F401058

General Info

Members Datasets Scaffolds Average Seq Length
311 158 622 72

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100530176|Ga0068868_1005301761
Length 77
Sequence MTRMVQLTVVGDIAEAEEIQSLLASAGIESQVETAVEHHPAATENAPQKVFVPEGDLESALDAIEALTEPDELTAEP

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
54 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
62 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
63 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
67 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
68 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
69 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
70 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 3.22
Rhizosphere 96.46
Stem 0
Stem Tuber 0
Unclassified 19.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100530176 3300005338 Unclassified 1035
2 Ga0070676_11418961 3300005328 Bacteria 533
3 Ga0070680_100967289 3300005336 Unclassified 735
4 Ga0070660_100844058 3300005339 Bacteria 771
5 Ga0070675_101009562 3300005354 Bacteria 764
6 Ga0070708_100278243 3300005445 Bacteria 1575
7 Ga0070706_100051016 3300005467 Bacteria 3817
8 Ga0070706_101112705 3300005467 Bacteria 727
9 Ga0070707_101387769 3300005468 Bacteria 669
10 Ga0070698_100125734 3300005471 Bacteria 2521
11 Ga0070699_100168444 3300005518 Bacteria 1941
12 Ga0068862_101361975 3300005844 Bacteria 712
13 Ga0081455_10058646 3300005937 Bacteria 3255
14 Ga0081455_10370943 3300005937 Bacteria 1003
15 Ga0081538_10129494 3300005981 Bacteria 1190
16 Ga0081538_10354797 3300005981 Unclassified 531
17 Ga0081539_10022691 3300005985 Bacteria 4140
18 Ga0081539_10353466 3300005985 Bacteria 617
19 Ga0070717_10308025 3300006028 Bacteria 1409
20 Ga0075368_10130840 3300006042 Unclassified 1043
21 Ga0075432_10106152 3300006058 Unclassified 1042
22 Ga0075434_100428062 3300006871 Archaea 1345
23 Ga0075434_101202144 3300006871 Bacteria 770
24 Ga0075429_100356065 3300006880 Bacteria 1281
25 Ga0075436_100067950 3300006914 Bacteria 2462
26 Ga0075436_100189729 3300006914 Unclassified 1454
27 Ga0075436_100850387 3300006914 Bacteria 681
28 Ga0105245_11135294 3300009098 Unclassified 828
29 Ga0114129_10030295 3300009147 Bacteria 7659
30 Ga0114129_10605482 3300009147 Bacteria 1419
31 Ga0114129_10746151 3300009147 Bacteria 1254
32 Ga0114129_11550191 3300009147 Bacteria 813
33 Ga0105248_10380136 3300009177 Unclassified 1590
34 Ga0105249_11232624 3300009553 Bacteria 819
35 Ga0105239_10431721 3300010375 Bacteria 1493
36 Ga0157369_11773099 3300013105 Bacteria 627
37 Ga0157374_11798146 3300013296 Unclassified 638
38 Ga0163162_10650527 3300013306 Bacteria 1178
39 Ga0207688_10941058 3300025901 Unclassified 547
40 Ga0207684_10681587 3300025910 Bacteria 874
41 Ga0207707_11383813 3300025912 Bacteria 562
42 Ga0207663_11213335 3300025916 Bacteria 607
43 Ga0207652_11001278 3300025921 Bacteria 734
44 Ga0207646_10700516 3300025922 Bacteria 906
45 Ga0207687_11324924 3300025927 Unclassified 619
46 Ga0207664_10432884 3300025929 Bacteria 1173
47 Ga0207711_10208504 3300025941 Unclassified 1785
48 Ga0207675_100106174 3300026118 Bacteria 2648
49 Ga0209983_1018534 3300027665 Bacteria 1446
50 Ga0209966_1003416 3300027695 Bacteria 2671
51 Ga0207428_10014471 3300027907 Bacteria 6853
52 Ga0265326_10126102 3300028558 Bacteria 729
53 Ga0265338_10034562 3300028800 Bacteria 4882
54 Ga0265324_10289516 3300029957 Bacteria 557
55 Ga0307408_100605963 3300031548 Bacteria 974
56 Ga0307405_10564682 3300031731 Bacteria 923
57 Ga0307406_10475011 3300031901 Bacteria 1008
58 Ga0307407_10461601 3300031903 Bacteria 924
59 Ga0307412_12240738 3300031911 Bacteria 509
60 Ga0307409_100075781 3300031995 Bacteria 2695
61 Ga0307409_100313328 3300031995 Bacteria 1465
62 Ga0307409_100347743 3300031995 Bacteria 1398
63 Ga0307409_102339631 3300031995 Bacteria 563
64 Ga0307416_100435044 3300032002 Bacteria 1360
65 Ga0307415_101503341 3300032126 Bacteria 644
66 Ga0373949_0129149 3300035090 Unclassified 716
67 Ga0373960_0106822 3300035121 Bacteria 914
68 Ga0395899_0058487 3300037312 Bacteria 2843
69 Ga0395899_0112098 3300037312 Unclassified 1960
70 Ga0395900_0120573 3300037418 Bacteria 2691
71 Ga0395900_0126265 3300037418 Bacteria 2624
72 Ga0395900_0129648 3300037418 Bacteria 2585
73 Ga0395900_0795476 3300037418 Bacteria 874
74 Ga0395898_0336973 3300037466 Unclassified 1438
75 Ga0395898_0689013 3300037466 Bacteria 964
76 Ga0395898_1614661 3300037466 Unclassified 572
77 Ga0395898_1639058 3300037466 Unclassified 567
78 Ga0395905_0003035 3300037471 Bacteria 18184
79 Ga0395905_0520218 3300037471 Bacteria 1090
80 Ga0395905_0530937 3300037471 Bacteria 1077
81 Ga0395905_1041605 3300037471 Unclassified 721
82 Ga0395901_0114142 3300038443 Unclassified 2837
83 Ga0395901_0202688 3300038443 Bacteria 2079
84 Ga0395901_1130809 3300038443 Bacteria 752
85 Ga0395901_1644217 3300038443 Unclassified 595
86 Ga0439439_0136971 3300041406 Bacteria 690
87 Ga0439453_0035333 3300041408 Bacteria 962
88 Ga0439461_0007161 3300041410 Bacteria 1966
89 Ga0439466_0153840 3300041411 Bacteria 704
90 Ga0439466_0190744 3300041411 Bacteria 624
91 Ga0439448_0010108 3300042005 Bacteria 2790
92 Ga0439450_015246 3300042008 Bacteria 1571
93 Ga0439451_003849 3300042009 Bacteria 3050
94 Ga0439454_000655 3300042011 Bacteria 2904
95 Ga0439455_0044822 3300042012 Bacteria 1142
96 Ga0439463_057720 3300042016 Bacteria 992
97 Ga0439446_0012442 3300042156 Bacteria 2324
98 Ga0439458_0007874 3300042157 Bacteria 2370
99 Ga0450909_041676 3300042185 Bacteria 707
100 Ga0439434_0016792 3300042435 Bacteria 2188
101 Ga0466963_0002006 3300044694 Bacteria 11187
102 Ga0466957_0024215 3300044842 Bacteria 3591
103 Ga0466958_0012762 3300045836 Bacteria 4765
104 Ga0466967_0018440 3300045976 Bacteria 5577
105 Ga0466967_0803392 3300045976 Bacteria 934
106 Ga0466967_1856900 3300045976 Bacteria 599
107 Ga0495592_0001047 3300046454 Bacteria 19192
108 Ga0495651_0607335 3300046462 Bacteria 689
109 Ga0495651_0663379 3300046462 Bacteria 653
110 Ga0495653_0399883 3300046463 Bacteria 873
111 Ga0495664_0694631 3300046477 Bacteria 601
112 Ga0495607_0363191 3300046501 Unclassified 666
113 Ga0495608_0223909 3300046511 Unclassified 1179
114 Ga0495618_0073835 3300046514 Unclassified 2172
115 Ga0495628_0463169 3300046516 Bacteria 919
116 Ga0495663_0023697 3300046525 Bacteria 1780
117 Ga0495642_0135660 3300046528 Bacteria 1061
118 Ga0495652_0726231 3300046529 Bacteria 666
119 Ga0495587_0334012 3300046536 Bacteria 846
120 Ga0495598_0435690 3300046537 Unclassified 517
121 Ga0495667_0164079 3300046559 Bacteria 1428
122 Ga0495667_0184388 3300046559 Unclassified 1338
123 Ga0495634_0465330 3300046642 Bacteria 744
124 Ga0495635_0044308 3300046663 Bacteria 3070
125 Ga0495659_0160389 3300046664 Bacteria 908
126 Ga0495657_0164922 3300046675 Bacteria 1368
127 Ga0495646_0273139 3300046680 Bacteria 900
128 Ga0495658_0109856 3300046683 Bacteria 1657
129 Ga0495613_0144089 3300046689 Unclassified 1701
130 Ga0495589_0238019 3300046794 Bacteria 852
131 Ga0495589_0320621 3300046794 Bacteria 716
132 Ga0495600_0286901 3300046809 Unclassified 1041
133 Ga0495604_0110430 3300047317 Bacteria 2006
134 Ga0495674_0528057 3300047319 Unclassified 941
135 Ga0495674_0555246 3300047319 Bacteria 914
136 Ga0495680_0013209 3300047322 Bacteria 7214
137 Ga0495680_0154066 3300047322 Bacteria 1673
138 Ga0495675_0536068 3300047444 Bacteria 669
139 Ga0495675_0737522 3300047444 Bacteria 549
140 Ga0495684_0477071 3300047471 Unclassified 862
141 Ga0495684_0904103 3300047471 Bacteria 568
142 Ga0495684_0992050 3300047471 Bacteria 534
143 Ga0495593_0311120 3300047673 Bacteria 787
144 Ga0496102_0423201 3300048905 Bacteria 1251
145 Ga0496102_1974561 3300048905 Bacteria 500
146 Ga0496103_0569310 3300048906 Bacteria 723
147 Ga0496104_0089275 3300048907 Bacteria 2945
148 Ga0496104_0845080 3300048907 Bacteria 821
149 Ga0496104_1274702 3300048907 Bacteria 638
150 Ga0496108_0318084 3300048911 Bacteria 1357
151 Ga0496108_0642492 3300048911 Bacteria 923
152 Ga0496110_1368381 3300048913 Bacteria 617
153 Ga0496111_0956489 3300048914 Bacteria 615
154 Ga0501031_0000181 3300049568 Bacteria 35725
155 Ga0501031_0025119 3300049568 Bacteria 3886
156 Ga0501031_0047313 3300049568 Bacteria 2804
157 Ga0501031_0245841 3300049568 Bacteria 1163
158 Ga0501031_0297958 3300049568 Bacteria 1045
159 Ga0501031_0657074 3300049568 Unclassified 674
160 Ga0501032_0482758 3300049569 Bacteria 793
161 Ga0501033_0534816 3300049570 Bacteria 808
162 Ga0501033_1096373 3300049570 Bacteria 530
163 Ga0501034_0621034 3300049571 Bacteria 985
164 Ga0501036_0082187 3300049572 Bacteria 2722
165 Ga0501036_0127211 3300049572 Bacteria 2152
166 Ga0501036_0381577 3300049572 Bacteria 1176
167 Ga0501036_0560446 3300049572 Bacteria 949
168 Ga0501036_1550975 3300049572 Unclassified 535
169 Ga0501037_0016300 3300049573 Bacteria 5470
170 Ga0501037_0990268 3300049573 Bacteria 548
171 Ga0501038_0091310 3300049574 Bacteria 2551
172 Ga0501038_0120472 3300049574 Unclassified 2165
173 Ga0501039_0131232 3300049575 Bacteria 1966
174 Ga0501039_0277399 3300049575 Unclassified 1318
175 Ga0501039_0279245 3300049575 Unclassified 1313
176 Ga0501039_0560125 3300049575 Bacteria 897
177 Ga0501040_0054078 3300049576 Bacteria 2752
178 Ga0501040_0147185 3300049576 Bacteria 1660
179 Ga0501040_0620903 3300049576 Bacteria 781
180 Ga0501040_0849037 3300049576 Unclassified 661
181 Ga0501040_1058460 3300049576 Bacteria 588
182 Ga0501041_0151363 3300049577 Bacteria 1449
183 Ga0501041_0319401 3300049577 Bacteria 979
184 Ga0501041_0471255 3300049577 Unclassified 798
185 Ga0501041_0559276 3300049577 Unclassified 729
186 Ga0501041_0591488 3300049577 Bacteria 708
187 Ga0501042_0031226 3300049578 Bacteria 3769
188 Ga0501042_0041111 3300049578 Bacteria 3287
189 Ga0501042_0075033 3300049578 Bacteria 2420
190 Ga0501042_0078218 3300049578 Archaea 2369
191 Ga0501042_0295637 3300049578 Unclassified 1170
192 Ga0501042_0543363 3300049578 Bacteria 844
193 Ga0501042_0623373 3300049578 Bacteria 784
194 Ga0501043_0067818 3300049579 Bacteria 2801
195 Ga0501043_0217779 3300049579 Bacteria 1478
196 Ga0501043_0804959 3300049579 Unclassified 679
197 Ga0501046_0069385 3300049580 Bacteria 2742
198 Ga0501046_0369612 3300049580 Bacteria 1039
199 Ga0501047_0087334 3300049581 Bacteria 2996
200 Ga0501048_0005144 3300049582 Bacteria 9966
201 Ga0501048_0019824 3300049582 Bacteria 4931
202 Ga0501067_0126679 3300049583 Bacteria 1421
203 Ga0501068_0088896 3300049584 Bacteria 1904
204 Ga0501069_0137702 3300049585 Bacteria 1399
205 Ga0501069_0229138 3300049585 Unclassified 1081
206 Ga0501069_0813609 3300049585 Unclassified 567
207 Ga0501070_0008749 3300049586 Bacteria 8561
208 Ga0501071_0064936 3300049587 Bacteria 2649
209 Ga0501071_0203873 3300049587 Bacteria 1486
210 Ga0501071_0303655 3300049587 Unclassified 1210
211 Ga0501071_0503156 3300049587 Bacteria 929
212 Ga0501071_1044331 3300049587 Bacteria 631
213 Ga0501071_1135975 3300049587 Unclassified 603
214 Ga0501072_0014652 3300049588 Bacteria 6010
215 Ga0501072_0068290 3300049588 Bacteria 2806
216 Ga0501072_0121048 3300049588 Bacteria 2085
217 Ga0501072_0336592 3300049588 Bacteria 1199
218 Ga0501073_0005882 3300049589 Bacteria 9154
219 Ga0501073_1082942 3300049589 Bacteria 551
220 Ga0501074_0189958 3300049590 Unclassified 1465
221 Ga0501074_0484540 3300049590 Bacteria 876
222 Ga0501074_1251401 3300049590 Bacteria 520
223 Ga0501075_0071731 3300049591 Bacteria 2618
224 Ga0501075_0098488 3300049591 Archaea 2220
225 Ga0501075_0178323 3300049591 Bacteria 1621
226 Ga0501075_0417976 3300049591 Bacteria 1022
227 Ga0501075_0423474 3300049591 Bacteria 1015
228 Ga0501075_0625739 3300049591 Unclassified 821
229 Ga0501075_0695646 3300049591 Bacteria 774
230 Ga0501076_0026024 3300049592 Bacteria 4528
231 Ga0501076_0050976 3300049592 Bacteria 3275
232 Ga0501076_0194962 3300049592 Bacteria 1653
233 Ga0501076_0232348 3300049592 Unclassified 1508
234 Ga0501076_0295562 3300049592 Bacteria 1327
235 Ga0501076_0650872 3300049592 Bacteria 870
236 Ga0501076_0800685 3300049592 Bacteria 777
237 Ga0501076_0956771 3300049592 Bacteria 706
238 Ga0501076_1110807 3300049592 Unclassified 651
239 Ga0501076_1553943 3300049592 Bacteria 543
240 Ga0501077_0112537 3300049593 Bacteria 1725
241 Ga0501077_0363978 3300049593 Bacteria 923
242 Ga0501079_0345751 3300049741 Bacteria 1165
243 Ga0501079_0604414 3300049741 Unclassified 863
244 Ga0501079_0656899 3300049741 Bacteria 825
245 Ga0501079_0783654 3300049741 Bacteria 750
246 Ga0501079_0898364 3300049741 Unclassified 698
247 Ga0501079_1291210 3300049741 Bacteria 575
248 Ga0501080_0150838 3300049742 Bacteria 2148
249 Ga0501080_0317433 3300049742 Bacteria 1411
250 Ga0501080_1772743 3300049742 Bacteria 519
251 Ga0501081_0007162 3300049743 Bacteria 7251
252 Ga0501081_0063637 3300049743 Bacteria 2560
253 Ga0501081_0096141 3300049743 Bacteria 2089
254 Ga0501081_0272894 3300049743 Bacteria 1237
255 Ga0501081_0687242 3300049743 Bacteria 768
256 Ga0501081_0831476 3300049743 Bacteria 695
257 Ga0501083_0038903 3300049744 Bacteria 3232
258 Ga0501035_0012070 3300049822 Bacteria 7989
259 Ga0501035_0349811 3300049822 Bacteria 1237
260 Ga0501035_1480878 3300049822 Bacteria 518
261 Ga0501045_0170009 3300049824 Bacteria 1623
262 Ga0501045_0187721 3300049824 Bacteria 1540
263 Ga0501045_0331072 3300049824 Unclassified 1133
264 Ga0501045_0894350 3300049824 Bacteria 652
265 Ga0501045_1185711 3300049824 Bacteria 557
266 nmdc:mga05p37_106190_c1 3300050507 Bacteria 3454
267 nmdc:mga05p37_1284269_c1 3300050507 Bacteria 748
268 nmdc:mga05p37_19675_c1 3300050507 Bacteria 8168
269 nmdc:mga05p37_20308_c1 3300050507 Bacteria 8037
270 nmdc:mga09592_852085_c1 3300050508 Bacteria 768
271 nmdc:mga06r32_438298_c1 3300050510 Unclassified 1287
272 nmdc:mga0n895_10843_c1 3300050512 Bacteria 8088
273 nmdc:mga0rr50_873918_c1 3300050513 Bacteria 767
274 nmdc:mga08x19_1304540_c1 3300050514 Bacteria 514
275 nmdc:mga08x19_162722_c1 3300050514 Unclassified 1516
276 nmdc:mga08x19_24074_c1 3300050514 Bacteria 3781
277 nmdc:mga08x19_798824_c1 3300050514 Bacteria 670
278 nmdc:mga08x19_828026_c1 3300050514 Bacteria 657
279 nmdc:mga08x19_909648_c1 3300050514 Unclassified 625
280 nmdc:mga0a205_666045_c1 3300050515 Bacteria 892
281 Ga0495601_0138229 3300053077 Bacteria 1589
282 Ga0495601_0193051 3300053077 Unclassified 1331
283 Ga0495595_0100758 3300053084 Bacteria 1394
284 Ga0495595_0111252 3300053084 Bacteria 1328
285 Ga0495595_0240010 3300053084 Bacteria 906
286 Ga0495619_0059359 3300053085 Bacteria 2541
287 Ga0495619_0497530 3300053085 Bacteria 838
288 Ga0501084_0013352 3300054114 Bacteria 6795
289 Ga0501084_0046994 3300054114 Bacteria 3615
290 Ga0501084_0107885 3300054114 Unclassified 2339
291 Ga0501084_0123670 3300054114 Bacteria 2176
292 Ga0501084_0234747 3300054114 Unclassified 1548
293 Ga0501084_0671976 3300054114 Bacteria 874
294 Ga0590075_053161 3300059424 Bacteria 1040
295 Ga0590075_119378 3300059424 Bacteria 690
296 Ga0501082_0011687 3300060353 Bacteria 7547
297 Ga0501082_0069377 3300060353 Bacteria 3034
298 Ga0501082_0097997 3300060353 Bacteria 2535
299 Ga0501082_0159007 3300060353 Bacteria 1963
300 Ga0501082_0320036 3300060353 Unclassified 1351
301 Ga0501082_0454452 3300060353 Bacteria 1119
302 Ga0501082_1332553 3300060353 Unclassified 627
303 Ga0501082_1502233 3300060353 Unclassified 588
304 Ga0501082_1898349 3300060353 Bacteria 519
305 Ga0530510_0047298 3300061734 Bacteria 3108
306 Ga0530510_0234524 3300061734 Unclassified 1365
307 Ga0530510_0445798 3300061734 Bacteria 978
308 Ga0530510_0531839 3300061734 Bacteria 892
309 Ga0530510_1006577 3300061734 Bacteria 638
310 Ga0530510_1478586 3300061734 Archaea 522
311 Ga0530510_1479655 3300061734 Unclassified 521
312 Ga0068868_100530176
313 Ga0070676_11418961
314 Ga0070680_100967289
315 Ga0070660_100844058
316 Ga0070675_101009562
317 Ga0070708_100278243
318 Ga0070706_100051016
319 Ga0070706_101112705
320 Ga0070707_101387769
321 Ga0070698_100125734
322 Ga0070699_100168444
323 Ga0068862_101361975
324 Ga0081455_10058646
325 Ga0081455_10370943
326 Ga0081538_10129494
327 Ga0081538_10354797
328 Ga0081539_10022691
329 Ga0081539_10353466
330 Ga0070717_10308025
331 Ga0075368_10130840
332 Ga0075432_10106152
333 Ga0075434_100428062
334 Ga0075434_101202144
335 Ga0075429_100356065
336 Ga0075436_100067950
337 Ga0075436_100189729
338 Ga0075436_100850387
339 Ga0105245_11135294
340 Ga0114129_10030295
341 Ga0114129_10605482
342 Ga0114129_10746151
343 Ga0114129_11550191
344 Ga0105248_10380136
345 Ga0105249_11232624
346 Ga0105239_10431721
347 Ga0157369_11773099
348 Ga0157374_11798146
349 Ga0163162_10650527
350 Ga0207688_10941058
351 Ga0207684_10681587
352 Ga0207707_11383813
353 Ga0207663_11213335
354 Ga0207652_11001278
355 Ga0207646_10700516
356 Ga0207687_11324924
357 Ga0207664_10432884
358 Ga0207711_10208504
359 Ga0207675_100106174
360 Ga0209983_1018534
361 Ga0209966_1003416
362 Ga0207428_10014471
363 Ga0265326_10126102
364 Ga0265338_10034562
365 Ga0265324_10289516
366 Ga0307408_100605963
367 Ga0307405_10564682
368 Ga0307406_10475011
369 Ga0307407_10461601
370 Ga0307412_12240738
371 Ga0307409_100075781
372 Ga0307409_100313328
373 Ga0307409_100347743
374 Ga0307409_102339631
375 Ga0307416_100435044
376 Ga0307415_101503341
377 Ga0373949_0129149
378 Ga0373960_0106822
379 Ga0395899_0058487
380 Ga0395899_0112098
381 Ga0395900_0120573
382 Ga0395900_0126265
383 Ga0395900_0129648
384 Ga0395900_0795476
385 Ga0395898_0336973
386 Ga0395898_0689013
387 Ga0395898_1614661
388 Ga0395898_1639058
389 Ga0395905_0003035
390 Ga0395905_0520218
391 Ga0395905_0530937
392 Ga0395905_1041605
393 Ga0395901_0114142
394 Ga0395901_0202688
395 Ga0395901_1130809
396 Ga0395901_1644217
397 Ga0439439_0136971
398 Ga0439453_0035333
399 Ga0439461_0007161
400 Ga0439466_0153840
401 Ga0439466_0190744
402 Ga0439448_0010108
403 Ga0439450_015246
404 Ga0439451_003849
405 Ga0439454_000655
406 Ga0439455_0044822
407 Ga0439463_057720
408 Ga0439446_0012442
409 Ga0439458_0007874
410 Ga0450909_041676
411 Ga0439434_0016792
412 Ga0466963_0002006
413 Ga0466957_0024215
414 Ga0466958_0012762
415 Ga0466967_0018440
416 Ga0466967_0803392
417 Ga0466967_1856900
418 Ga0495592_0001047
419 Ga0495651_0607335
420 Ga0495651_0663379
421 Ga0495653_0399883
422 Ga0495664_0694631
423 Ga0495607_0363191
424 Ga0495608_0223909
425 Ga0495618_0073835
426 Ga0495628_0463169
427 Ga0495663_0023697
428 Ga0495642_0135660
429 Ga0495652_0726231
430 Ga0495587_0334012
431 Ga0495598_0435690
432 Ga0495667_0164079
433 Ga0495667_0184388
434 Ga0495634_0465330
435 Ga0495635_0044308
436 Ga0495659_0160389
437 Ga0495657_0164922
438 Ga0495646_0273139
439 Ga0495658_0109856
440 Ga0495613_0144089
441 Ga0495589_0238019
442 Ga0495589_0320621
443 Ga0495600_0286901
444 Ga0495604_0110430
445 Ga0495674_0528057
446 Ga0495674_0555246
447 Ga0495680_0013209
448 Ga0495680_0154066
449 Ga0495675_0536068
450 Ga0495675_0737522
451 Ga0495684_0477071
452 Ga0495684_0904103
453 Ga0495684_0992050
454 Ga0495593_0311120
455 Ga0496102_0423201
456 Ga0496102_1974561
457 Ga0496103_0569310
458 Ga0496104_0089275
459 Ga0496104_0845080
460 Ga0496104_1274702
461 Ga0496108_0318084
462 Ga0496108_0642492
463 Ga0496110_1368381
464 Ga0496111_0956489
465 Ga0501031_0000181
466 Ga0501031_0025119
467 Ga0501031_0047313
468 Ga0501031_0245841
469 Ga0501031_0297958
470 Ga0501031_0657074
471 Ga0501032_0482758
472 Ga0501033_0534816
473 Ga0501033_1096373
474 Ga0501034_0621034
475 Ga0501036_0082187
476 Ga0501036_0127211
477 Ga0501036_0381577
478 Ga0501036_0560446
479 Ga0501036_1550975
480 Ga0501037_0016300
481 Ga0501037_0990268
482 Ga0501038_0091310
483 Ga0501038_0120472
484 Ga0501039_0131232
485 Ga0501039_0277399
486 Ga0501039_0279245
487 Ga0501039_0560125
488 Ga0501040_0054078
489 Ga0501040_0147185
490 Ga0501040_0620903
491 Ga0501040_0849037
492 Ga0501040_1058460
493 Ga0501041_0151363
494 Ga0501041_0319401
495 Ga0501041_0471255
496 Ga0501041_0559276
497 Ga0501041_0591488
498 Ga0501042_0031226
499 Ga0501042_0041111
500 Ga0501042_0075033
501 Ga0501042_0078218
502 Ga0501042_0295637
503 Ga0501042_0543363
504 Ga0501042_0623373
505 Ga0501043_0067818
506 Ga0501043_0217779
507 Ga0501043_0804959
508 Ga0501046_0069385
509 Ga0501046_0369612
510 Ga0501047_0087334
511 Ga0501048_0005144
512 Ga0501048_0019824
513 Ga0501067_0126679
514 Ga0501068_0088896
515 Ga0501069_0137702
516 Ga0501069_0229138
517 Ga0501069_0813609
518 Ga0501070_0008749
519 Ga0501071_0064936
520 Ga0501071_0203873
521 Ga0501071_0303655
522 Ga0501071_0503156
523 Ga0501071_1044331
524 Ga0501071_1135975
525 Ga0501072_0014652
526 Ga0501072_0068290
527 Ga0501072_0121048
528 Ga0501072_0336592
529 Ga0501073_0005882
530 Ga0501073_1082942
531 Ga0501074_0189958
532 Ga0501074_0484540
533 Ga0501074_1251401
534 Ga0501075_0071731
535 Ga0501075_0098488
536 Ga0501075_0178323
537 Ga0501075_0417976
538 Ga0501075_0423474
539 Ga0501075_0625739
540 Ga0501075_0695646
541 Ga0501076_0026024
542 Ga0501076_0050976
543 Ga0501076_0194962
544 Ga0501076_0232348
545 Ga0501076_0295562
546 Ga0501076_0650872
547 Ga0501076_0800685
548 Ga0501076_0956771
549 Ga0501076_1110807
550 Ga0501076_1553943
551 Ga0501077_0112537
552 Ga0501077_0363978
553 Ga0501079_0345751
554 Ga0501079_0604414
555 Ga0501079_0656899
556 Ga0501079_0783654
557 Ga0501079_0898364
558 Ga0501079_1291210
559 Ga0501080_0150838
560 Ga0501080_0317433
561 Ga0501080_1772743
562 Ga0501081_0007162
563 Ga0501081_0063637
564 Ga0501081_0096141
565 Ga0501081_0272894
566 Ga0501081_0687242
567 Ga0501081_0831476
568 Ga0501083_0038903
569 Ga0501035_0012070
570 Ga0501035_0349811
571 Ga0501035_1480878
572 Ga0501045_0170009
573 Ga0501045_0187721
574 Ga0501045_0331072
575 Ga0501045_0894350
576 Ga0501045_1185711
577 nmdc:mga05p37_106190_c1
578 nmdc:mga05p37_1284269_c1
579 nmdc:mga05p37_19675_c1
580 nmdc:mga05p37_20308_c1
581 nmdc:mga09592_852085_c1
582 nmdc:mga06r32_438298_c1
583 nmdc:mga0n895_10843_c1
584 nmdc:mga0rr50_873918_c1
585 nmdc:mga08x19_1304540_c1
586 nmdc:mga08x19_162722_c1
587 nmdc:mga08x19_24074_c1
588 nmdc:mga08x19_798824_c1
589 nmdc:mga08x19_828026_c1
590 nmdc:mga08x19_909648_c1
591 nmdc:mga0a205_666045_c1
592 Ga0495601_0138229
593 Ga0495601_0193051
594 Ga0495595_0100758
595 Ga0495595_0111252
596 Ga0495595_0240010
597 Ga0495619_0059359
598 Ga0495619_0497530
599 Ga0501084_0013352
600 Ga0501084_0046994
601 Ga0501084_0107885
602 Ga0501084_0123670
603 Ga0501084_0234747
604 Ga0501084_0671976
605 Ga0590075_053161
606 Ga0590075_119378
607 Ga0501082_0011687
608 Ga0501082_0069377
609 Ga0501082_0097997
610 Ga0501082_0159007
611 Ga0501082_0320036
612 Ga0501082_0454452
613 Ga0501082_1332553
614 Ga0501082_1502233
615 Ga0501082_1898349
616 Ga0530510_0047298
617 Ga0530510_0234524
618 Ga0530510_0445798
619 Ga0530510_0531839
620 Ga0530510_1006577
621 Ga0530510_1478586
622 Ga0530510_1479655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8axn-assembly1.cif.gz_a inner membrane ring and secretin n0 n1 domains of the type 3 secretion system of shigella flexneri 0.8321 3 70
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.8195 3 70
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8173 3 69
5gv2-assembly1.cif.gz_A crystal structure of arginine-bound castor1 from homo sapiens 0.7896 15 64
5gt7-assembly1.cif.gz_A crystal structure of arg-bound castor1 0.7862 15 65
ID Description Score Start End Superfamily
4d6nF02 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.763 9 57 3.10.28.10
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7454 5 72 3.30.70.2350
af_P9WMR3_600_711_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7325 9 60 3.10.28.10
af_Q9SKA3_290_443_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7304 30 51 2.60.40.150
1zvpB00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7233 13 68 3.30.2130.10
ID Description Score Start End GO Terms
AF-A0A0C1RLI4-F1-model_v4 DUF2007 domain-containing protein 0.8803 2 67
AF-A0A517ZC56-F1-model_v4 DUF2007 domain-containing protein 0.8796 1 67
AF-A0A7C8AEB1-F1-model_v4 DUF2007 domain-containing protein 0.8672 1 68
AF-A0A7C4T4Z5-F1-model_v4 DUF2007 domain-containing protein 0.866 1 67
AF-A0A0J8D9S8-F1-model_v4 DUF2007 domain-containing protein 0.8645 3 65

Map