F401252

General Info

Members Datasets Scaffolds Average Seq Length
311 190 622 351

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10063755|Ga0207668_100637552
Length 339
Sequence MNPRHLIVAAIAASAITAALPIEGTMPSLAGATGWLNSPPLSPAELRGKVVILDVWTYTCINWLRTLPYVRAWAEKYKDKGLVVIGVHSPEFPFEHDLANVRRAAAEMRVTYPVAIDNDFAIWRALNNQYWPALYIVDAQGRIRHHQFGEGGYEEAERVIQQLLVDAGSSGVGSGLTKVDAPGIEAPAAWNDLKSPENYVGYGRTENFSGGALRDGPRVYSVPARLRLNQWGLAGDWTISKGAVALNKPNGRIVYRFHARDLHLVMGPASTGSPVRFRVLIDGKPPGPAHGTDVDDQGIGTVDAQRLYQLIRQPAPIADRTFEIEFLDPGVEAYAFTFG

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 2919404418 Luteibacter sp. 3190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.64
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.61
Rhizosphere 96.78
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10063755 3300025972 Bacteria 2601
2 Ga0070676_10218977 3300005328 Bacteria 1256
3 Ga0070670_100027830 3300005331 Bacteria 4863
4 Ga0070670_100148215 3300005331 Bacteria 2030
5 Ga0070682_100030931 3300005337 Bacteria 3235
6 Ga0070661_100221071 3300005344 Unclassified 1453
7 Ga0070668_100048983 3300005347 Bacteria 3250
8 Ga0070668_100087975 3300005347 Bacteria 2445
9 Ga0070674_100025344 3300005356 Bacteria 3860
10 Ga0070673_100000171 3300005364 Bacteria 31374
11 Ga0070673_100067006 3300005364 Bacteria 2870
12 Ga0070667_100337636 3300005367 Bacteria 1362
13 Ga0070713_100005682 3300005436 Bacteria 8560
14 Ga0070705_100190143 3300005440 Bacteria 1398
15 Ga0070694_100006291 3300005444 Bacteria 7208
16 Ga0070708_100010975 3300005445 Bacteria 7361
17 Ga0070708_100022349 3300005445 Bacteria 5364
18 Ga0070708_100177670 3300005445 Bacteria 1989
19 Ga0070662_100000346 3300005457 Bacteria 27732
20 Ga0068867_100015396 3300005459 Bacteria 5423
21 Ga0070685_10000109 3300005466 Bacteria 52248
22 Ga0070706_100000261 3300005467 Bacteria 64138
23 Ga0070706_100015126 3300005467 Bacteria 7125
24 Ga0070706_100022085 3300005467 Bacteria 5860
25 Ga0070706_100040043 3300005467 Bacteria 4326
26 Ga0070706_100045798 3300005467 Bacteria 4038
27 Ga0070706_100117183 3300005467 Bacteria 2481
28 Ga0070707_100029019 3300005468 Bacteria 5266
29 Ga0070707_100186074 3300005468 Bacteria 2025
30 Ga0070698_100009109 3300005471 Bacteria 10662
31 Ga0070699_100001714 3300005518 Bacteria 19979
32 Ga0070699_100009720 3300005518 Bacteria 8323
33 Ga0070699_100011521 3300005518 Bacteria 7632
34 Ga0070699_100020536 3300005518 Bacteria 5697
35 Ga0070684_100275633 3300005535 Bacteria 1540
36 Ga0070697_100018375 3300005536 Bacteria 5511
37 Ga0070697_100089541 3300005536 Bacteria 2543
38 Ga0070672_100033572 3300005543 Bacteria 3887
39 Ga0070695_100022010 3300005545 Bacteria 3907
40 Ga0070695_100023099 3300005545 Bacteria 3818
41 Ga0070696_100029738 3300005546 Bacteria 3736
42 Ga0070696_100107500 3300005546 Unclassified 2006
43 Ga0070704_100018490 3300005549 Bacteria 4458
44 Ga0068855_100089072 3300005563 Bacteria 3564
45 Ga0070664_100105004 3300005564 Bacteria 2460
46 Ga0068857_100020809 3300005577 Bacteria 5771
47 Ga0068857_100062619 3300005577 Bacteria 3307
48 Ga0068856_100149187 3300005614 Bacteria 2346
49 Ga0070702_100072528 3300005615 Bacteria 2038
50 Ga0068864_100025964 3300005618 Bacteria 4937
51 Ga0068864_100214225 3300005618 Bacteria 1775
52 Ga0068861_100018847 3300005719 Bacteria 4920
53 Ga0068870_10018479 3300005840 Bacteria 3368
54 Ga0068863_100025845 3300005841 Bacteria 5602
55 Ga0068863_100165750 3300005841 Bacteria 2119
56 Ga0068858_100130010 3300005842 Bacteria 2360
57 Ga0068860_100042026 3300005843 Bacteria 4368
58 Ga0068860_100175335 3300005843 Bacteria 2072
59 Ga0068862_100015711 3300005844 Bacteria 6291
60 Ga0081538_10000884 3300005981 Bacteria 32396
61 Ga0081538_10081369 3300005981 Bacteria 1723
62 Ga0070717_10004784 3300006028 Bacteria 9846
63 Ga0075365_10223612 3300006038 Bacteria 1321
64 Ga0075432_10011855 3300006058 Bacteria 2962
65 Ga0070712_100038619 3300006175 Bacteria 3264
66 Ga0097621_100099928 3300006237 Bacteria 2440
67 Ga0075428_100123122 3300006844 Bacteria 2823
68 Ga0075430_100000015 3300006846 Bacteria 89952
69 Ga0075431_100000478 3300006847 Bacteria 33199
70 Ga0075433_10045995 3300006852 Bacteria 3795
71 Ga0075434_100027297 3300006871 Bacteria 5604
72 Ga0075434_100300237 3300006871 Bacteria 1626
73 Ga0075435_100002861 3300007076 Bacteria 11560
74 Ga0105251_10086464 3300009011 Bacteria 1444
75 Ga0111539_10050506 3300009094 Bacteria 4955
76 Ga0105245_10002193 3300009098 Bacteria 17695
77 Ga0105245_10028686 3300009098 Bacteria 4912
78 Ga0114129_10028979 3300009147 Bacteria 7843
79 Ga0114129_10157967 3300009147 Bacteria 3100
80 Ga0114129_10192526 3300009147 Bacteria 2768
81 Ga0114129_10484093 3300009147 Bacteria 1618
82 Ga0114129_10604594 3300009147 Bacteria 1420
83 Ga0114129_10664467 3300009147 Bacteria 1343
84 Ga0114129_10665713 3300009147 Bacteria 1342
85 Ga0105243_10080920 3300009148 Bacteria 2651
86 Ga0105241_10076623 3300009174 Bacteria 2608
87 Ga0105242_10419024 3300009176 Bacteria 1254
88 Ga0105248_10057811 3300009177 Bacteria 4354
89 Ga0105249_10014070 3300009553 Bacteria 7073
90 Ga0105246_10032270 3300011119 Bacteria 3472
91 Ga0157374_10117556 3300013296 Bacteria 2563
92 Ga0163162_10129338 3300013306 Bacteria 2633
93 Ga0163163_10127370 3300014325 Bacteria 2585
94 Ga0207682_10061771 3300025893 Bacteria 1569
95 Ga0207680_10029624 3300025903 Bacteria 3078
96 Ga0207647_10057279 3300025904 Bacteria 2389
97 Ga0207645_10207567 3300025907 Bacteria 1290
98 Ga0207705_10000038 3300025909 Bacteria 193812
99 Ga0207684_10001521 3300025910 Bacteria 24854
100 Ga0207684_10003539 3300025910 Bacteria 15215
101 Ga0207684_10012014 3300025910 Bacteria 7540
102 Ga0207684_10028958 3300025910 Unclassified 4717
103 Ga0207684_10074446 3300025910 Bacteria 2885
104 Ga0207693_10064562 3300025915 Bacteria 2868
105 Ga0207646_10009828 3300025922 Bacteria 9418
106 Ga0207659_10184298 3300025926 Bacteria 1656
107 Ga0207700_10295716 3300025928 Bacteria 1397
108 Ga0207706_10000259 3300025933 Bacteria 57912
109 Ga0207686_10109469 3300025934 Bacteria 1860
110 Ga0207709_10055123 3300025935 Bacteria 2455
111 Ga0207691_10020393 3300025940 Bacteria 6266
112 Ga0207711_10022156 3300025941 Bacteria 5311
113 Ga0207711_10107636 3300025941 Bacteria 2475
114 Ga0207689_10001685 3300025942 Bacteria 20991
115 Ga0207667_10255092 3300025949 Bacteria 1794
116 Ga0207651_10000047 3300025960 Bacteria 56486
117 Ga0207651_10146495 3300025960 Bacteria 1832
118 Ga0207651_10209052 3300025960 Bacteria 1569
119 Ga0207712_10085453 3300025961 Bacteria 2309
120 Ga0207712_10206421 3300025961 Bacteria 1562
121 Ga0207668_10023707 3300025972 Bacteria 3950
122 Ga0207703_10022045 3300026035 Bacteria 4990
123 Ga0207678_10163500 3300026067 Bacteria 1901
124 Ga0207702_10121117 3300026078 Bacteria 2342
125 Ga0207641_10065149 3300026088 Bacteria 3116
126 Ga0207648_10010951 3300026089 Bacteria 8567
127 Ga0207676_10041283 3300026095 Bacteria 3540
128 Ga0207674_10071281 3300026116 Bacteria 3492
129 Ga0207674_10173055 3300026116 Bacteria 2112
130 Ga0207674_10329421 3300026116 Bacteria 1477
131 Ga0207675_100001861 3300026118 Bacteria 21131
132 Ga0207675_100073094 3300026118 Bacteria 3208
133 Ga0207683_10001828 3300026121 Bacteria 18812
134 Ga0207428_10086513 3300027907 Bacteria 2440
135 Ga0207428_10161425 3300027907 Bacteria 1702
136 Ga0268266_10049725 3300028379 Bacteria 3596
137 Ga0268265_10074054 3300028380 Bacteria 2662
138 Ga0268264_10018596 3300028381 Bacteria 5681
139 Ga0268264_10384269 3300028381 Bacteria 1345
140 Ga0265318_10011501 3300028577 Bacteria 3807
141 Ga0265318_10024815 3300028577 Bacteria 2373
142 Ga0307517_10124063 3300028786 Bacteria 1894
143 Ga0265327_10006304 3300031251 Bacteria 9543
144 Ga0307408_100012983 3300031548 Bacteria 5523
145 Ga0307405_10005263 3300031731 Bacteria 6221
146 Ga0307405_10035959 3300031731 Bacteria 2963
147 Ga0307413_10005927 3300031824 Bacteria 5523
148 Ga0307410_10000446 3300031852 Bacteria 16584
149 Ga0307410_10157203 3300031852 Bacteria 1699
150 Ga0307406_10008707 3300031901 Bacteria 5672
151 Ga0307407_10065673 3300031903 Bacteria 2137
152 Ga0307407_10074504 3300031903 Bacteria 2031
153 Ga0307409_100006495 3300031995 Bacteria 6878
154 Ga0307409_100006864 3300031995 Bacteria 6746
155 Ga0307409_100322472 3300031995 Bacteria 1446
156 Ga0307416_100005272 3300032002 Bacteria 7916
157 Ga0307416_100272180 3300032002 Bacteria 1664
158 Ga0307414_10006858 3300032004 Bacteria 6373
159 Ga0307411_10015432 3300032005 Bacteria 4290
160 Ga0307415_100000426 3300032126 Bacteria 18072
161 Ga0307415_100000950 3300032126 Bacteria 13334
162 Ga0307415_100006147 3300032126 Bacteria 6443
163 Ga0373945_0013937 3300035116 Bacteria 2689
164 Ga0373954_0062254 3300035118 Bacteria 1762
165 Ga0373943_0007400 3300035170 Bacteria 4931
166 Ga0373946_0017153 3300035171 Bacteria 2767
167 Ga0373946_0037886 3300035171 Bacteria 1962
168 Ga0373935_0141979 3300035692 Bacteria 1623
169 Ga0373935_0176997 3300035692 Bacteria 1463
170 Ga0373927_0006846 3300035695 Bacteria 7748
171 Ga0373947_0009376 3300035725 Bacteria 5623
172 Ga0373925_0020208 3300037068 Bacteria 4845
173 Ga0373925_0050704 3300037068 Bacteria 3097
174 Ga0395899_0060235 3300037312 Bacteria 2797
175 Ga0395900_0018815 3300037418 Bacteria 7045
176 Ga0395900_0035625 3300037418 Bacteria 5126
177 Ga0395898_0447640 3300037466 Bacteria 1230
178 Ga0395905_0004729 3300037471 Bacteria 14060
179 Ga0395905_0005431 3300037471 Bacteria 13023
180 Ga0395905_0126407 3300037471 Unclassified 2404
181 Ga0395905_0263445 3300037471 Bacteria 1609
182 Ga0436364_1403761 3300037853 Bacteria 6469
183 Ga0395901_0002280 3300038443 Bacteria 19557
184 Ga0395901_0018723 3300038443 Bacteria 7074
185 Ga0395901_0048108 3300038443 Bacteria 4429
186 Ga0439460_0039241 3300042461 Bacteria 1383
187 Ga0439440_0005768 3300042993 Bacteria 2468
188 Ga0466960_0031862 3300044901 Bacteria 2435
189 Ga0451576_0218634 3300045051 Bacteria 1989
190 Ga0451576_0230252 3300045051 Bacteria 1935
191 Ga0451576_0231375 3300045051 Bacteria 1930
192 Ga0466967_0050347 3300045976 Bacteria 3647
193 Ga0495627_012028 3300046453 Bacteria 3083
194 Ga0495603_0015270 3300046455 Bacteria 4646
195 Ga0495603_0053083 3300046455 Bacteria 2405
196 Ga0495580_0000002 3300046472 Bacteria 121311
197 Ga0495580_0126279 3300046472 Bacteria 1775
198 Ga0495605_0009629 3300046474 Bacteria 5426
199 Ga0495664_0064728 3300046477 Bacteria 2179
200 Ga0495584_0000016 3300046491 Bacteria 156560
201 Ga0495584_0015988 3300046491 Bacteria 3829
202 Ga0495584_0027060 3300046491 Bacteria 2906
203 Ga0495584_0030970 3300046491 Bacteria 2707
204 Ga0495585_0000048 3300046492 Bacteria 120031
205 Ga0495585_0000746 3300046492 Bacteria 28843
206 Ga0495585_0002201 3300046492 Bacteria 14148
207 Ga0495585_0005384 3300046492 Bacteria 8074
208 Ga0495585_0031191 3300046492 Bacteria 3027
209 Ga0495585_0048060 3300046492 Bacteria 2374
210 Ga0495594_0047504 3300046499 Bacteria 2357
211 Ga0495596_0026356 3300046500 Bacteria 2344
212 Ga0495596_0029448 3300046500 Bacteria 2201
213 Ga0495596_0060981 3300046500 Bacteria 1469
214 Ga0495607_0002698 3300046501 Bacteria 14167
215 Ga0495607_0026285 3300046501 Bacteria 3612
216 Ga0495607_0063289 3300046501 Bacteria 2093
217 Ga0495583_0021487 3300046506 Bacteria 3319
218 Ga0495606_0010077 3300046507 Bacteria 7895
219 Ga0495616_0010128 3300046513 Bacteria 5470
220 Ga0495616_0036519 3300046513 Bacteria 2535
221 Ga0495620_0009801 3300046515 Bacteria 5082
222 Ga0495630_0119576 3300046517 Bacteria 1998
223 Ga0495631_0000837 3300046518 Bacteria 19605
224 Ga0495631_0025965 3300046518 Bacteria 2693
225 Ga0495631_0037690 3300046518 Bacteria 2152
226 Ga0495644_0000688 3300046523 Bacteria 14010
227 Ga0495642_0006881 3300046528 Bacteria 4359
228 Ga0495642_0028371 3300046528 Bacteria 2230
229 Ga0495665_0002388 3300046531 Bacteria 10139
230 Ga0495609_0012220 3300046538 Bacteria 4072
231 Ga0495609_0037953 3300046538 Bacteria 2173
232 Ga0495597_0069380 3300046542 Bacteria 1521
233 Ga0495622_0001683 3300046557 Bacteria 10937
234 Ga0495622_0009539 3300046557 Bacteria 4491
235 Ga0495622_0141416 3300046557 Bacteria 1092
236 Ga0495633_0003395 3300046558 Bacteria 10654
237 Ga0495633_0004792 3300046558 Bacteria 8481
238 Ga0495633_0008790 3300046558 Bacteria 5647
239 Ga0495656_0003496 3300046615 Bacteria 5313
240 Ga0495656_0021674 3300046615 Bacteria 2504
241 Ga0495668_0007998 3300046616 Bacteria 6664
242 Ga0495611_0000010 3300046648 Bacteria 156661
243 Ga0495611_0000156 3300046648 Bacteria 48942
244 Ga0495611_0004738 3300046648 Bacteria 5843
245 Ga0495611_0007083 3300046648 Bacteria 4762
246 Ga0495625_0027118 3300046660 Bacteria 4319
247 Ga0495661_0000839 3300046665 Bacteria 28706
248 Ga0495661_0005039 3300046665 Bacteria 9432
249 Ga0495661_0016908 3300046665 Bacteria 4820
250 Ga0495661_0036602 3300046665 Bacteria 3071
251 Ga0495661_0097711 3300046665 Bacteria 1658
252 Ga0495661_0098334 3300046665 Bacteria 1652
253 Ga0495588_0001550 3300046674 Bacteria 9831
254 Ga0495588_0013071 3300046674 Bacteria 3945
255 Ga0495658_0002396 3300046683 Bacteria 9458
256 Ga0495669_0011835 3300046684 Bacteria 3709
257 Ga0495624_0034553 3300046690 Bacteria 3269
258 Ga0495670_0000180 3300046691 Bacteria 28193
259 Ga0495670_0001782 3300046691 Bacteria 10563
260 Ga0495670_0102052 3300046691 Bacteria 1478
261 Ga0495671_0000715 3300046692 Bacteria 23970
262 Ga0495671_0014618 3300046692 Bacteria 4219
263 Ga0495671_0025074 3300046692 Bacteria 3102
264 Ga0495649_0010352 3300046694 Bacteria 5509
265 Ga0495649_0012192 3300046694 Bacteria 5014
266 Ga0495589_0002793 3300046794 Bacteria 9655
267 Ga0495581_0005371 3300047315 Bacteria 7415
268 Ga0495581_0007718 3300047315 Bacteria 6225
269 Ga0495604_0023406 3300047317 Bacteria 4927
270 Ga0495672_0001143 3300047320 Bacteria 26813
271 Ga0495676_0000007 3300047321 Bacteria 276148
272 Ga0495676_0053593 3300047321 Bacteria 3213
273 Ga0495677_0000989 3300047445 Bacteria 11438
274 Ga0495677_0001036 3300047445 Bacteria 11157
275 Ga0495677_0014875 3300047445 Bacteria 2830
276 Ga0495679_036664 3300047446 Bacteria 1548
277 Ga0495681_0000658 3300047470 Bacteria 26270
278 Ga0495626_0002442 3300048091 Bacteria 12899
279 Ga0495626_0038282 3300048091 Bacteria 2274
280 Ga0496102_0077855 3300048905 Bacteria 3052
281 Ga0496102_0119208 3300048905 Bacteria 2464
282 Ga0496108_0114722 3300048911 Bacteria 2307
283 Ga0496109_0085749 3300048912 Bacteria 2908
284 Ga0496112_0128130 3300048915 Bacteria 2509
285 Ga0495682_0000187 3300049460 Bacteria 50666
286 Ga0501235_019703 3300049669 Bacteria 1497
287 nmdc:mga0k408_108755_c1 3300050493 Bacteria 1638
288 nmdc:mga05p37_255204_c1 3300050507 Bacteria 2101
289 nmdc:mga05p37_321963_c1 3300050507 Bacteria 1830
290 nmdc:mga05p37_381852_c1 3300050507 Bacteria 1650
291 nmdc:mga05p37_83229_c1 3300050507 Bacteria 3942
292 nmdc:mga09592_20128_c1 3300050508 Bacteria 5484
293 nmdc:mga09592_211171_c1 3300050508 Bacteria 1682
294 nmdc:mga0qj67_168_c1 3300050509 Bacteria 43793
295 nmdc:mga0qj67_97_c1 3300050509 Bacteria 58508
296 nmdc:mga06r32_243627_c1 3300050510 Bacteria 1785
297 nmdc:mga06r32_24495_c1 3300050510 Bacteria 5602
298 nmdc:mga06r32_569_c1 3300050510 Bacteria 32069
299 nmdc:mga0n895_10813_c1 3300050512 Bacteria 8099
300 nmdc:mga0n895_23836_c1 3300050512 Bacteria 5759
301 nmdc:mga0n895_250863_c1 3300050512 Bacteria 1796
302 nmdc:mga0n895_42158_c1 3300050512 Bacteria 4440
303 nmdc:mga0rr50_84544_c1 3300050513 Bacteria 2457
304 nmdc:mga08x19_50969_c2 3300050514 Bacteria 1630
305 nmdc:mga0a205_16292_c1 3300050515 Bacteria 6960
306 nmdc:mga0a205_209471_c1 3300050515 Bacteria 1838
307 nmdc:mga0a205_27530_c1 3300050515 Bacteria 5428
308 nmdc:mga0a205_5719_c1 3300050515 Bacteria 11205
309 Ga0587066_009484 3300059490 Bacteria 1381
310 Ga0587067_013777 3300059640 Bacteria 1286
311 2919405527 2919404418 Bacteria 4232372
312 Ga0207668_10063755
313 Ga0070676_10218977
314 Ga0070670_100027830
315 Ga0070670_100148215
316 Ga0070682_100030931
317 Ga0070661_100221071
318 Ga0070668_100048983
319 Ga0070668_100087975
320 Ga0070674_100025344
321 Ga0070673_100000171
322 Ga0070673_100067006
323 Ga0070667_100337636
324 Ga0070713_100005682
325 Ga0070705_100190143
326 Ga0070694_100006291
327 Ga0070708_100010975
328 Ga0070708_100022349
329 Ga0070708_100177670
330 Ga0070662_100000346
331 Ga0068867_100015396
332 Ga0070685_10000109
333 Ga0070706_100000261
334 Ga0070706_100015126
335 Ga0070706_100022085
336 Ga0070706_100040043
337 Ga0070706_100045798
338 Ga0070706_100117183
339 Ga0070707_100029019
340 Ga0070707_100186074
341 Ga0070698_100009109
342 Ga0070699_100001714
343 Ga0070699_100009720
344 Ga0070699_100011521
345 Ga0070699_100020536
346 Ga0070684_100275633
347 Ga0070697_100018375
348 Ga0070697_100089541
349 Ga0070672_100033572
350 Ga0070695_100022010
351 Ga0070695_100023099
352 Ga0070696_100029738
353 Ga0070696_100107500
354 Ga0070704_100018490
355 Ga0068855_100089072
356 Ga0070664_100105004
357 Ga0068857_100020809
358 Ga0068857_100062619
359 Ga0068856_100149187
360 Ga0070702_100072528
361 Ga0068864_100025964
362 Ga0068864_100214225
363 Ga0068861_100018847
364 Ga0068870_10018479
365 Ga0068863_100025845
366 Ga0068863_100165750
367 Ga0068858_100130010
368 Ga0068860_100042026
369 Ga0068860_100175335
370 Ga0068862_100015711
371 Ga0081538_10000884
372 Ga0081538_10081369
373 Ga0070717_10004784
374 Ga0075365_10223612
375 Ga0075432_10011855
376 Ga0070712_100038619
377 Ga0097621_100099928
378 Ga0075428_100123122
379 Ga0075430_100000015
380 Ga0075431_100000478
381 Ga0075433_10045995
382 Ga0075434_100027297
383 Ga0075434_100300237
384 Ga0075435_100002861
385 Ga0105251_10086464
386 Ga0111539_10050506
387 Ga0105245_10002193
388 Ga0105245_10028686
389 Ga0114129_10028979
390 Ga0114129_10157967
391 Ga0114129_10192526
392 Ga0114129_10484093
393 Ga0114129_10604594
394 Ga0114129_10664467
395 Ga0114129_10665713
396 Ga0105243_10080920
397 Ga0105241_10076623
398 Ga0105242_10419024
399 Ga0105248_10057811
400 Ga0105249_10014070
401 Ga0105246_10032270
402 Ga0157374_10117556
403 Ga0163162_10129338
404 Ga0163163_10127370
405 Ga0207682_10061771
406 Ga0207680_10029624
407 Ga0207647_10057279
408 Ga0207645_10207567
409 Ga0207705_10000038
410 Ga0207684_10001521
411 Ga0207684_10003539
412 Ga0207684_10012014
413 Ga0207684_10028958
414 Ga0207684_10074446
415 Ga0207693_10064562
416 Ga0207646_10009828
417 Ga0207659_10184298
418 Ga0207700_10295716
419 Ga0207706_10000259
420 Ga0207686_10109469
421 Ga0207709_10055123
422 Ga0207691_10020393
423 Ga0207711_10022156
424 Ga0207711_10107636
425 Ga0207689_10001685
426 Ga0207667_10255092
427 Ga0207651_10000047
428 Ga0207651_10146495
429 Ga0207651_10209052
430 Ga0207712_10085453
431 Ga0207712_10206421
432 Ga0207668_10023707
433 Ga0207703_10022045
434 Ga0207678_10163500
435 Ga0207702_10121117
436 Ga0207641_10065149
437 Ga0207648_10010951
438 Ga0207676_10041283
439 Ga0207674_10071281
440 Ga0207674_10173055
441 Ga0207674_10329421
442 Ga0207675_100001861
443 Ga0207675_100073094
444 Ga0207683_10001828
445 Ga0207428_10086513
446 Ga0207428_10161425
447 Ga0268266_10049725
448 Ga0268265_10074054
449 Ga0268264_10018596
450 Ga0268264_10384269
451 Ga0265318_10011501
452 Ga0265318_10024815
453 Ga0307517_10124063
454 Ga0265327_10006304
455 Ga0307408_100012983
456 Ga0307405_10005263
457 Ga0307405_10035959
458 Ga0307413_10005927
459 Ga0307410_10000446
460 Ga0307410_10157203
461 Ga0307406_10008707
462 Ga0307407_10065673
463 Ga0307407_10074504
464 Ga0307409_100006495
465 Ga0307409_100006864
466 Ga0307409_100322472
467 Ga0307416_100005272
468 Ga0307416_100272180
469 Ga0307414_10006858
470 Ga0307411_10015432
471 Ga0307415_100000426
472 Ga0307415_100000950
473 Ga0307415_100006147
474 Ga0373945_0013937
475 Ga0373954_0062254
476 Ga0373943_0007400
477 Ga0373946_0017153
478 Ga0373946_0037886
479 Ga0373935_0141979
480 Ga0373935_0176997
481 Ga0373927_0006846
482 Ga0373947_0009376
483 Ga0373925_0020208
484 Ga0373925_0050704
485 Ga0395899_0060235
486 Ga0395900_0018815
487 Ga0395900_0035625
488 Ga0395898_0447640
489 Ga0395905_0004729
490 Ga0395905_0005431
491 Ga0395905_0126407
492 Ga0395905_0263445
493 Ga0436364_1403761
494 Ga0395901_0002280
495 Ga0395901_0018723
496 Ga0395901_0048108
497 Ga0439460_0039241
498 Ga0439440_0005768
499 Ga0466960_0031862
500 Ga0451576_0218634
501 Ga0451576_0230252
502 Ga0451576_0231375
503 Ga0466967_0050347
504 Ga0495627_012028
505 Ga0495603_0015270
506 Ga0495603_0053083
507 Ga0495580_0000002
508 Ga0495580_0126279
509 Ga0495605_0009629
510 Ga0495664_0064728
511 Ga0495584_0000016
512 Ga0495584_0015988
513 Ga0495584_0027060
514 Ga0495584_0030970
515 Ga0495585_0000048
516 Ga0495585_0000746
517 Ga0495585_0002201
518 Ga0495585_0005384
519 Ga0495585_0031191
520 Ga0495585_0048060
521 Ga0495594_0047504
522 Ga0495596_0026356
523 Ga0495596_0029448
524 Ga0495596_0060981
525 Ga0495607_0002698
526 Ga0495607_0026285
527 Ga0495607_0063289
528 Ga0495583_0021487
529 Ga0495606_0010077
530 Ga0495616_0010128
531 Ga0495616_0036519
532 Ga0495620_0009801
533 Ga0495630_0119576
534 Ga0495631_0000837
535 Ga0495631_0025965
536 Ga0495631_0037690
537 Ga0495644_0000688
538 Ga0495642_0006881
539 Ga0495642_0028371
540 Ga0495665_0002388
541 Ga0495609_0012220
542 Ga0495609_0037953
543 Ga0495597_0069380
544 Ga0495622_0001683
545 Ga0495622_0009539
546 Ga0495622_0141416
547 Ga0495633_0003395
548 Ga0495633_0004792
549 Ga0495633_0008790
550 Ga0495656_0003496
551 Ga0495656_0021674
552 Ga0495668_0007998
553 Ga0495611_0000010
554 Ga0495611_0000156
555 Ga0495611_0004738
556 Ga0495611_0007083
557 Ga0495625_0027118
558 Ga0495661_0000839
559 Ga0495661_0005039
560 Ga0495661_0016908
561 Ga0495661_0036602
562 Ga0495661_0097711
563 Ga0495661_0098334
564 Ga0495588_0001550
565 Ga0495588_0013071
566 Ga0495658_0002396
567 Ga0495669_0011835
568 Ga0495624_0034553
569 Ga0495670_0000180
570 Ga0495670_0001782
571 Ga0495670_0102052
572 Ga0495671_0000715
573 Ga0495671_0014618
574 Ga0495671_0025074
575 Ga0495649_0010352
576 Ga0495649_0012192
577 Ga0495589_0002793
578 Ga0495581_0005371
579 Ga0495581_0007718
580 Ga0495604_0023406
581 Ga0495672_0001143
582 Ga0495676_0000007
583 Ga0495676_0053593
584 Ga0495677_0000989
585 Ga0495677_0001036
586 Ga0495677_0014875
587 Ga0495679_036664
588 Ga0495681_0000658
589 Ga0495626_0002442
590 Ga0495626_0038282
591 Ga0496102_0077855
592 Ga0496102_0119208
593 Ga0496108_0114722
594 Ga0496109_0085749
595 Ga0496112_0128130
596 Ga0495682_0000187
597 Ga0501235_019703
598 nmdc:mga0k408_108755_c1
599 nmdc:mga05p37_255204_c1
600 nmdc:mga05p37_321963_c1
601 nmdc:mga05p37_381852_c1
602 nmdc:mga05p37_83229_c1
603 nmdc:mga09592_20128_c1
604 nmdc:mga09592_211171_c1
605 nmdc:mga0qj67_168_c1
606 nmdc:mga0qj67_97_c1
607 nmdc:mga06r32_243627_c1
608 nmdc:mga06r32_24495_c1
609 nmdc:mga06r32_569_c1
610 nmdc:mga0n895_10813_c1
611 nmdc:mga0n895_23836_c1
612 nmdc:mga0n895_250863_c1
613 nmdc:mga0n895_42158_c1
614 nmdc:mga0rr50_84544_c1
615 nmdc:mga08x19_50969_c2
616 nmdc:mga0a205_16292_c1
617 nmdc:mga0a205_209471_c1
618 nmdc:mga0a205_27530_c1
619 nmdc:mga0a205_5719_c1
620 Ga0587066_009484
621 Ga0587067_013777
622 2919405527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17991

Thioredoxin_10

Thioredoxin like C-terminal domain

195

339

0.97

PF00578

AhpC-TSA

AhpC/TSA family

29

146

0.93

PF08534

Redoxin

Redoxin

24

163

0.88

PF13905

Thioredoxin_8

Thioredoxin-like

48

143

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eyt-assembly1.cif.gz_B crystal structure of thioredoxin-like superfamily protein spoa0173 0.9122 11 152
2b5y-assembly1.cif.gz_A solution structure of a thioredoxin-like protein in the oxidized form 0.9052 12 154
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9026 13 152
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8985 11 151
2hyx-assembly1.cif.gz_B structure of the c-terminal domain of dipz from mycobacterium tuberculosis 0.8974 10 329
ID Description Score Start End Superfamily
af_Q9W5T4_48_199_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9602 22 153 3.40.30.10
af_Q8BZW8_26_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9518 11 153 3.40.30.10
af_Q8VZ10_367_538_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9457 9 153 3.40.30.10
af_P9WG63_364_563_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9249 7 168 3.40.30.10
2b5yA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9052 12 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F8ST24-F1-model_v4 Uncharacterized protein 1.002 59 152
AF-A0A529ME08-F1-model_v4 Redoxin domain-containing protein 0.9999 33 114 GO:0016491
AF-A0A7Y7XJH9-F1-model_v4 Thioredoxin family protein 0.9994 13 156 GO:0016209
GO:0016491
AF-A0A0U5DK99-F1-model_v4 deleted 0.9992 39 152
AF-A0A7W1E6A8-F1-model_v4 Cytochrome c biogenesis protein DipZ 0.999 10 156 GO:0005886
GO:0016209
GO:0016491
GO:0017004

Map