520
240 Ga0495607_0064643 3300046501 Bacteria 2066
241 Ga0495606_0022285 3300046507 Bacteria 4618
242 Ga0495630_0319738 3300046517 Unclassified 1186
243 Ga0495625_0089783 3300046660 Bacteria 2127
244 Ga0495625_0131133 3300046660 Bacteria 1698
245 Ga0495647_0185552 3300046681 Unclassified 907
246 Ga0495670_0099146 3300046691 Unclassified 1499
247 Ga0495600_0161193 3300046809 Bacteria 1450
248 Ga0495674_0065984 3300047319 Bacteria 3142
249 Ga0495686_0631098 3300047472 Unclassified 552
250 Ga0495602_0712875 3300048088 Bacteria 680
251 Ga0496115_0018140 3300048918 Bacteria 5396
252 Ga0496125_0001693 3300048928 Bacteria 30807
253 Ga0496126_0025640 3300048929 Bacteria 5668
254 Ga0501031_0123252 3300049568 Bacteria 1693
255 Ga0501032_0029595 3300049569 Bacteria 3757
256 Ga0501034_0068506 3300049571 Bacteria 3558
257 Ga0501036_0146852 3300049572 Bacteria 1989
258 Ga0501036_0494373 3300049572 Unclassified 1018
259 Ga0501037_0021159 3300049573 Bacteria 4806
260 Ga0501038_0015492 3300049574 Bacteria 6930
261 Ga0501047_0018459 3300049581 Bacteria 6688
262 Ga0501047_0271800 3300049581 Bacteria 1541
263 Ga0501073_0534488 3300049589 Bacteria 810
264 Ga0501238_000246 3300049671 Bacteria 7536
265 Ga0501249_000001 3300049679 Bacteria 268580
266 Ga0501249_008264 3300049679 Bacteria 2159
267 Ga0501241_002559 3300049758 Unclassified 3501
268 Ga0501241_012535 3300049758 Bacteria 1541
269 Ga0501266_000004 3300049763 Bacteria 356286
270 Ga0501269_007218 3300049766 Bacteria 1342
271 Ga0501280_001424 3300049776 Bacteria 4442
272 Ga0501282_005766 3300049778 Bacteria 1326
273 Ga0501035_0005968 3300049822 Bacteria 11465
274 Ga0501035_0010820 3300049822 Bacteria 8448
275 Ga0501035_0584184 3300049822 Bacteria 912
276 Ga0501035_1200146 3300049822 Unclassified 589
277 Ga0501044_0077040 3300049823 Bacteria 3382
278 nmdc:mga0qj67_435774_c1 3300050509 Bacteria 1056
279 nmdc:mga08y16_354481_c1 3300050511 Unclassified 1507
280 Ga0500651_0000143 3300053093 Bacteria 44885
281 Ga0500566_0245271 3300053094 Unclassified 875
282 Ga0500641_0007546 3300053096 Bacteria 3879
283 Ga0500641_0010845 3300053096 Bacteria 3302
284 Ga0500658_0000060 3300053134 Bacteria 54045
285 Ga0500559_0030505 3300053136 Bacteria 2312
286 Ga0500577_0066100 3300053142 Bacteria 1406
287 Ga0500588_0003992 3300053146 Unclassified 3162
288 Ga0500616_0000015 3300053153 Bacteria 633259
289 Ga0500616_0014439 3300053153 Bacteria 4539
290 Ga0500616_0125597 3300053153 Bacteria 1219
291 2513235363 2513020052 Bacteria 5120511
292 2738733308 2738541279 Bacteria 6149495
293 2738760752 2738541284 Bacteria 5199923
294 2738765846 2738541285 Bacteria 6150075
295 2739214889 2738543007 Bacteria 6149845
296 2740002393 2739367857 Bacteria 5433684
297 2740007209 2739367858 Bacteria 5432813
298 2776612955 2775506987 Bacteria 5373360
299 2819590210 2818991444 Bacteria 6968812
300 2819678776 2818991460 Bacteria 7595395
301 2842906206 2842903701 Bacteria 6986368
302 2852631735 2852627209 Bacteria 5896285
303 2857614700 2857613821 Bacteria 4917088
304 2857620306 2857618242 Bacteria 5635925
305 2884792005 2884791551 Bacteria 8511252
306 2884792918 2884791551 Bacteria 8511252
307 2904556824 2904555929 Bacteria 5218588
308 2919191423 2919186247 Bacteria 6244071
309 2939669658 2939664404 Bacteria 6364494
310 2958512480 2958512119 Bacteria 4528530
311 2965323634 2965320100 Bacteria 3975600
312 Ga0307515_10113016
313 SwRhRL2b_contig_1482229
314 SwRhRL2b_contig_1857681
315 JGI24744J21845_10051256
316 JGI25159J45721_1014540
317 rootH1_10090914
318 rootH2_10292626
319 rootL2_10163645
320 rootL2_10209759
321 rootH1_10004563
322 rootH1_10021304
323 rootH1_10064082
324 JGI25160J50197_1008058
325 Ga0055530_10033960
326 Ga0055531_10000018
327 Ga0065714_10003162
328 Ga0065714_10005451
329 Ga0065714_10105033
330 Ga0065704_10000482
331 Ga0065704_10071568
332 Ga0065704_10073266
333 Ga0065704_10147578
334 Ga0070658_10195782
335 Ga0070676_10169645
336 Ga0070676_10194413
337 Ga0070690_100189463
338 Ga0070670_100131320
339 Ga0070670_100784347
340 Ga0068869_100152287
341 Ga0070680_100025150
342 Ga0070682_100039861
343 Ga0068868_100021462
344 Ga0068868_100999698
345 Ga0070691_10003406
346 Ga0070668_100038278
347 Ga0070669_100044311
348 Ga0070669_100889492
349 Ga0070675_100101626
350 Ga0070671_100594068
351 Ga0070674_100366215
352 Ga0070673_100012443
353 Ga0070667_100046986
354 Ga0070667_100576243
355 Ga0070662_100022925
356 Ga0068867_100177462
357 Ga0070685_10018885
358 Ga0070679_100022409
359 Ga0068853_100021458
360 Ga0068853_100032699
361 Ga0068853_100131031
362 Ga0068853_100608657
363 Ga0070672_100005709
364 Ga0070693_100013360
365 Ga0070665_100016760
366 Ga0068855_100000622
367 Ga0068855_100150987
368 Ga0068855_100462529
369 Ga0068857_101475745
370 Ga0068854_100117317
371 Ga0068856_100052240
372 Ga0068856_100361126
373 Ga0068852_101038562
374 Ga0068859_101173224
375 Ga0068866_10057703
376 Ga0068861_100154928
377 Ga0068870_10024547
378 Ga0068863_100069728
379 Ga0068863_100583691
380 Ga0068860_100011609
381 Ga0068860_100056031
382 Ga0068862_100568793
383 Ga0097621_100064964
384 Ga0097621_100291141
385 Ga0068871_100007433
386 Ga0068871_100033799
387 Ga0075428_100004877
388 Ga0075430_100253242
389 Ga0068865_100375790
390 Ga0097620_101173302
391 Ga0105240_10014460
392 Ga0105240_10015795
393 Ga0105240_10017398
394 Ga0111539_10015135
395 Ga0105245_10874195
396 Ga0105243_10250797
397 Ga0105241_10006388
398 Ga0105241_10067710
399 Ga0105241_10077193
400 Ga0105241_10278023
401 Ga0105242_10006670
402 Ga0105242_10093409
403 Ga0105237_10003779
404 Ga0105237_10262403
405 Ga0105237_10552774
406 Ga0105237_10628668
407 Ga0105249_10329814
408 Ga0105249_10386874
409 Ga0105239_10000004
410 Ga0105239_10012391
411 Ga0105239_10112501
412 Ga0105239_10945611
413 Ga0105246_10002754
414 Ga0157373_10000064
415 Ga0157371_10001595
416 Ga0157371_10034544
417 Ga0157370_10000859
418 Ga0157370_10024981
419 Ga0157370_10034242
420 Ga0157370_10057058
421 Ga0157370_10170311
422 Ga0157370_11130224
423 Ga0157369_10479718
424 Ga0157374_10142155
425 Ga0157374_10235060
426 Ga0157378_10124611
427 Ga0163162_10000118
428 Ga0163162_10009735
429 Ga0163162_10052962
430 Ga0163162_10266056
431 Ga0163162_10403238
432 Ga0157372_10028479
433 Ga0157375_10050819
434 Ga0163163_10619066
435 Ga0182008_10000010
436 Ga0157376_10011171
437 Ga0157376_10025255
438 Ga0157376_10244258
439 Ga0157376_10862607
440 Ga0157376_10949142
441 Ga0182006_1011721
442 Ga0182006_1021858
443 Ga0163161_10000016
444 Ga0163161_10012247
445 Ga0163161_10022411
446 Ga0163161_10484115
447 Ga0209436_103983
448 Ga0209455_1001356
449 Ga0209130_1002270
450 Ga0209050_1001560
451 Ga0209050_1012907
452 Ga0207426_1000073
453 Ga0209257_1000023
454 Ga0207655_1000012
455 Ga0207642_10045229
456 Ga0207688_10029980
457 Ga0207680_10174781
458 Ga0207647_10052400
459 Ga0207645_10000263
460 Ga0207643_10030883
461 Ga0207705_10699795
462 Ga0207654_10100031
463 Ga0207707_10000160
464 Ga0207695_10012553
465 Ga0207695_10013090
466 Ga0207695_10064115
467 Ga0207671_10008228
468 Ga0207671_10200841
469 Ga0207660_10023096
470 Ga0207657_10405821
471 Ga0207652_10000406
472 Ga0207650_10236279
473 Ga0207650_10973354
474 Ga0207659_10482729
475 Ga0207706_10386265
476 Ga0207669_10462587
477 Ga0207691_10013423
478 Ga0207691_11129739
479 Ga0207689_10003557
480 Ga0207667_10009695
481 Ga0207667_10395129
482 Ga0207651_10410640
483 Ga0207668_10072271
484 Ga0207640_10580473
485 Ga0207640_10775129
486 Ga0207658_10210395
487 Ga0207677_10144988
488 Ga0207703_10481344
489 Ga0207639_10078465
490 Ga0207639_10710218
491 Ga0207639_11064706
492 Ga0207648_10008743
493 Ga0207648_10023149
494 Ga0207676_10532493
495 Ga0207674_10731969
496 Ga0207674_11383395
497 Ga0207675_100060955
498 Ga0207698_10400106
499 Ga0207428_10204628
500 Ga0268266_10368019
501 Ga0268266_10648407
502 Ga0268265_10562492
503 Ga0268264_10016106
504 Ga0268264_10614561
505 Ga0307515_10000010
506 Ga0307515_10180904
507 Ga0316177_1082079
508 Ga0316177_1186797
509 Ga0316176_1173111
510 Ga0316183_1048236
511 Ga0316181_1192220
512 Ga0316181_1248553
513 Ga0316182_1164611
514 Ga0307513_10212713
515 Ga0307513_10331905
516 Ga0307509_10041370
517 Ga0307509_10077246
518 Ga0307509_10224921
519 Ga0307408_100002347
520 Ga0307508_10005153
521 Ga0307508_10068648
522 Ga0307405_10000002
523 Ga0307405_10122440
524 Ga0307413_10034497
525 Ga0307410_10000462
526 Ga0307406_10000003
527 Ga0307406_10027111
528 Ga0307407_10025702
529 Ga0307412_10000009
530 Ga0307412_10138084
531 Ga0307414_10000001
532 Ga0307414_10010202
533 Ga0307411_10000008
534 Ga0307411_10194843
535 Ga0307507_10123279
536 Ga0307510_10070785
537 Ga0373936_0217990
538 Ga0373955_0108204
539 Ga0373937_0174894
540 Ga0439439_0042858
541 Ga0439447_001609
542 Ga0439466_0002118
543 Ga0439445_0006592
544 Ga0439445_0090569
545 Ga0439432_079006
546 Ga0466969_0055977
547 Ga0451576_0000003
548 Ga0495638_0000004
549 Ga0495580_0213205
550 Ga0495639_0080110
551 Ga0495607_0064643
552 Ga0495606_0022285
553 Ga0495630_0319738
554 Ga0495625_0089783
555 Ga0495625_0131133
556 Ga0495647_0185552
557 Ga0495670_0099146
558 Ga0495600_0161193
559 Ga0495674_0065984
560 Ga0495686_0631098
561 Ga0495602_0712875
562 Ga0496115_0018140
563 Ga0496125_0001693
564 Ga0496126_0025640
565 Ga0501031_0123252
566 Ga0501032_0029595
567 Ga0501034_0068506
568 Ga0501036_0146852
569 Ga0501036_0494373
570 Ga0501037_0021159
571 Ga0501038_0015492
572 Ga0501047_0018459
573 Ga0501047_0271800
574 Ga0501073_0534488
575 Ga0501238_000246
576 Ga0501249_000001
577 Ga0501249_008264
578 Ga0501241_002559
579 Ga0501241_012535
580 Ga0501266_000004
581 Ga0501269_007218
582 Ga0501280_001424
583 Ga0501282_005766
584 Ga0501035_0005968
585 Ga0501035_0010820
586 Ga0501035_0584184
587 Ga0501035_1200146
588 Ga0501044_0077040
589 nmdc:mga0qj67_435774_c1
590 nmdc:mga08y16_354481_c1
591 Ga0500651_0000143
592 Ga0500566_0245271
593 Ga0500641_0007546
594 Ga0500641_0010845
595 Ga0500658_0000060
596 Ga0500559_0030505
597 Ga0500577_0066100
598 Ga0500588_0003992
599 Ga0500616_0000015
600 Ga0500616_0014439
601 Ga0500616_0125597
602 2513235363
603 2738733308
604 2738760752
605 2738765846
606 2739214889
607 2740002393
608 2740007209
609 2776612955
610 2819590210
611 2819678776
612 2842906206
613 2852631735
614 2857614700
615 2857620306
616 2884792005
617 2884792918
618 2904556824
619 2919191423
620 2939669658
621 2958512480
622 2965323634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

46

92

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4me9-assembly1.cif.gz_B crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution 0.8784 7 196
4me9-assembly1.cif.gz_B crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution 0.8655 7 196
3pas-assembly1.cif.gz_A crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution 0.8534 1 196
3pas-assembly1.cif.gz_A crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution 0.8452 1 196
3he0-assembly1.cif.gz_B the structure of a putative transcriptional regulator tetr family protein from vibrio parahaemolyticus. 0.84 8 196
ID Description Score Start End Superfamily
3mvpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9767 5 48 1.10.10.60
1jupE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9707 7 54 1.10.10.60
1qvuE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.968 7 54 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9677 7 54 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9671 8 54 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q6AML9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9713 34 196
AF-J2JKW4-F1-model_v4 Transcriptional regulator 0.966 4 196 GO:0003677
AF-A0A376DN64-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9648 1 196 GO:0003677
AF-A0A4R8AZ69-F1-model_v4 TetR family transcriptional regulator 0.9642 1 196 GO:0003677
AF-A0A2N4XAE7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9603 1 196 GO:0003677

Map