F400993

General Info

Members Datasets Scaffolds Average Seq Length
310 199 620 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990065138
Length 399
Sequence HLGRSACTHARKALDVNPRTTGYTPSIRIRRHTALRRTAVSLAASAAAVSLAACGVVDVGDSVEASPTKGDDITVGVLFPDKDTKRYEQFDYPNIKKKIAELTDNKGVTEYANAEKDQETQNRQMEQMVEDKVDIIIVDAVDSKTIEPAVQTAHDAGVPVIAYDRLAQGPIDGYVSFDNQLVGQVQGRSLVEDLGDSAANKIVMMNGSTTDPNAAMFKEGALSELQDKVTISETYDTKDWDPAVAKVNMEKAVAKLGIDNIDAVYAANDGIAGAVIDVLKTAGVAKVPPVTGQDADLDAVQRIVSGDQYMTVYKSFPLQASAAAEMAVAKVQGRSIEFDALTTDSIDSPTTKNIPAQLVPPIALTRKNIEDTVIQDGIYTVKQICTSDFKADCDAIDLN

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
54 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
55 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
56 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
57 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
58 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
148 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
152 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
153 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
154 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
155 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
156 2643221647 Streptomyces sp. Root369 Isolate Unclassified
157 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
158 2643221714 Streptomyces sp. Root264 Isolate Unclassified
159 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
160 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
161 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
162 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
163 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
164 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
165 2808606448 Streptomyces sp. 193411 Isolate Unclassified
166 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
167 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
168 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
169 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
170 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
171 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
172 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
173 2867428634 Streptomyces sp. RP5T Isolate Unclassified
174 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
175 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
176 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
177 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
178 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
179 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
180 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
181 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
182 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
183 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
184 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
185 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
186 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
187 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
188 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
189 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
190 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
191 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
192 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
193 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
194 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
195 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
196 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
197 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
198 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
199 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.23
Metatranscriptomes 0
Isolates 16.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0.65
Rhizoplane 0.32
Rhizosphere 76.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10031454 3300001989 Bacteria 1834
2 JGI24737J22298_10005313 3300001990 Bacteria 4455
3 JGI24737J22298_10034763 3300001990 Bacteria 1562
4 JGI24738J21930_10012406 3300002075 Bacteria 1862
5 JGI24738J21930_10013847 3300002075 Bacteria 1737
6 JGI24738J21930_10015645 3300002075 Bacteria 1611
7 rootH1_10060396 3300003316 Bacteria 1482
8 rootH2_10190765 3300003320 Bacteria 1474
9 rootH1_10013761 3300003323 Bacteria 3422
10 Ga0070672_100280646 3300005543 Bacteria 1408
11 Ga0068856_100149294 3300005614 Bacteria 2346
12 Ga0075365_10089853 3300006038 Bacteria 2091
13 Ga0075363_100034006 3300006048 Bacteria 2659
14 Ga0075363_100051834 3300006048 Bacteria 2189
15 Ga0075363_100073605 3300006048 Bacteria 1859
16 Ga0075367_10002824 3300006178 Bacteria 8065
17 Ga0075367_10010958 3300006178 Bacteria 4778
18 Ga0105244_10044889 3300009036 Bacteria 2275
19 Ga0105250_10046547 3300009092 Bacteria 1739
20 Ga0105238_10412846 3300009551 Bacteria 1344
21 Ga0105239_10339904 3300010375 Bacteria 1694
22 Ga0105246_10001464 3300011119 Bacteria 14015
23 Ga0105246_10001948 3300011119 Bacteria 12433
24 Ga0105246_10061221 3300011119 Bacteria 2618
25 Ga0157369_10158604 3300013105 Bacteria 2389
26 Ga0157369_10196808 3300013105 Bacteria 2116
27 Ga0157372_10280590 3300013307 Bacteria 1937
28 Ga0182008_10001422 3300014497 Bacteria 16053
29 Ga0182007_10001972 3300015262 Bacteria 10595
30 Ga0183367_1015 3300015688 Bacteria 298435
31 Ga0209758_1001903 3300025297 Bacteria 22787
32 Ga0207647_10003807 3300025904 Bacteria 11272
33 Ga0207647_10008962 3300025904 Bacteria 7127
34 Ga0207694_10244234 3300025924 Bacteria 1468
35 Ga0207709_10003959 3300025935 Bacteria 8647
36 Ga0207667_10183843 3300025949 Bacteria 2146
37 Ga0207702_10159329 3300026078 Bacteria 2060
38 Ga0209371_1004304 3300027312 Bacteria 6288
39 Ga0209371_1013813 3300027312 Bacteria 2243
40 Ga0209813_10013738 3300027866 Bacteria 2167
41 Ga0268266_10200525 3300028379 Bacteria 1826
42 Ga0307517_10063886 3300028786 Bacteria 3433
43 Ga0307515_10027617 3300028794 Bacteria 9693
44 Ga0307515_10084482 3300028794 Bacteria 4076
45 Ga0307515_10206620 3300028794 Bacteria 1821
46 Ga0268256_1005624 3300030500 Bacteria 4870
47 Ga0268256_1015322 3300030500 Bacteria 2243
48 Ga0307511_10000029 3300030521 Bacteria 108570
49 Ga0307512_10004792 3300030522 Bacteria 14534
50 Ga0307512_10012507 3300030522 Bacteria 8011
51 Ga0307513_10015144 3300031456 Bacteria 9361
52 Ga0307513_10048808 3300031456 Bacteria 4590
53 Ga0307513_10055095 3300031456 Bacteria 4257
54 Ga0307509_10017296 3300031507 Bacteria 8305
55 Ga0307509_10148181 3300031507 Bacteria 2268
56 Ga0307508_10014141 3300031616 Bacteria 7282
57 Ga0307508_10022359 3300031616 Bacteria 5747
58 Ga0307508_10117561 3300031616 Bacteria 2260
59 Ga0307514_10007678 3300031649 Bacteria 9282
60 Ga0307514_10202314 3300031649 Bacteria 1246
61 Ga0307516_10003864 3300031730 Bacteria 18933
62 Ga0307516_10006155 3300031730 Bacteria 14137
63 Ga0307518_10035390 3300031838 Bacteria 3626
64 Ga0307507_10018929 3300033179 Bacteria 7795
65 Ga0307507_10047542 3300033179 Bacteria 4188
66 Ga0307507_10066544 3300033179 Bacteria 3302
67 Ga0307507_10107796 3300033179 Bacteria 2293
68 Ga0307510_10034795 3300033180 Bacteria 5632
69 Ga0307510_10055775 3300033180 Bacteria 4123
70 Ga0307510_10187780 3300033180 Bacteria 1619
71 Ga0395900_0213043 3300037418 Bacteria 1950
72 Ga0395898_0000852 3300037466 Bacteria 50067
73 Ga0395898_0014886 3300037466 Bacteria 7984
74 Ga0395901_0400954 3300038443 Bacteria 1409
75 Ga0439436_0002407 3300041404 Bacteria 5612
76 Ga0439436_0002660 3300041404 Bacteria 5384
77 Ga0439439_0000626 3300041406 Bacteria 6218
78 Ga0451837_1263351 3300041494 Bacteria 3246
79 Ga0451853_0456281 3300041512 Bacteria 1748
80 Ga0439442_009363 3300042002 Bacteria 1983
81 Ga0439448_0002918 3300042005 Bacteria 4688
82 Ga0439455_0016060 3300042012 Bacteria 1727
83 Ga0439457_000082 3300042014 Bacteria 21299
84 Ga0439457_000585 3300042014 Bacteria 10675
85 Ga0439462_0013603 3300042015 Bacteria 2086
86 Ga0450894_000283 3300042131 Bacteria 9098
87 Ga0450906_008678 3300042145 Bacteria 1958
88 Ga0439458_0000086 3300042157 Bacteria 17612
89 Ga0466969_0006971 3300044656 Bacteria 6013
90 Ga0466969_0044103 3300044656 Bacteria 2220
91 Ga0466972_0001544 3300044658 Bacteria 11213
92 Ga0466972_0009961 3300044658 Bacteria 4771
93 Ga0466972_0018875 3300044658 Bacteria 3446
94 Ga0466972_0021848 3300044658 Bacteria 3188
95 Ga0466972_0044898 3300044658 Bacteria 2142
96 Ga0466965_0004390 3300044683 Bacteria 6270
97 Ga0466965_0017627 3300044683 Bacteria 3416
98 Ga0466965_0044149 3300044683 Bacteria 2202
99 Ga0466966_0000860 3300044684 Bacteria 19397
100 Ga0466966_0002965 3300044684 Bacteria 11170
101 Ga0466966_0003426 3300044684 Bacteria 10463
102 Ga0466961_0002357 3300044693 Bacteria 11742
103 Ga0466961_0025031 3300044693 Bacteria 3842
104 Ga0466961_0041304 3300044693 Bacteria 2957
105 Ga0466963_0008322 3300044694 Bacteria 6213
106 Ga0466963_0179102 3300044694 Bacteria 1479
107 Ga0466964_0002841 3300044706 Bacteria 6243
108 Ga0466964_0055739 3300044706 Bacteria 1633
109 Ga0466971_0003947 3300044719 Bacteria 6371
110 Ga0466968_0003950 3300044735 Bacteria 5509
111 Ga0466968_0023203 3300044735 Bacteria 2526
112 Ga0466970_0001401 3300044765 Bacteria 11645
113 Ga0466970_0004519 3300044765 Bacteria 6863
114 Ga0466957_0003486 3300044842 Bacteria 8641
115 Ga0466960_0017786 3300044901 Bacteria 3106
116 Ga0466959_0005969 3300045049 Bacteria 8401
117 Ga0466959_0015019 3300045049 Bacteria 5643
118 Ga0466958_0004105 3300045836 Bacteria 7641
119 Ga0466967_0115859 3300045976 Bacteria 2468
120 Ga0466967_0319727 3300045976 Bacteria 1496
121 Ga0495617_038114 3300046452 Bacteria 1609
122 Ga0495603_0004366 3300046455 Bacteria 8438
123 Ga0495603_0040330 3300046455 Bacteria 2794
124 Ga0495590_0030039 3300046457 Bacteria 1904
125 Ga0495629_0022974 3300046459 Bacteria 4445
126 Ga0495638_0008652 3300046460 Bacteria 7200
127 Ga0495653_0103736 3300046463 Bacteria 2056
128 Ga0495582_0114610 3300046473 Bacteria 1515
129 Ga0495605_0041765 3300046474 Bacteria 2283
130 Ga0495605_0083349 3300046474 Bacteria 1492
131 Ga0495662_0006884 3300046476 Bacteria 5648
132 Ga0495662_0015378 3300046476 Bacteria 3716
133 Ga0495664_0001811 3300046477 Bacteria 11344
134 Ga0495585_0076394 3300046492 Bacteria 1819
135 Ga0495594_0016319 3300046499 Bacteria 3912
136 Ga0495594_0049549 3300046499 Bacteria 2308
137 Ga0495594_0136283 3300046499 Bacteria 1391
138 Ga0495594_0148962 3300046499 Bacteria 1328
139 Ga0495606_0146247 3300046507 Bacteria 1391
140 Ga0495620_0026819 3300046515 Bacteria 2704
141 Ga0495620_0050396 3300046515 Bacteria 1776
142 Ga0495628_0023632 3300046516 Bacteria 5043
143 Ga0495630_0025750 3300046517 Bacteria 4351
144 Ga0495630_0061561 3300046517 Bacteria 2819
145 Ga0495631_0025573 3300046518 Bacteria 2717
146 Ga0495643_0032120 3300046522 Bacteria 2916
147 Ga0495648_0027221 3300046524 Bacteria 3832
148 Ga0495666_0007543 3300046526 Bacteria 5441
149 Ga0495652_0020444 3300046529 Bacteria 5886
150 Ga0495640_0009423 3300046533 Bacteria 7605
151 Ga0495640_0156001 3300046533 Bacteria 1465
152 Ga0495587_0015724 3300046536 Bacteria 4719
153 Ga0495609_0026207 3300046538 Bacteria 2669
154 Ga0495597_0029063 3300046542 Bacteria 2525
155 Ga0495597_0033278 3300046542 Bacteria 2335
156 Ga0495667_0123794 3300046559 Bacteria 1669
157 Ga0495668_0057578 3300046616 Bacteria 2144
158 Ga0495634_0007004 3300046642 Bacteria 8505
159 Ga0495625_0008432 3300046660 Bacteria 8798
160 Ga0495625_0110349 3300046660 Bacteria 1880
161 Ga0495635_0003593 3300046663 Bacteria 10736
162 Ga0495588_0012886 3300046674 Bacteria 3965
163 Ga0495588_0139948 3300046674 Bacteria 1278
164 Ga0495588_0203720 3300046674 Bacteria 1045
165 Ga0495623_0013606 3300046679 Bacteria 5273
166 Ga0495646_0001596 3300046680 Bacteria 13501
167 Ga0495613_0001247 3300046689 Bacteria 19397
168 Ga0495613_0005338 3300046689 Bacteria 9654
169 Ga0495613_0041104 3300046689 Bacteria 3424
170 Ga0495613_0138842 3300046689 Bacteria 1737
171 Ga0495613_0154316 3300046689 Bacteria 1636
172 Ga0495624_0029310 3300046690 Bacteria 3591
173 Ga0495670_0067460 3300046691 Bacteria 1806
174 Ga0495671_0008827 3300046692 Bacteria 5661
175 Ga0495649_0085607 3300046694 Bacteria 1682
176 Ga0495600_0068742 3300046809 Bacteria 2315
177 Ga0495660_0114845 3300046810 Bacteria 1369
178 Ga0495604_0005497 3300047317 Bacteria 10048
179 Ga0495604_0055395 3300047317 Bacteria 3056
180 Ga0495636_0000824 3300047318 Bacteria 11431
181 Ga0495676_0005827 3300047321 Bacteria 11308
182 Ga0495676_0034443 3300047321 Bacteria 4249
183 Ga0495676_0056545 3300047321 Bacteria 3101
184 Ga0495676_0075833 3300047321 Bacteria 2570
185 Ga0495687_005427 3300047443 Bacteria 8130
186 Ga0495685_048455 3300047447 Bacteria 1444
187 Ga0495681_0000587 3300047470 Bacteria 27794
188 Ga0495681_0078175 3300047470 Bacteria 1483
189 Ga0495686_0028297 3300047472 Bacteria 3650
190 Ga0495686_0096219 3300047472 Bacteria 1792
191 Ga0495593_0004555 3300047673 Bacteria 8236
192 Ga0495593_0017305 3300047673 Bacteria 4057
193 Ga0495602_0023286 3300048088 Bacteria 6038
194 Ga0495602_0068461 3300048088 Bacteria 3048
195 Ga0495614_0001364 3300048089 Bacteria 10533
196 Ga0495614_0032016 3300048089 Bacteria 2263
197 Ga0495614_0112795 3300048089 Bacteria 1194
198 Ga0496109_0067028 3300048912 Bacteria 3288
199 Ga0501031_0006833 3300049568 Bacteria 7443
200 Ga0501031_0277165 3300049568 Bacteria 1088
201 Ga0501032_0136103 3300049569 Bacteria 1619
202 Ga0501032_0146966 3300049569 Bacteria 1551
203 Ga0501033_0009566 3300049570 Bacteria 7458
204 Ga0501033_0028101 3300049570 Bacteria 4227
205 Ga0501033_0037065 3300049570 Bacteria 3651
206 Ga0501033_0060322 3300049570 Bacteria 2799
207 Ga0501034_0010417 3300049571 Bacteria 9689
208 Ga0501034_0013828 3300049571 Bacteria 8306
209 Ga0501034_0057672 3300049571 Bacteria 3904
210 Ga0501036_0006414 3300049572 Bacteria 9550
211 Ga0501036_0017904 3300049572 Bacteria 5931
212 Ga0501036_0045945 3300049572 Bacteria 3698
213 Ga0501037_0016710 3300049573 Bacteria 5399
214 Ga0501037_0093255 3300049573 Bacteria 2177
215 Ga0501038_0001598 3300049574 Bacteria 21002
216 Ga0501038_0005217 3300049574 Bacteria 12095
217 Ga0501038_0012482 3300049574 Bacteria 7763
218 Ga0501038_0042152 3300049574 Bacteria 3976
219 Ga0501039_0033475 3300049575 Bacteria 3962
220 Ga0501039_0053633 3300049575 Bacteria 3120
221 Ga0501043_0008684 3300049579 Bacteria 7994
222 Ga0501043_0011947 3300049579 Bacteria 6794
223 Ga0501043_0067637 3300049579 Bacteria 2805
224 Ga0501043_0190451 3300049579 Bacteria 1595
225 Ga0501046_0002356 3300049580 Bacteria 17798
226 Ga0501047_0068986 3300049581 Bacteria 3405
227 Ga0501047_0088958 3300049581 Bacteria 2965
228 Ga0501047_0104678 3300049581 Bacteria 2710
229 Ga0501047_0116516 3300049581 Bacteria 2553
230 Ga0501048_0001625 3300049582 Bacteria 17103
231 Ga0501048_0063944 3300049582 Bacteria 2602
232 Ga0501070_0018190 3300049586 Bacteria 5894
233 Ga0501070_0053627 3300049586 Bacteria 3344
234 Ga0501070_0220929 3300049586 Bacteria 1554
235 Ga0501074_0004168 3300049590 Bacteria 10324
236 Ga0501080_0074807 3300049742 Bacteria 3151
237 Ga0501080_0138409 3300049742 Bacteria 2252
238 Ga0501035_0003070 3300049822 Bacteria 16025
239 Ga0501035_0004292 3300049822 Bacteria 13533
240 Ga0501035_0154371 3300049822 Bacteria 1990
241 Ga0501044_0007311 3300049823 Bacteria 12134
242 Ga0501044_0022147 3300049823 Bacteria 6775
243 Ga0501044_0026134 3300049823 Bacteria 6183
244 Ga0501044_0067877 3300049823 Bacteria 3633
245 Ga0501044_0089298 3300049823 Bacteria 3110
246 Ga0501044_0144923 3300049823 Bacteria 2361
247 nmdc:mga03n38_809_c1 3300050490 Bacteria 8350
248 nmdc:mga0yw44_60156_c1 3300050492 Bacteria 2326
249 nmdc:mga06z11_4524_c1 3300050494 Bacteria 5476
250 nmdc:mga06z11_989_c1 3300050494 Bacteria 10390
251 nmdc:mga04h51_20774_c1 3300050495 Bacteria 1966
252 Ga0500578_0074918 3300053086 Bacteria 2156
253 Ga0500560_020656 3300053107 Bacteria 1871
254 Ga0500600_0028831 3300053149 Bacteria 3282
255 Ga0500636_0119483 3300053177 Bacteria 1480
256 Ga0466962_0007873 3300061719 Bacteria 5111
257 Ga0466962_0008204 3300061719 Bacteria 5010
258 Ga0466962_0011469 3300061719 Bacteria 4267
259 2990065138 2990059506 Bacteria 9321252
260 2547406329 2547132111 Bacteria 8013147
261 2585305438 2582581313 Bacteria 10042643
262 2585312837 2582581314 Bacteria 11452267
263 2585321121 2582581314 Bacteria 11452267
264 2616702266 2616644814 Bacteria 11555299
265 2644268511 2643221647 Bacteria 10741251
266 2644437396 2643221678 Bacteria 9540101
267 2644628223 2643221714 Bacteria 9015452
268 2784589247 2784132148 Bacteria 8627943
269 2785342407 2784746763 Bacteria 9783172
270 2785346592 2784746763 Bacteria 9783172
271 2785370280 2784746768 Bacteria 10036182
272 2786671389 2786546132 Bacteria 10419719
273 2808842791 2808606359 Bacteria 9866990
274 2808921209 2808606375 Bacteria 9466072
275 2809232859 2808606448 Bacteria 8656184
276 2812357252 2811994879 Bacteria 9313447
277 2812479930 2811994917 Bacteria 7761064
278 2852639846 2852635781 Bacteria 8251373
279 2862286445 2862281513 Bacteria 9621493
280 2862388252 2862382967 Bacteria 10317375
281 2862510097 2862507626 Bacteria 9425308
282 2863412163 2863404153 Bacteria 9672205
283 2867431314 2867428634 Bacteria 9590268
284 2877680353 2877676314 Bacteria 9512378
285 2912718971 2912715099 Bacteria 9460473
286 2912724159 2912723979 Bacteria 8557534
287 2919471260 2919468124 Bacteria 9133025
288 2946068608 2946064051 Bacteria 8957905
289 2946076607 2946072368 Bacteria 8999607
290 2947228285 2947224130 Bacteria 9938529
291 2954006392 2954002825 Bacteria 9173742
292 2954385419 2954380949 Bacteria 10050426
293 2954677693 2954673503 Bacteria 9685905
294 2954686461 2954682443 Bacteria 9862841
295 2954696108 2954691527 Bacteria 10720516
296 2954711281 2954701450 Bacteria 10834262
297 2954715512 2954711539 Bacteria 10867210
298 2954725449 2954721474 Bacteria 10456478
299 2954736364 2954731030 Bacteria 10243860
300 2954744386 2954740390 Bacteria 10229294
301 2954755211 2954749733 Bacteria 10366972
302 2954763359 2954759201 Bacteria 9358192
303 2990063769 2990059506 Bacteria 9321252
304 3006393522 3006393351 Bacteria 6615579
305 3006500199 3006493962 Bacteria 8825450
306 8008565978 8008558824 Bacteria 10610750
307 8008578252 8008574985 Bacteria 7815457
308 8023630032 8023623736 Bacteria 8593882
309 8048410834 8048406513 Bacteria 8936924
310 8056837814 8056829672 Bacteria 9045328
311 JGI24739J22299_10031454
312 JGI24737J22298_10005313
313 JGI24737J22298_10034763
314 JGI24738J21930_10012406
315 JGI24738J21930_10013847
316 JGI24738J21930_10015645
317 rootH1_10060396
318 rootH2_10190765
319 rootH1_10013761
320 Ga0070672_100280646
321 Ga0068856_100149294
322 Ga0075365_10089853
323 Ga0075363_100034006
324 Ga0075363_100051834
325 Ga0075363_100073605
326 Ga0075367_10002824
327 Ga0075367_10010958
328 Ga0105244_10044889
329 Ga0105250_10046547
330 Ga0105238_10412846
331 Ga0105239_10339904
332 Ga0105246_10001464
333 Ga0105246_10001948
334 Ga0105246_10061221
335 Ga0157369_10158604
336 Ga0157369_10196808
337 Ga0157372_10280590
338 Ga0182008_10001422
339 Ga0182007_10001972
340 Ga0183367_1015
341 Ga0209758_1001903
342 Ga0207647_10003807
343 Ga0207647_10008962
344 Ga0207694_10244234
345 Ga0207709_10003959
346 Ga0207667_10183843
347 Ga0207702_10159329
348 Ga0209371_1004304
349 Ga0209371_1013813
350 Ga0209813_10013738
351 Ga0268266_10200525
352 Ga0307517_10063886
353 Ga0307515_10027617
354 Ga0307515_10084482
355 Ga0307515_10206620
356 Ga0268256_1005624
357 Ga0268256_1015322
358 Ga0307511_10000029
359 Ga0307512_10004792
360 Ga0307512_10012507
361 Ga0307513_10015144
362 Ga0307513_10048808
363 Ga0307513_10055095
364 Ga0307509_10017296
365 Ga0307509_10148181
366 Ga0307508_10014141
367 Ga0307508_10022359
368 Ga0307508_10117561
369 Ga0307514_10007678
370 Ga0307514_10202314
371 Ga0307516_10003864
372 Ga0307516_10006155
373 Ga0307518_10035390
374 Ga0307507_10018929
375 Ga0307507_10047542
376 Ga0307507_10066544
377 Ga0307507_10107796
378 Ga0307510_10034795
379 Ga0307510_10055775
380 Ga0307510_10187780
381 Ga0395900_0213043
382 Ga0395898_0000852
383 Ga0395898_0014886
384 Ga0395901_0400954
385 Ga0439436_0002407
386 Ga0439436_0002660
387 Ga0439439_0000626
388 Ga0451837_1263351
389 Ga0451853_0456281
390 Ga0439442_009363
391 Ga0439448_0002918
392 Ga0439455_0016060
393 Ga0439457_000082
394 Ga0439457_000585
395 Ga0439462_0013603
396 Ga0450894_000283
397 Ga0450906_008678
398 Ga0439458_0000086
399 Ga0466969_0006971
400 Ga0466969_0044103
401 Ga0466972_0001544
402 Ga0466972_0009961
403 Ga0466972_0018875
404 Ga0466972_0021848
405 Ga0466972_0044898
406 Ga0466965_0004390
407 Ga0466965_0017627
408 Ga0466965_0044149
409 Ga0466966_0000860
410 Ga0466966_0002965
411 Ga0466966_0003426
412 Ga0466961_0002357
413 Ga0466961_0025031
414 Ga0466961_0041304
415 Ga0466963_0008322
416 Ga0466963_0179102
417 Ga0466964_0002841
418 Ga0466964_0055739
419 Ga0466971_0003947
420 Ga0466968_0003950
421 Ga0466968_0023203
422 Ga0466970_0001401
423 Ga0466970_0004519
424 Ga0466957_0003486
425 Ga0466960_0017786
426 Ga0466959_0005969
427 Ga0466959_0015019
428 Ga0466958_0004105
429 Ga0466967_0115859
430 Ga0466967_0319727
431 Ga0495617_038114
432 Ga0495603_0004366
433 Ga0495603_0040330
434 Ga0495590_0030039
435 Ga0495629_0022974
436 Ga0495638_0008652
437 Ga0495653_0103736
438 Ga0495582_0114610
439 Ga0495605_0041765
440 Ga0495605_0083349
441 Ga0495662_0006884
442 Ga0495662_0015378
443 Ga0495664_0001811
444 Ga0495585_0076394
445 Ga0495594_0016319
446 Ga0495594_0049549
447 Ga0495594_0136283
448 Ga0495594_0148962
449 Ga0495606_0146247
450 Ga0495620_0026819
451 Ga0495620_0050396
452 Ga0495628_0023632
453 Ga0495630_0025750
454 Ga0495630_0061561
455 Ga0495631_0025573
456 Ga0495643_0032120
457 Ga0495648_0027221
458 Ga0495666_0007543
459 Ga0495652_0020444
460 Ga0495640_0009423
461 Ga0495640_0156001
462 Ga0495587_0015724
463 Ga0495609_0026207
464 Ga0495597_0029063
465 Ga0495597_0033278
466 Ga0495667_0123794
467 Ga0495668_0057578
468 Ga0495634_0007004
469 Ga0495625_0008432
470 Ga0495625_0110349
471 Ga0495635_0003593
472 Ga0495588_0012886
473 Ga0495588_0139948
474 Ga0495588_0203720
475 Ga0495623_0013606
476 Ga0495646_0001596
477 Ga0495613_0001247
478 Ga0495613_0005338
479 Ga0495613_0041104
480 Ga0495613_0138842
481 Ga0495613_0154316
482 Ga0495624_0029310
483 Ga0495670_0067460
484 Ga0495671_0008827
485 Ga0495649_0085607
486 Ga0495600_0068742
487 Ga0495660_0114845
488 Ga0495604_0005497
489 Ga0495604_0055395
490 Ga0495636_0000824
491 Ga0495676_0005827
492 Ga0495676_0034443
493 Ga0495676_0056545
494 Ga0495676_0075833
495 Ga0495687_005427
496 Ga0495685_048455
497 Ga0495681_0000587
498 Ga0495681_0078175
499 Ga0495686_0028297
500 Ga0495686_0096219
501 Ga0495593_0004555
502 Ga0495593_0017305
503 Ga0495602_0023286
504 Ga0495602_0068461
505 Ga0495614_0001364
506 Ga0495614_0032016
507 Ga0495614_0112795
508 Ga0496109_0067028
509 Ga0501031_0006833
510 Ga0501031_0277165
511 Ga0501032_0136103
512 Ga0501032_0146966
513 Ga0501033_0009566
514 Ga0501033_0028101
515 Ga0501033_0037065
516 Ga0501033_0060322
517 Ga0501034_0010417
518 Ga0501034_0013828
519 Ga0501034_0057672
520 Ga0501036_0006414
521 Ga0501036_0017904
522 Ga0501036_0045945
523 Ga0501037_0016710
524 Ga0501037_0093255
525 Ga0501038_0001598
526 Ga0501038_0005217
527 Ga0501038_0012482
528 Ga0501038_0042152
529 Ga0501039_0033475
530 Ga0501039_0053633
531 Ga0501043_0008684
532 Ga0501043_0011947
533 Ga0501043_0067637
534 Ga0501043_0190451
535 Ga0501046_0002356
536 Ga0501047_0068986
537 Ga0501047_0088958
538 Ga0501047_0104678
539 Ga0501047_0116516
540 Ga0501048_0001625
541 Ga0501048_0063944
542 Ga0501070_0018190
543 Ga0501070_0053627
544 Ga0501070_0220929
545 Ga0501074_0004168
546 Ga0501080_0074807
547 Ga0501080_0138409
548 Ga0501035_0003070
549 Ga0501035_0004292
550 Ga0501035_0154371
551 Ga0501044_0007311
552 Ga0501044_0022147
553 Ga0501044_0026134
554 Ga0501044_0067877
555 Ga0501044_0089298
556 Ga0501044_0144923
557 nmdc:mga03n38_809_c1
558 nmdc:mga0yw44_60156_c1
559 nmdc:mga06z11_4524_c1
560 nmdc:mga06z11_989_c1
561 nmdc:mga04h51_20774_c1
562 Ga0500578_0074918
563 Ga0500560_020656
564 Ga0500600_0028831
565 Ga0500636_0119483
566 Ga0466962_0007873
567 Ga0466962_0008204
568 Ga0466962_0011469
569 2990065138
570 2547406329
571 2585305438
572 2585312837
573 2585321121
574 2616702266
575 2644268511
576 2644437396
577 2644628223
578 2784589247
579 2785342407
580 2785346592
581 2785370280
582 2786671389
583 2808842791
584 2808921209
585 2809232859
586 2812357252
587 2812479930
588 2852639846
589 2862286445
590 2862388252
591 2862510097
592 2863412163
593 2867431314
594 2877680353
595 2912718971
596 2912724159
597 2919471260
598 2946068608
599 2946076607
600 2947228285
601 2954006392
602 2954385419
603 2954677693
604 2954686461
605 2954696108
606 2954711281
607 2954715512
608 2954725449
609 2954736364
610 2954744386
611 2954755211
612 2954763359
613 2990063769
614 3006393522
615 3006500199
616 8008565978
617 8008578252
618 8023630032
619 8048410834
620 8056837814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

75

335

0.97

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

73

301

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3urm-assembly1.cif.gz_A crystal structure of the periplasmic sugar binding protein chve 0.9168 30 344
4ywh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose 0.9066 30 344
2gx6-assembly1.cif.gz_A rational stabilization of e. coli ribose binding protein 0.9049 31 325
4ywh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose 0.901 30 344
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.9009 30 325
ID Description Score Start End Superfamily
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9591 30 135 3.40.50.2300
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9413 30 135 3.40.50.2300
1ba2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9307 31 133 3.40.50.2300
4ywhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9303 30 136 3.40.50.2300
5dteD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9202 134 275 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A561TGR6-F1-model_v4 D-xylose transport system substrate-binding protein 0.9627 31 359 GO:0030246
GO:0030288
AF-A0A561TGR6-F1-model_v4 D-xylose transport system substrate-binding protein 0.9598 31 359 GO:0030246
GO:0030288
AF-A0A3D5PHC6-F1-model_v4 ABC transporter substrate-binding protein 0.9341 195 359
AF-A0A4Y8Q7E8-F1-model_v4 D-xylose ABC transporter substrate-binding protein 0.9316 39 347 GO:0015753
GO:0030288
GO:0048029
AF-A0A5J4K6B8-F1-model_v4 deleted 0.9312 31 347

Map