F400914

General Info

Members Datasets Scaffolds Average Seq Length
310 203 309 128

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_1704881|Ga0501034_1704881_97_468
Length 123
Sequence MGVNKKHDEFHTLAMDQGWEVPPGYPPGIQQKILSGGLDEAKRAGSRTRLLRFKPGAFTTEPFVHEYWEEVFLVEGELVVGSANSAEAFSPFTYACRPPGAYHGPFRSEAGCLLLEIHYFDPA

Samples

Sample ID Description Type Environment
1 2643221672 Variovorax sp. Root434 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
199 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 0
Rhizoplane 4.19
Rhizosphere 78.39
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10340526 3300003320 Bacteria 1065
2 Ga0070666_10060849 3300005335 Bacteria 2556
3 Ga0070669_102012397 3300005353 Unclassified 505
4 Ga0070671_100227640 3300005355 Bacteria 1582
5 Ga0070674_101212339 3300005356 Unclassified 670
6 Ga0070673_100750020 3300005364 Unclassified 899
7 Ga0070659_100166334 3300005366 Bacteria 1805
8 Ga0070703_10022570 3300005406 Bacteria 1848
9 Ga0070709_10267018 3300005434 Unclassified 1239
10 Ga0070709_10289582 3300005434 Bacteria 1193
11 Ga0070709_10436704 3300005434 Bacteria 984
12 Ga0070714_100024958 3300005435 Bacteria 4929
13 Ga0070714_100309625 3300005435 Bacteria 1474
14 Ga0070714_100773209 3300005435 Bacteria 929
15 Ga0070713_100160090 3300005436 Unclassified 2009
16 Ga0070713_100370015 3300005436 Bacteria 1333
17 Ga0070713_100779150 3300005436 Unclassified 916
18 Ga0070713_100846417 3300005436 Bacteria 878
19 Ga0070710_10003275 3300005437 Bacteria 7679
20 Ga0070710_11051463 3300005437 Bacteria 596
21 Ga0070711_100011962 3300005439 Bacteria 5405
22 Ga0070711_100346993 3300005439 Bacteria 1193
23 Ga0070711_100718499 3300005439 Bacteria 842
24 Ga0070711_101776480 3300005439 Unclassified 541
25 Ga0070705_100694308 3300005440 Bacteria 798
26 Ga0070694_100145095 3300005444 Bacteria 1728
27 Ga0070694_100930987 3300005444 Bacteria 719
28 Ga0070681_10006879 3300005458 Bacteria 11070
29 Ga0070707_100230033 3300005468 Bacteria 1805
30 Ga0070698_100001353 3300005471 Bacteria 27266
31 Ga0070699_100787579 3300005518 Bacteria 870
32 Ga0070697_100424214 3300005536 Bacteria 1156
33 Ga0070695_100002021 3300005545 Bacteria 11577
34 Ga0070695_100217297 3300005545 Unclassified 1375
35 Ga0070696_100274044 3300005546 Bacteria 1284
36 Ga0070696_100334625 3300005546 Unclassified 1169
37 Ga0070693_101239169 3300005547 Unclassified 574
38 Ga0070704_100297363 3300005549 Bacteria 1344
39 Ga0070664_100169455 3300005564 Bacteria 1936
40 Ga0068856_100184716 3300005614 Bacteria 2098
41 Ga0068856_100570520 3300005614 Bacteria 1153
42 Ga0068863_100356077 3300005841 Bacteria 1426
43 Ga0068858_101789742 3300005842 Bacteria 607
44 Ga0068860_100315647 3300005843 Bacteria 1533
45 Ga0081455_10008425 3300005937 Bacteria 10724
46 Ga0070717_10000398 3300006028 Bacteria 27863
47 Ga0070717_10014369 3300006028 Bacteria 6092
48 Ga0070717_10235603 3300006028 Bacteria 1613
49 Ga0075432_10093293 3300006058 Bacteria 1104
50 Ga0070715_10001174 3300006163 Bacteria 7514
51 Ga0070715_10226372 3300006163 Bacteria 964
52 Ga0070716_100034542 3300006173 Bacteria 2774
53 Ga0070716_100245168 3300006173 Bacteria 1217
54 Ga0070716_100930447 3300006173 Unclassified 683
55 Ga0070712_100125464 3300006175 Bacteria 1938
56 Ga0070712_100429265 3300006175 Bacteria 1097
57 Ga0075369_10157728 3300006186 Unclassified 1039
58 Ga0075366_10644659 3300006195 Bacteria 657
59 Ga0075428_101177106 3300006844 Unclassified 808
60 Ga0075428_102528664 3300006844 Bacteria 525
61 Ga0075431_100073668 3300006847 Bacteria 3523
62 Ga0075431_100704606 3300006847 Bacteria 987
63 Ga0075433_10756802 3300006852 Unclassified 850
64 Ga0075434_100232660 3300006871 Bacteria 1862
65 Ga0075429_100120456 3300006880 Unclassified 2294
66 Ga0075436_100888745 3300006914 Bacteria 666
67 Ga0075435_100113076 3300007076 Bacteria 2259
68 Ga0111539_10435848 3300009094 Bacteria 1526
69 Ga0114129_10115221 3300009147 Bacteria 3705
70 Ga0114129_10206546 3300009147 Bacteria 2657
71 Ga0114129_10593499 3300009147 Bacteria 1436
72 Ga0114129_10929741 3300009147 Bacteria 1100
73 Ga0105243_10008835 3300009148 Bacteria 7715
74 Ga0105241_10618093 3300009174 Bacteria 981
75 Ga0105242_10350892 3300009176 Bacteria 1362
76 Ga0105242_10495584 3300009176 Bacteria 1161
77 Ga0105242_11166915 3300009176 Bacteria 788
78 Ga0105248_10514090 3300009177 Bacteria 1350
79 Ga0105237_10754884 3300009545 Unclassified 979
80 Ga0105249_12790261 3300009553 Bacteria 560
81 Ga0105246_10820892 3300011119 Unclassified 827
82 Ga0163162_11206514 3300013306 Unclassified 859
83 Ga0163162_13210464 3300013306 Bacteria 524
84 Ga0157375_12248159 3300013308 Unclassified 650
85 Ga0163163_10073347 3300014325 Bacteria 3414
86 Ga0163163_11339502 3300014325 Bacteria 778
87 Ga0157376_10509725 3300014969 Unclassified 1184
88 Ga0213873_10092389 3300021358 Bacteria 861
89 Ga0213874_10029195 3300021377 Bacteria 1581
90 Ga0213874_10030026 3300021377 Bacteria 1564
91 Ga0213874_10073701 3300021377 Bacteria 1094
92 Ga0213874_10120661 3300021377 Bacteria 891
93 Ga0213876_10301904 3300021384 Bacteria 851
94 Ga0213875_10209385 3300021388 Bacteria 918
95 Ga0213875_10340269 3300021388 Bacteria 712
96 Ga0213871_10064835 3300021441 Bacteria 1023
97 Ga0207692_10005371 3300025898 Bacteria 5131
98 Ga0207685_10002372 3300025905 Bacteria 4296
99 Ga0207699_10050173 3300025906 Bacteria 2459
100 Ga0207699_10202700 3300025906 Bacteria 1345
101 Ga0207684_10099268 3300025910 Bacteria 2487
102 Ga0207707_10102927 3300025912 Bacteria 2496
103 Ga0207693_10013785 3300025915 Bacteria 6508
104 Ga0207693_10027560 3300025915 Bacteria 4490
105 Ga0207693_10066481 3300025915 Bacteria 2822
106 Ga0207663_10073476 3300025916 Bacteria 2213
107 Ga0207663_10178372 3300025916 Bacteria 1515
108 Ga0207646_10029981 3300025922 Bacteria 4939
109 Ga0207700_10131719 3300025928 Bacteria 2042
110 Ga0207700_10414185 3300025928 Bacteria 1183
111 Ga0207700_10555599 3300025928 Unclassified 1019
112 Ga0207700_11464368 3300025928 Unclassified 606
113 Ga0207664_10116189 3300025929 Bacteria 2232
114 Ga0207664_10479895 3300025929 Bacteria 1112
115 Ga0207644_10287712 3300025931 Bacteria 1321
116 Ga0207690_10259902 3300025932 Bacteria 1345
117 Ga0207686_10298479 3300025934 Bacteria 1196
118 Ga0207686_11437320 3300025934 Unclassified 568
119 Ga0207665_10081869 3300025939 Bacteria 2224
120 Ga0207711_10854625 3300025941 Unclassified 847
121 Ga0207679_10317146 3300025945 Bacteria 1349
122 Ga0207651_10668590 3300025960 Unclassified 913
123 Ga0207702_10450219 3300026078 Bacteria 1249
124 Ga0207641_10368633 3300026088 Bacteria 1373
125 Ga0207428_10612425 3300027907 Unclassified 784
126 Ga0265334_10024015 3300028573 Bacteria 2476
127 Ga0265325_10224696 3300031241 Bacteria 858
128 Ga0265340_10108006 3300031247 Bacteria 1288
129 Ga0265331_10075696 3300031250 Unclassified 1569
130 Ga0265331_10324638 3300031250 Bacteria 689
131 Ga0265327_10358502 3300031251 Bacteria 636
132 Ga0307408_100000406 3300031548 Bacteria 38727
133 Ga0265314_10001402 3300031711 Bacteria 27034
134 Ga0265342_10043116 3300031712 Bacteria 2724
135 Ga0307405_10173624 3300031731 Bacteria 1540
136 Ga0307405_10176231 3300031731 Bacteria 1530
137 Ga0307406_10253542 3300031901 Bacteria 1327
138 Ga0307412_10000207 3300031911 Bacteria 40047
139 Ga0307412_10015597 3300031911 Bacteria 4510
140 Ga0307416_100131729 3300032002 Bacteria 2252
141 Ga0307414_10229930 3300032004 Bacteria 1528
142 Ga0307411_10000086 3300032005 Bacteria 28813
143 Ga0307411_10192576 3300032005 Bacteria 1558
144 Ga0373934_0003919 3300035086 Bacteria 5467
145 Ga0373939_0015281 3300035114 Bacteria 2007
146 Ga0373954_0004243 3300035118 Bacteria 6158
147 Ga0373954_0231581 3300035118 Bacteria 909
148 Ga0373956_0000584 3300035119 Bacteria 14945
149 Ga0373956_0185401 3300035119 Unclassified 984
150 Ga0373957_0024429 3300035120 Bacteria 2170
151 Ga0373957_0025642 3300035120 Bacteria 2126
152 Ga0373957_0183851 3300035120 Unclassified 867
153 Ga0373955_0030373 3300035172 Bacteria 2820
154 Ga0373955_0035088 3300035172 Bacteria 2654
155 Ga0373955_0787172 3300035172 Bacteria 584
156 Ga0373931_0643572 3300035691 Bacteria 696
157 Ga0373935_0125178 3300035692 Bacteria 1721
158 Ga0373935_0171258 3300035692 Bacteria 1485
159 Ga0373927_0557219 3300035695 Unclassified 757
160 Ga0373933_0000759 3300035724 Bacteria 19748
161 Ga0373933_0007330 3300035724 Bacteria 6018
162 Ga0373933_0554278 3300035724 Bacteria 754
163 Ga0373937_0000931 3300036401 Bacteria 24797
164 Ga0373937_0009125 3300036401 Bacteria 8607
165 Ga0373937_0151134 3300036401 Bacteria 2175
166 Ga0373937_0351451 3300036401 Unclassified 1396
167 Ga0373925_0153164 3300037068 Bacteria 1812
168 Ga0373925_0344517 3300037068 Unclassified 1209
169 Ga0436364_0068638 3300037853 Bacteria 9742
170 Ga0436364_0225243 3300037853 Bacteria 951
171 Ga0436364_0535544 3300037853 Bacteria 2499
172 Ga0436364_0974297 3300037853 Bacteria 2298
173 Ga0436364_1214805 3300037853 Bacteria 741
174 Ga0436364_1406937 3300037853 Bacteria 1200
175 Ga0436365_0257297 3300039437 Bacteria 853
176 Ga0436365_1138345 3300039437 Bacteria 1469
177 Ga0436365_1326572 3300039437 Unclassified 1474
178 Ga0436360_0288511 3300039438 Bacteria 573
179 Ga0436360_0627708 3300039438 Bacteria 1952
180 Ga0436360_0705875 3300039438 Bacteria 983
181 Ga0436360_0996139 3300039438 Bacteria 1060
182 Ga0436363_0180174 3300039450 Bacteria 1718
183 Ga0436363_0360075 3300039450 Bacteria 868
184 Ga0436363_0523233 3300039450 Bacteria 2396
185 Ga0436363_0666119 3300039450 Bacteria 940
186 Ga0436363_0878951 3300039450 Bacteria 1367
187 Ga0436363_0908748 3300039450 Bacteria 765
188 Ga0436363_1245511 3300039450 Bacteria 1101
189 Ga0436363_1495593 3300039450 Bacteria 863
190 Ga0436363_1654339 3300039450 Bacteria 4840
191 Ga0436362_0782961 3300039453 Bacteria 3937
192 Ga0436362_0906540 3300039453 Bacteria 1042
193 Ga0439455_0237133 3300042012 Bacteria 532
194 Ga0451577_0041582 3300042876 Bacteria 4126
195 Ga0466972_0027862 3300044658 Bacteria 2793
196 Ga0466966_0427173 3300044684 Bacteria 796
197 Ga0466966_0751620 3300044684 Bacteria 588
198 Ga0466960_0097634 3300044901 Bacteria 1508
199 Ga0466958_1130794 3300045836 Unclassified 511
200 Ga0466967_0813332 3300045976 Bacteria 928
201 Ga0495592_0339033 3300046454 Unclassified 967
202 Ga0495651_0000314 3300046462 Bacteria 37543
203 Ga0495651_0181984 3300046462 Bacteria 1487
204 Ga0495653_0299673 3300046463 Bacteria 1049
205 Ga0495580_0100345 3300046472 Bacteria 2014
206 Ga0495608_0019425 3300046511 Bacteria 4676
207 Ga0495637_0271373 3300046520 Bacteria 607
208 Ga0495640_0584315 3300046533 Bacteria 675
209 Ga0495667_0004361 3300046559 Bacteria 9553
210 Ga0495667_0199869 3300046559 Unclassified 1279
211 Ga0495634_0110951 3300046642 Bacteria 1764
212 Ga0495635_0084773 3300046663 Bacteria 2168
213 Ga0495657_0147762 3300046675 Bacteria 1461
214 Ga0495646_0454488 3300046680 Bacteria 661
215 Ga0495671_0217250 3300046692 Bacteria 926
216 Ga0495581_0252071 3300047315 Bacteria 1032
217 Ga0495636_0029285 3300047318 Bacteria 2247
218 Ga0495674_0016457 3300047319 Bacteria 6898
219 Ga0495680_0009764 3300047322 Bacteria 8608
220 Ga0495602_0069011 3300048088 Bacteria 3033
221 Ga0496100_1347747 3300048903 Bacteria 563
222 Ga0496102_0598233 3300048905 Bacteria 1026
223 Ga0496104_1752786 3300048907 Unclassified 523
224 Ga0496107_1059618 3300048910 Unclassified 587
225 Ga0496108_0000835 3300048911 Bacteria 23948
226 Ga0496109_0005707 3300048912 Bacteria 10416
227 Ga0496110_0000379 3300048913 Bacteria 29816
228 Ga0496110_0029405 3300048913 Bacteria 4729
229 Ga0496110_0072736 3300048913 Bacteria 3051
230 Ga0496111_0012963 3300048914 Bacteria 5658
231 Ga0496112_0149887 3300048915 Bacteria 2299
232 Ga0496113_0255194 3300048916 Bacteria 1400
233 Ga0496114_1039957 3300048917 Unclassified 703
234 Ga0496118_0571023 3300048921 Bacteria 547
235 Ga0496126_0092089 3300048929 Bacteria 2664
236 Ga0496126_0305209 3300048929 Unclassified 1312
237 Ga0501034_0378418 3300049571 Bacteria 1341
238 Ga0501034_1704881 3300049571 Bacteria 502
239 Ga0501036_0406415 3300049572 Bacteria 1136
240 Ga0501037_0686080 3300049573 Bacteria 682
241 Ga0501038_0193488 3300049574 Unclassified 1636
242 Ga0501042_0474450 3300049578 Bacteria 908
243 Ga0501043_0651756 3300049579 Unclassified 773
244 Ga0501046_0086337 3300049580 Bacteria 2419
245 Ga0501046_0615492 3300049580 Unclassified 770
246 Ga0501047_1106785 3300049581 Bacteria 605
247 Ga0501068_0144303 3300049584 Bacteria 1494
248 Ga0501070_0027720 3300049586 Bacteria 4752
249 Ga0501070_0195522 3300049586 Bacteria 1661
250 Ga0501073_0645071 3300049589 Bacteria 731
251 Ga0501074_1249317 3300049590 Bacteria 521
252 Ga0501077_0007955 3300049593 Bacteria 6552
253 Ga0501079_0177196 3300049741 Bacteria 1663
254 Ga0501079_0715995 3300049741 Bacteria 788
255 Ga0501080_0838155 3300049742 Bacteria 804
256 Ga0501081_0049680 3300049743 Bacteria 2889
257 Ga0501035_0006037 3300049822 Bacteria 11406
258 Ga0501044_0005411 3300049823 Bacteria 14184
259 Ga0501045_0228457 3300049824 Bacteria 1385
260 Ga0501045_1353277 3300049824 Bacteria 518
261 nmdc:mga0yw44_302219_c1 3300050492 Bacteria 1072
262 nmdc:mga0k408_589316_c1 3300050493 Bacteria 656
263 nmdc:mga07m45_441071_c1 3300050496 Bacteria 755
264 nmdc:mga07m45_786159_c1 3300050496 Bacteria 546
265 nmdc:mga05p37_1045547_c1 3300050507 Bacteria 862
266 nmdc:mga05p37_1460673_c1 3300050507 Bacteria 684
267 nmdc:mga05p37_160126_c1 3300050507 Bacteria 2750
268 nmdc:mga05p37_34686_c1 3300050507 Bacteria 6181
269 nmdc:mga05p37_483738_c1 3300050507 Bacteria 1425
270 nmdc:mga05p37_488981_c1 3300050507 Bacteria 1415
271 nmdc:mga05p37_620249_c1 3300050507 Bacteria 1217
272 nmdc:mga09592_125827_c1 3300050508 Unclassified 2203
273 nmdc:mga0qj67_164021_c1 3300050509 Unclassified 1804
274 nmdc:mga06r32_1376613_c1 3300050510 Bacteria 648
275 nmdc:mga08y16_762162_c1 3300050511 Bacteria 963
276 nmdc:mga0n895_123509_c1 3300050512 Bacteria 2611
277 nmdc:mga0n895_1787453_c1 3300050512 Unclassified 576
278 nmdc:mga0n895_430685_c1 3300050512 Bacteria 1333
279 nmdc:mga0rr50_1053701_c1 3300050513 Unclassified 692
280 nmdc:mga0sz30_144208_c1 3300050516 Unclassified 1052
281 Ga0495601_0040562 3300053077 Bacteria 2916
282 Ga0495601_0763048 3300053077 Unclassified 615
283 Ga0500635_0001189 3300053080 Bacteria 6238
284 Ga0495595_0066085 3300053084 Bacteria 1702
285 Ga0495595_0141276 3300053084 Bacteria 1181
286 Ga0495595_0211074 3300053084 Unclassified 968
287 Ga0495619_0078791 3300053085 Bacteria 2215
288 Ga0495619_0968226 3300053085 Unclassified 570
289 Ga0495619_0997331 3300053085 Unclassified 560
290 Ga0500578_0565779 3300053086 Bacteria 630
291 Ga0500643_006784 3300053087 Bacteria 4722
292 Ga0500644_0000856 3300053088 Bacteria 9989
293 Ga0500651_0004404 3300053093 Bacteria 7877
294 Ga0500651_0166281 3300053093 Bacteria 1317
295 Ga0500650_0377582 3300053098 Unclassified 616
296 Ga0500594_0066910 3300053118 Unclassified 1048
297 Ga0500595_000002 3300053119 Bacteria 1074388
298 Ga0500642_0086412 3300053130 Bacteria 1446
299 Ga0500652_031333 3300053131 Bacteria 2085
300 Ga0500655_014278 3300053133 Bacteria 1453
301 Ga0500616_0000001 3300053153 Bacteria 1986011
302 Ga0500639_065737 3300053163 Bacteria 1860
303 Ga0500637_0008502 3300053178 Bacteria 5182
304 Ga0500645_000291 3300053730 Bacteria 35819
305 Ga0500645_202517 3300053730 Bacteria 535
306 Ga0501084_0841633 3300054114 Bacteria 772
307 Ga0501082_0250250 3300060353 Bacteria 1542
308 Ga0501082_1604181 3300060353 Bacteria 568
309 Ga0530510_0498904 3300061734 Bacteria 923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1752786 Ga0496104_1752786_174_506 110
2 3300035691 Ga0373931_0643572 Ga0373931_0643572_344_679 111
3 3300035724 Ga0373933_0554278 Ga0373933_0554278_42_380 112
4 3300037068 Ga0373925_0344517 Ga0373925_0344517_566_904 112
5 3300006163 Ga0070715_10226372 Ga0070715_102263722 115
6 3300005434 Ga0070709_10267018 Ga0070709_102670182 123
7 3300005436 Ga0070713_100160090 Ga0070713_1001600903 123
8 3300006847 Ga0075431_100704606 Ga0075431_1007046062 123
9 3300025915 Ga0207693_10066481 Ga0207693_100664813 123
10 3300025928 Ga0207700_10131719 Ga0207700_101317192 123
11 3300049571 Ga0501034_1704881 Ga0501034_1704881_97_468 123
12 3300049579 Ga0501043_0651756 Ga0501043_0651756_352_723 123
13 3300049584 Ga0501068_0144303 Ga0501068_0144303_598_969 123
14 3300049586 Ga0501070_0027720 Ga0501070_0027720_4019_4390 123
15 3300049589 Ga0501073_0645071 Ga0501073_0645071_142_513 123
16 3300049742 Ga0501080_0838155 Ga0501080_0838155_146_517 123
17 3300005353 Ga0070669_102012397 Ga0070669_1020123971 124
18 3300005356 Ga0070674_101212339 Ga0070674_1012123392 124
19 3300005366 Ga0070659_100166334 Ga0070659_1001663342 124
20 3300005435 Ga0070714_100773209 Ga0070714_1007732091 124
21 3300005564 Ga0070664_100169455 Ga0070664_1001694552 124
22 3300005841 Ga0068863_100356077 Ga0068863_1003560772 124
23 3300011119 Ga0105246_10820892 Ga0105246_108208922 124
24 3300013306 Ga0163162_11206514 Ga0163162_112065142 124
25 3300014325 Ga0163163_11339502 Ga0163163_113395022 124
26 3300025932 Ga0207690_10259902 Ga0207690_102599022 124
27 3300025945 Ga0207679_10317146 Ga0207679_103171461 124
28 3300026088 Ga0207641_10368633 Ga0207641_103686331 124
29 3300027907 Ga0207428_10612425 Ga0207428_106124252 124
30 3300031250 Ga0265331_10075696 Ga0265331_100756962 124
31 3300035118 Ga0373954_0004243 Ga0373954_0004243_3634_4065 124
32 3300035119 Ga0373956_0185401 Ga0373956_0185401_72_503 124
33 3300035120 Ga0373957_0025642 Ga0373957_0025642_1114_1545 124
34 3300035172 Ga0373955_0030373 Ga0373955_0030373_1475_1906 124
35 3300035724 Ga0373933_0007330 Ga0373933_0007330_4626_5057 124
36 3300036401 Ga0373937_0009125 Ga0373937_0009125_2475_2906 124
37 3300046559 Ga0495667_0199869 Ga0495667_0199869_531_962 124
38 3300048913 Ga0496110_0072736 Ga0496110_0072736_1367_1741 124
39 3300053077 Ga0495601_0040562 Ga0495601_0040562_559_990 124
40 3300053084 Ga0495595_0066085 Ga0495595_0066085_628_1059 124
41 3300053085 Ga0495619_0078791 Ga0495619_0078791_1110_1541 124
42 iso_pu_bacteria 2643221672 2644401315 124
43 3300005335 Ga0070666_10060849 Ga0070666_100608491 125
44 3300005355 Ga0070671_100227640 Ga0070671_1002276404 125
45 3300005364 Ga0070673_100750020 Ga0070673_1007500201 125
46 3300005435 Ga0070714_100309625 Ga0070714_1003096252 125
47 3300005437 Ga0070710_11051463 Ga0070710_110514631 125
48 3300005439 Ga0070711_100346993 Ga0070711_1003469932 125
49 3300005439 Ga0070711_100718499 Ga0070711_1007184992 125
50 3300005439 Ga0070711_101776480 Ga0070711_1017764801 125
51 3300005468 Ga0070707_100230033 Ga0070707_1002300332 125
52 3300005471 Ga0070698_100001353 Ga0070698_10000135332 125
53 3300005518 Ga0070699_100787579 Ga0070699_1007875791 125
54 3300005536 Ga0070697_100424214 Ga0070697_1004242143 125
55 3300005614 Ga0068856_100570520 Ga0068856_1005705201 125
56 3300005842 Ga0068858_101789742 Ga0068858_1017897422 125
57 3300006028 Ga0070717_10000398 Ga0070717_1000039832 125
58 3300006175 Ga0070712_100429265 Ga0070712_1004292651 125
59 3300009176 Ga0105242_10495584 Ga0105242_104955842 125
60 3300009177 Ga0105248_10514090 Ga0105248_105140902 125
61 3300014969 Ga0157376_10509725 Ga0157376_105097253 125
62 3300021377 Ga0213874_10030026 Ga0213874_100300262 125
63 3300021377 Ga0213874_10073701 Ga0213874_100737012 125
64 3300021384 Ga0213876_10301904 Ga0213876_103019042 125
65 3300025910 Ga0207684_10099268 Ga0207684_100992682 125
66 3300025915 Ga0207693_10027560 Ga0207693_100275605 125
67 3300025916 Ga0207663_10178372 Ga0207663_101783723 125
68 3300025922 Ga0207646_10029981 Ga0207646_100299812 125
69 3300025929 Ga0207664_10116189 Ga0207664_101161892 125
70 3300025929 Ga0207664_10479895 Ga0207664_104798952 125
71 3300025931 Ga0207644_10287712 Ga0207644_102877122 125
72 3300025934 Ga0207686_11437320 Ga0207686_114373202 125
73 3300025941 Ga0207711_10854625 Ga0207711_108546252 125
74 3300025960 Ga0207651_10668590 Ga0207651_106685902 125
75 3300026078 Ga0207702_10450219 Ga0207702_104502192 125
76 3300031241 Ga0265325_10224696 Ga0265325_102246962 125
77 3300037853 Ga0436364_0535544 Ga0436364_0535544_687_1064 125
78 3300037853 Ga0436364_1214805 Ga0436364_1214805_245_622 125
79 3300037853 Ga0436364_1406937 Ga0436364_1406937_560_937 125
80 3300039437 Ga0436365_0257297 Ga0436365_0257297_204_581 125
81 3300039438 Ga0436360_0288511 Ga0436360_0288511_102_563 125
82 3300039438 Ga0436360_0996139 Ga0436360_0996139_32_433 125
83 3300039450 Ga0436363_0360075 Ga0436363_0360075_397_774 125
84 3300039450 Ga0436363_0523233 Ga0436363_0523233_1764_2141 125
85 3300045976 Ga0466967_0813332 Ga0466967_0813332_99_476 125
86 3300048910 Ga0496107_1059618 Ga0496107_1059618_80_457 125
87 3300050507 nmdc:mga05p37_1460673_c1 nmdc:mga05p37_1460673_c1_158_535 125
88 3300053077 Ga0495601_0763048 Ga0495601_0763048_82_459 125
89 3300005434 Ga0070709_10436704 Ga0070709_104367042 126
90 3300005436 Ga0070713_100846417 Ga0070713_1008464172 126
91 3300006028 Ga0070717_10235603 Ga0070717_102356032 126
92 3300006173 Ga0070716_100245168 Ga0070716_1002451682 126
93 3300006173 Ga0070716_100930447 Ga0070716_1009304471 126
94 3300006186 Ga0075369_10157728 Ga0075369_101577282 126
95 3300006195 Ga0075366_10644659 Ga0075366_106446591 126
96 3300009147 Ga0114129_10593499 Ga0114129_105934992 126
97 3300009553 Ga0105249_12790261 Ga0105249_127902611 126
98 3300014325 Ga0163163_10073347 Ga0163163_100733474 126
99 3300021358 Ga0213873_10092389 Ga0213873_100923891 126
100 3300021377 Ga0213874_10029195 Ga0213874_100291952 126
101 3300021377 Ga0213874_10120661 Ga0213874_101206612 126
102 3300021388 Ga0213875_10209385 Ga0213875_102093852 126
103 3300021388 Ga0213875_10340269 Ga0213875_103402692 126
104 3300025906 Ga0207699_10202700 Ga0207699_102027002 126
105 3300025928 Ga0207700_10414185 Ga0207700_104141852 126
106 3300025939 Ga0207665_10081869 Ga0207665_100818691 126
107 3300031250 Ga0265331_10324638 Ga0265331_103246381 126
108 3300031251 Ga0265327_10358502 Ga0265327_103585022 126
109 3300031711 Ga0265314_10001402 Ga0265314_1000140232 126
110 3300031712 Ga0265342_10043116 Ga0265342_100431163 126
111 3300035118 Ga0373954_0231581 Ga0373954_0231581_160_540 126
112 3300035172 Ga0373955_0787172 Ga0373955_0787172_126_506 126
113 3300035692 Ga0373935_0125178 Ga0373935_0125178_138_518 126
114 3300035692 Ga0373935_0171258 Ga0373935_0171258_441_821 126
115 3300035695 Ga0373927_0557219 Ga0373927_0557219_350_730 126
116 3300036401 Ga0373937_0151134 Ga0373937_0151134_921_1301 126
117 3300037068 Ga0373925_0153164 Ga0373925_0153164_1195_1575 126
118 3300037853 Ga0436364_0068638 Ga0436364_0068638_3322_3702 126
119 3300037853 Ga0436364_0225243 Ga0436364_0225243_522_902 126
120 3300037853 Ga0436364_0974297 Ga0436364_0974297_1776_2156 126
121 3300039437 Ga0436365_1138345 Ga0436365_1138345_98_478 126
122 3300039437 Ga0436365_1326572 Ga0436365_1326572_385_765 126
123 3300039450 Ga0436363_0180174 Ga0436363_0180174_909_1289 126
124 3300039450 Ga0436363_0666119 Ga0436363_0666119_125_505 126
125 3300039450 Ga0436363_0878951 Ga0436363_0878951_735_1115 126
126 3300039450 Ga0436363_0908748 Ga0436363_0908748_58_438 126
127 3300039450 Ga0436363_1245511 Ga0436363_1245511_400_780 126
128 3300039450 Ga0436363_1495593 Ga0436363_1495593_156_536 126
129 3300039450 Ga0436363_1654339 Ga0436363_1654339_3096_3482 126
130 3300039453 Ga0436362_0782961 Ga0436362_0782961_2217_2597 126
131 3300044684 Ga0466966_0427173 Ga0466966_0427173_359_739 126
132 3300044684 Ga0466966_0751620 Ga0466966_0751620_86_466 126
133 3300045836 Ga0466958_1130794 Ga0466958_1130794_46_426 126
134 3300046454 Ga0495592_0339033 Ga0495592_0339033_204_605 126
135 3300046462 Ga0495651_0181984 Ga0495651_0181984_756_1157 126
136 3300046463 Ga0495653_0299673 Ga0495653_0299673_58_459 126
137 3300046472 Ga0495580_0100345 Ga0495580_0100345_507_887 126
138 3300046511 Ga0495608_0019425 Ga0495608_0019425_2782_3183 126
139 3300046520 Ga0495637_0271373 Ga0495637_0271373_65_445 126
140 3300046533 Ga0495640_0584315 Ga0495640_0584315_245_646 126
141 3300046559 Ga0495667_0004361 Ga0495667_0004361_8100_8501 126
142 3300046642 Ga0495634_0110951 Ga0495634_0110951_523_924 126
143 3300046663 Ga0495635_0084773 Ga0495635_0084773_1416_1817 126
144 3300046675 Ga0495657_0147762 Ga0495657_0147762_767_1168 126
145 3300046680 Ga0495646_0454488 Ga0495646_0454488_176_577 126
146 3300047315 Ga0495581_0252071 Ga0495581_0252071_551_952 126
147 3300047319 Ga0495674_0016457 Ga0495674_0016457_421_822 126
148 3300047322 Ga0495680_0009764 Ga0495680_0009764_7425_7826 126
149 3300048088 Ga0495602_0069011 Ga0495602_0069011_1777_2178 126
150 3300048913 Ga0496110_0029405 Ga0496110_0029405_970_1350 126
151 3300048917 Ga0496114_1039957 Ga0496114_1039957_282_662 126
152 3300048921 Ga0496118_0571023 Ga0496118_0571023_37_417 126
153 3300048929 Ga0496126_0092089 Ga0496126_0092089_2163_2543 126
154 3300049571 Ga0501034_0378418 Ga0501034_0378418_201_581 126
155 3300049574 Ga0501038_0193488 Ga0501038_0193488_1036_1416 126
156 3300049580 Ga0501046_0086337 Ga0501046_0086337_1098_1478 126
157 3300049580 Ga0501046_0615492 Ga0501046_0615492_341_721 126
158 3300049590 Ga0501074_1249317 Ga0501074_1249317_118_498 126
159 3300049593 Ga0501077_0007955 Ga0501077_0007955_1488_1868 126
160 3300049741 Ga0501079_0177196 Ga0501079_0177196_301_681 126
161 3300049743 Ga0501081_0049680 Ga0501081_0049680_901_1281 126
162 3300049824 Ga0501045_0228457 Ga0501045_0228457_435_815 126
163 3300050492 nmdc:mga0yw44_302219_c1 nmdc:mga0yw44_302219_c1_181_561 126
164 3300050493 nmdc:mga0k408_589316_c1 nmdc:mga0k408_589316_c1_227_607 126
165 3300050496 nmdc:mga07m45_786159_c1 nmdc:mga07m45_786159_c1_50_430 126
166 3300050507 nmdc:mga05p37_620249_c1 nmdc:mga05p37_620249_c1_360_740 126
167 3300050510 nmdc:mga06r32_1376613_c1 nmdc:mga06r32_1376613_c1_13_399 126
168 3300050512 nmdc:mga0n895_430685_c1 nmdc:mga0n895_430685_c1_838_1218 126
169 3300050516 nmdc:mga0sz30_144208_c1 nmdc:mga0sz30_144208_c1_82_462 126
170 3300053080 Ga0500635_0001189 Ga0500635_0001189_4151_4531 126
171 3300053084 Ga0495595_0141276 Ga0495595_0141276_658_1059 126
172 3300053086 Ga0500578_0565779 Ga0500578_0565779_50_430 126
173 3300053087 Ga0500643_006784 Ga0500643_006784_2846_3226 126
174 3300053088 Ga0500644_0000856 Ga0500644_0000856_7327_7707 126
175 3300053093 Ga0500651_0004404 Ga0500651_0004404_6439_6819 126
176 3300053093 Ga0500651_0166281 Ga0500651_0166281_359_739 126
177 3300053098 Ga0500650_0377582 Ga0500650_0377582_171_551 126
178 3300053118 Ga0500594_0066910 Ga0500594_0066910_61_441 126
179 3300053119 Ga0500595_000002 Ga0500595_000002_831679_832059 126
180 3300053130 Ga0500642_0086412 Ga0500642_0086412_516_896 126
181 3300053131 Ga0500652_031333 Ga0500652_031333_694_1074 126
182 3300053133 Ga0500655_014278 Ga0500655_014278_142_522 126
183 3300053153 Ga0500616_0000001 Ga0500616_0000001_1506363_1506743 126
184 3300053163 Ga0500639_065737 Ga0500639_065737_1442_1822 126
185 3300053178 Ga0500637_0008502 Ga0500637_0008502_4165_4545 126
186 3300053730 Ga0500645_000291 Ga0500645_000291_29426_29806 126
187 3300053730 Ga0500645_202517 Ga0500645_202517_53_433 126
188 3300054114 Ga0501084_0841633 Ga0501084_0841633_333_713 126
189 3300061734 Ga0530510_0498904 Ga0530510_0498904_454_834 126
190 3300005614 Ga0068856_100184716 Ga0068856_1001847162 127
191 3300009147 Ga0114129_10115221 Ga0114129_101152213 127
192 3300048929 Ga0496126_0305209 Ga0496126_0305209_131_514 127
193 3300050507 nmdc:mga05p37_483738_c1 nmdc:mga05p37_483738_c1_208_594 127
194 3300005937 Ga0081455_10008425 Ga0081455_1000842511 128
195 3300006844 Ga0075428_101177106 Ga0075428_1011771062 128
196 3300006844 Ga0075428_102528664 Ga0075428_1025286641 128
197 3300006871 Ga0075434_100232660 Ga0075434_1002326602 128
198 3300006914 Ga0075436_100888745 Ga0075436_1008887451 128
199 3300007076 Ga0075435_100113076 Ga0075435_1001130762 128
200 3300009094 Ga0111539_10435848 Ga0111539_104358482 128
201 3300009147 Ga0114129_10206546 Ga0114129_102065463 128
202 3300009176 Ga0105242_11166915 Ga0105242_111669151 128
203 3300009545 Ga0105237_10754884 Ga0105237_107548841 128
204 3300028573 Ga0265334_10024015 Ga0265334_100240152 128
205 3300031247 Ga0265340_10108006 Ga0265340_101080062 128
206 3300031548 Ga0307408_100000406 Ga0307408_10000040618 128
207 3300031731 Ga0307405_10173624 Ga0307405_101736242 128
208 3300031731 Ga0307405_10176231 Ga0307405_101762312 128
209 3300031901 Ga0307406_10253542 Ga0307406_102535421 128
210 3300031911 Ga0307412_10000207 Ga0307412_1000020723 128
211 3300031911 Ga0307412_10015597 Ga0307412_100155975 128
212 3300032002 Ga0307416_100131729 Ga0307416_1001317292 128
213 3300032004 Ga0307414_10229930 Ga0307414_102299302 128
214 3300032005 Ga0307411_10000086 Ga0307411_1000008629 128
215 3300032005 Ga0307411_10192576 Ga0307411_101925762 128
216 3300044658 Ga0466972_0027862 Ga0466972_0027862_1781_2173 128
217 3300044901 Ga0466960_0097634 Ga0466960_0097634_474_866 128
218 3300046692 Ga0495671_0217250 Ga0495671_0217250_19_405 128
219 3300049573 Ga0501037_0686080 Ga0501037_0686080_63_449 128
220 3300049581 Ga0501047_1106785 Ga0501047_1106785_13_399 128
221 3300049586 Ga0501070_0195522 Ga0501070_0195522_817_1203 128
222 3300049822 Ga0501035_0006037 Ga0501035_0006037_1180_1566 128
223 3300049823 Ga0501044_0005411 Ga0501044_0005411_4204_4590 128
224 3300049824 Ga0501045_1353277 Ga0501045_1353277_78_464 128
225 3300050496 nmdc:mga07m45_441071_c1 nmdc:mga07m45_441071_c1_292_684 128
226 3300050507 nmdc:mga05p37_160126_c1 nmdc:mga05p37_160126_c1_1655_2041 128
227 3300050511 nmdc:mga08y16_762162_c1 nmdc:mga08y16_762162_c1_128_514 128
228 3300050512 nmdc:mga0n895_123509_c1 nmdc:mga0n895_123509_c1_244_630 128
229 3300050513 nmdc:mga0rr50_1053701_c1 nmdc:mga0rr50_1053701_c1_42_428 128
230 3300060353 Ga0501082_1604181 Ga0501082_1604181_113_505 128
231 3300005458 Ga0070681_10006879 Ga0070681_1000687910 129
232 3300009174 Ga0105241_10618093 Ga0105241_106180932 129
233 3300013308 Ga0157375_12248159 Ga0157375_122481591 129
234 3300021441 Ga0213871_10064835 Ga0213871_100648352 129
235 3300025912 Ga0207707_10102927 Ga0207707_101029273 129
236 3300035086 Ga0373934_0003919 Ga0373934_0003919_196_585 129
237 3300035119 Ga0373956_0000584 Ga0373956_0000584_5907_6296 129
238 3300035120 Ga0373957_0024429 Ga0373957_0024429_1728_2117 129
239 3300035172 Ga0373955_0035088 Ga0373955_0035088_1883_2272 129
240 3300035724 Ga0373933_0000759 Ga0373933_0000759_3211_3600 129
241 3300036401 Ga0373937_0000931 Ga0373937_0000931_8428_8817 129
242 3300039438 Ga0436360_0627708 Ga0436360_0627708_519_908 129
243 3300039438 Ga0436360_0705875 Ga0436360_0705875_502_891 129
244 3300039453 Ga0436362_0906540 Ga0436362_0906540_490_879 129
245 3300046462 Ga0495651_0000314 Ga0495651_0000314_13010_13399 129
246 3300047318 Ga0495636_0029285 Ga0495636_0029285_1460_1849 129
247 3300050507 nmdc:mga05p37_34686_c1 nmdc:mga05p37_34686_c1_1624_2016 129
248 3300053085 Ga0495619_0997331 Ga0495619_0997331_69_458 129
249 3300005434 Ga0070709_10289582 Ga0070709_102895821 130
250 3300005435 Ga0070714_100024958 Ga0070714_1000249589 130
251 3300005436 Ga0070713_100370015 Ga0070713_1003700152 130
252 3300005437 Ga0070710_10003275 Ga0070710_100032752 130
253 3300005439 Ga0070711_100011962 Ga0070711_10001196210 130
254 3300005546 Ga0070696_100274044 Ga0070696_1002740441 130
255 3300006028 Ga0070717_10014369 Ga0070717_100143692 130
256 3300006058 Ga0075432_10093293 Ga0075432_100932932 130
257 3300006163 Ga0070715_10001174 Ga0070715_100011744 130
258 3300006173 Ga0070716_100034542 Ga0070716_1000345423 130
259 3300006175 Ga0070712_100125464 Ga0070712_1001254645 130
260 3300006852 Ga0075433_10756802 Ga0075433_107568022 130
261 3300013306 Ga0163162_13210464 Ga0163162_132104641 130
262 3300025898 Ga0207692_10005371 Ga0207692_100053712 130
263 3300025905 Ga0207685_10002372 Ga0207685_100023722 130
264 3300025906 Ga0207699_10050173 Ga0207699_100501733 130
265 3300025915 Ga0207693_10013785 Ga0207693_100137852 130
266 3300025916 Ga0207663_10073476 Ga0207663_100734762 130
267 3300025928 Ga0207700_11464368 Ga0207700_114643681 130
268 3300048905 Ga0496102_0598233 Ga0496102_0598233_168_560 130
269 3300050507 nmdc:mga05p37_488981_c1 nmdc:mga05p37_488981_c1_962_1354 130
270 3300050512 nmdc:mga0n895_1787453_c1 nmdc:mga0n895_1787453_c1_30_422 130
271 3300005436 Ga0070713_100779150 Ga0070713_1007791501 131
272 3300006847 Ga0075431_100073668 Ga0075431_1000736685 131
273 3300006880 Ga0075429_100120456 Ga0075429_1001204563 131
274 3300009147 Ga0114129_10929741 Ga0114129_109297412 131
275 3300025928 Ga0207700_10555599 Ga0207700_105555992 131
276 3300035120 Ga0373957_0183851 Ga0373957_0183851_254_649 131
277 3300036401 Ga0373937_0351451 Ga0373937_0351451_947_1342 131
278 3300048903 Ga0496100_1347747 Ga0496100_1347747_56_451 131
279 3300048911 Ga0496108_0000835 Ga0496108_0000835_2451_2846 131
280 3300048912 Ga0496109_0005707 Ga0496109_0005707_1184_1579 131
281 3300048913 Ga0496110_0000379 Ga0496110_0000379_8826_9221 131
282 3300048914 Ga0496111_0012963 Ga0496111_0012963_1119_1514 131
283 3300048915 Ga0496112_0149887 Ga0496112_0149887_1344_1739 131
284 3300048916 Ga0496113_0255194 Ga0496113_0255194_658_1053 131
285 3300050507 nmdc:mga05p37_1045547_c1 nmdc:mga05p37_1045547_c1_212_607 131
286 3300050508 nmdc:mga09592_125827_c1 nmdc:mga09592_125827_c1_847_1242 131
287 3300050509 nmdc:mga0qj67_164021_c1 nmdc:mga0qj67_164021_c1_664_1059 131
288 3300053084 Ga0495595_0211074 Ga0495595_0211074_538_933 131
289 3300053085 Ga0495619_0968226 Ga0495619_0968226_140_535 131
290 3300005406 Ga0070703_10022570 Ga0070703_100225703 132
291 3300005440 Ga0070705_100694308 Ga0070705_1006943082 132
292 3300005444 Ga0070694_100930987 Ga0070694_1009309871 132
293 3300005545 Ga0070695_100217297 Ga0070695_1002172972 132
294 3300005546 Ga0070696_100334625 Ga0070696_1003346252 132
295 3300009148 Ga0105243_10008835 Ga0105243_100088358 132
296 3300009176 Ga0105242_10350892 Ga0105242_103508921 132
297 3300025934 Ga0207686_10298479 Ga0207686_102984792 132
298 3300003320 rootH2_10340526 rootH2_103405262 134
299 3300005444 Ga0070694_100145095 Ga0070694_1001450952 134
300 3300005545 Ga0070695_100002021 Ga0070695_1000020216 134
301 3300005547 Ga0070693_101239169 Ga0070693_1012391691 134
302 3300005549 Ga0070704_100297363 Ga0070704_1002973633 134
303 3300005843 Ga0068860_100315647 Ga0068860_1003156472 134
304 3300035114 Ga0373939_0015281 Ga0373939_0015281_1206_1610 134
305 3300042012 Ga0439455_0237133 Ga0439455_0237133_46_450 134
306 3300042876 Ga0451577_0041582 Ga0451577_0041582_1892_2296 134
307 3300049572 Ga0501036_0406415 Ga0501036_0406415_561_965 134
308 3300049578 Ga0501042_0474450 Ga0501042_0474450_161_565 134
309 3300049741 Ga0501079_0715995 Ga0501079_0715995_214_618 134
310 3300060353 Ga0501082_0250250 Ga0501082_0250250_502_906 134

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8515 27 124
2qdr-assembly1.cif.gz_A crystal structure of a putative dioxygenase (npun_f5605) from nostoc punctiforme pcc 73102 at 2.60 a resolution 0.848 19 124
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.8478 46 124
2q1z-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.8264 15 121
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8196 28 122
ID Description Score Start End Superfamily
2qdrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8458 19 124 2.60.120.10
1sefA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7888 27 122 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7826 46 122 2.60.120.10
2ozjB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7787 31 124 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7769 9 122 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A833LPJ2-F1-model_v4 Cupin 0.9905 15 124
AF-A0A536SI27-F1-model_v4 Cupin 0.99 4 124
AF-A0A4Q8QX69-F1-model_v4 Cupin 0.9891 59 124
AF-A0A848Y6P2-F1-model_v4 Cupin 0.9872 38 124
AF-A0A177R1U6-F1-model_v4 Cupin 0.9858 4 124

Feature Viewer

pLDDT pTM Quality
91.61 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map