F400914
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 203 | 309 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_1704881|Ga0501034_1704881_97_468 |
| Length | 123 |
| Sequence | MGVNKKHDEFHTLAMDQGWEVPPGYPPGIQQKILSGGLDEAKRAGSRTRLLRFKPGAFTTEPFVHEYWEEVFLVEGELVVGSANSAEAFSPFTYACRPPGAYHGPFRSEAGCLLLEIHYFDPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 60 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 64 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 85 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 86 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 97 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 98 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 103 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 116 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 117 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 185 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 188 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 189 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 191 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 192 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 193 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 194 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 195 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 196 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 199 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 200 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.74 |
| Nodule | 0 |
| Rhizoplane | 4.19 |
| Rhizosphere | 78.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10340526 | 3300003320 | Bacteria | 1065 |
| 2 | Ga0070666_10060849 | 3300005335 | Bacteria | 2556 |
| 3 | Ga0070669_102012397 | 3300005353 | Unclassified | 505 |
| 4 | Ga0070671_100227640 | 3300005355 | Bacteria | 1582 |
| 5 | Ga0070674_101212339 | 3300005356 | Unclassified | 670 |
| 6 | Ga0070673_100750020 | 3300005364 | Unclassified | 899 |
| 7 | Ga0070659_100166334 | 3300005366 | Bacteria | 1805 |
| 8 | Ga0070703_10022570 | 3300005406 | Bacteria | 1848 |
| 9 | Ga0070709_10267018 | 3300005434 | Unclassified | 1239 |
| 10 | Ga0070709_10289582 | 3300005434 | Bacteria | 1193 |
| 11 | Ga0070709_10436704 | 3300005434 | Bacteria | 984 |
| 12 | Ga0070714_100024958 | 3300005435 | Bacteria | 4929 |
| 13 | Ga0070714_100309625 | 3300005435 | Bacteria | 1474 |
| 14 | Ga0070714_100773209 | 3300005435 | Bacteria | 929 |
| 15 | Ga0070713_100160090 | 3300005436 | Unclassified | 2009 |
| 16 | Ga0070713_100370015 | 3300005436 | Bacteria | 1333 |
| 17 | Ga0070713_100779150 | 3300005436 | Unclassified | 916 |
| 18 | Ga0070713_100846417 | 3300005436 | Bacteria | 878 |
| 19 | Ga0070710_10003275 | 3300005437 | Bacteria | 7679 |
| 20 | Ga0070710_11051463 | 3300005437 | Bacteria | 596 |
| 21 | Ga0070711_100011962 | 3300005439 | Bacteria | 5405 |
| 22 | Ga0070711_100346993 | 3300005439 | Bacteria | 1193 |
| 23 | Ga0070711_100718499 | 3300005439 | Bacteria | 842 |
| 24 | Ga0070711_101776480 | 3300005439 | Unclassified | 541 |
| 25 | Ga0070705_100694308 | 3300005440 | Bacteria | 798 |
| 26 | Ga0070694_100145095 | 3300005444 | Bacteria | 1728 |
| 27 | Ga0070694_100930987 | 3300005444 | Bacteria | 719 |
| 28 | Ga0070681_10006879 | 3300005458 | Bacteria | 11070 |
| 29 | Ga0070707_100230033 | 3300005468 | Bacteria | 1805 |
| 30 | Ga0070698_100001353 | 3300005471 | Bacteria | 27266 |
| 31 | Ga0070699_100787579 | 3300005518 | Bacteria | 870 |
| 32 | Ga0070697_100424214 | 3300005536 | Bacteria | 1156 |
| 33 | Ga0070695_100002021 | 3300005545 | Bacteria | 11577 |
| 34 | Ga0070695_100217297 | 3300005545 | Unclassified | 1375 |
| 35 | Ga0070696_100274044 | 3300005546 | Bacteria | 1284 |
| 36 | Ga0070696_100334625 | 3300005546 | Unclassified | 1169 |
| 37 | Ga0070693_101239169 | 3300005547 | Unclassified | 574 |
| 38 | Ga0070704_100297363 | 3300005549 | Bacteria | 1344 |
| 39 | Ga0070664_100169455 | 3300005564 | Bacteria | 1936 |
| 40 | Ga0068856_100184716 | 3300005614 | Bacteria | 2098 |
| 41 | Ga0068856_100570520 | 3300005614 | Bacteria | 1153 |
| 42 | Ga0068863_100356077 | 3300005841 | Bacteria | 1426 |
| 43 | Ga0068858_101789742 | 3300005842 | Bacteria | 607 |
| 44 | Ga0068860_100315647 | 3300005843 | Bacteria | 1533 |
| 45 | Ga0081455_10008425 | 3300005937 | Bacteria | 10724 |
| 46 | Ga0070717_10000398 | 3300006028 | Bacteria | 27863 |
| 47 | Ga0070717_10014369 | 3300006028 | Bacteria | 6092 |
| 48 | Ga0070717_10235603 | 3300006028 | Bacteria | 1613 |
| 49 | Ga0075432_10093293 | 3300006058 | Bacteria | 1104 |
| 50 | Ga0070715_10001174 | 3300006163 | Bacteria | 7514 |
| 51 | Ga0070715_10226372 | 3300006163 | Bacteria | 964 |
| 52 | Ga0070716_100034542 | 3300006173 | Bacteria | 2774 |
| 53 | Ga0070716_100245168 | 3300006173 | Bacteria | 1217 |
| 54 | Ga0070716_100930447 | 3300006173 | Unclassified | 683 |
| 55 | Ga0070712_100125464 | 3300006175 | Bacteria | 1938 |
| 56 | Ga0070712_100429265 | 3300006175 | Bacteria | 1097 |
| 57 | Ga0075369_10157728 | 3300006186 | Unclassified | 1039 |
| 58 | Ga0075366_10644659 | 3300006195 | Bacteria | 657 |
| 59 | Ga0075428_101177106 | 3300006844 | Unclassified | 808 |
| 60 | Ga0075428_102528664 | 3300006844 | Bacteria | 525 |
| 61 | Ga0075431_100073668 | 3300006847 | Bacteria | 3523 |
| 62 | Ga0075431_100704606 | 3300006847 | Bacteria | 987 |
| 63 | Ga0075433_10756802 | 3300006852 | Unclassified | 850 |
| 64 | Ga0075434_100232660 | 3300006871 | Bacteria | 1862 |
| 65 | Ga0075429_100120456 | 3300006880 | Unclassified | 2294 |
| 66 | Ga0075436_100888745 | 3300006914 | Bacteria | 666 |
| 67 | Ga0075435_100113076 | 3300007076 | Bacteria | 2259 |
| 68 | Ga0111539_10435848 | 3300009094 | Bacteria | 1526 |
| 69 | Ga0114129_10115221 | 3300009147 | Bacteria | 3705 |
| 70 | Ga0114129_10206546 | 3300009147 | Bacteria | 2657 |
| 71 | Ga0114129_10593499 | 3300009147 | Bacteria | 1436 |
| 72 | Ga0114129_10929741 | 3300009147 | Bacteria | 1100 |
| 73 | Ga0105243_10008835 | 3300009148 | Bacteria | 7715 |
| 74 | Ga0105241_10618093 | 3300009174 | Bacteria | 981 |
| 75 | Ga0105242_10350892 | 3300009176 | Bacteria | 1362 |
| 76 | Ga0105242_10495584 | 3300009176 | Bacteria | 1161 |
| 77 | Ga0105242_11166915 | 3300009176 | Bacteria | 788 |
| 78 | Ga0105248_10514090 | 3300009177 | Bacteria | 1350 |
| 79 | Ga0105237_10754884 | 3300009545 | Unclassified | 979 |
| 80 | Ga0105249_12790261 | 3300009553 | Bacteria | 560 |
| 81 | Ga0105246_10820892 | 3300011119 | Unclassified | 827 |
| 82 | Ga0163162_11206514 | 3300013306 | Unclassified | 859 |
| 83 | Ga0163162_13210464 | 3300013306 | Bacteria | 524 |
| 84 | Ga0157375_12248159 | 3300013308 | Unclassified | 650 |
| 85 | Ga0163163_10073347 | 3300014325 | Bacteria | 3414 |
| 86 | Ga0163163_11339502 | 3300014325 | Bacteria | 778 |
| 87 | Ga0157376_10509725 | 3300014969 | Unclassified | 1184 |
| 88 | Ga0213873_10092389 | 3300021358 | Bacteria | 861 |
| 89 | Ga0213874_10029195 | 3300021377 | Bacteria | 1581 |
| 90 | Ga0213874_10030026 | 3300021377 | Bacteria | 1564 |
| 91 | Ga0213874_10073701 | 3300021377 | Bacteria | 1094 |
| 92 | Ga0213874_10120661 | 3300021377 | Bacteria | 891 |
| 93 | Ga0213876_10301904 | 3300021384 | Bacteria | 851 |
| 94 | Ga0213875_10209385 | 3300021388 | Bacteria | 918 |
| 95 | Ga0213875_10340269 | 3300021388 | Bacteria | 712 |
| 96 | Ga0213871_10064835 | 3300021441 | Bacteria | 1023 |
| 97 | Ga0207692_10005371 | 3300025898 | Bacteria | 5131 |
| 98 | Ga0207685_10002372 | 3300025905 | Bacteria | 4296 |
| 99 | Ga0207699_10050173 | 3300025906 | Bacteria | 2459 |
| 100 | Ga0207699_10202700 | 3300025906 | Bacteria | 1345 |
| 101 | Ga0207684_10099268 | 3300025910 | Bacteria | 2487 |
| 102 | Ga0207707_10102927 | 3300025912 | Bacteria | 2496 |
| 103 | Ga0207693_10013785 | 3300025915 | Bacteria | 6508 |
| 104 | Ga0207693_10027560 | 3300025915 | Bacteria | 4490 |
| 105 | Ga0207693_10066481 | 3300025915 | Bacteria | 2822 |
| 106 | Ga0207663_10073476 | 3300025916 | Bacteria | 2213 |
| 107 | Ga0207663_10178372 | 3300025916 | Bacteria | 1515 |
| 108 | Ga0207646_10029981 | 3300025922 | Bacteria | 4939 |
| 109 | Ga0207700_10131719 | 3300025928 | Bacteria | 2042 |
| 110 | Ga0207700_10414185 | 3300025928 | Bacteria | 1183 |
| 111 | Ga0207700_10555599 | 3300025928 | Unclassified | 1019 |
| 112 | Ga0207700_11464368 | 3300025928 | Unclassified | 606 |
| 113 | Ga0207664_10116189 | 3300025929 | Bacteria | 2232 |
| 114 | Ga0207664_10479895 | 3300025929 | Bacteria | 1112 |
| 115 | Ga0207644_10287712 | 3300025931 | Bacteria | 1321 |
| 116 | Ga0207690_10259902 | 3300025932 | Bacteria | 1345 |
| 117 | Ga0207686_10298479 | 3300025934 | Bacteria | 1196 |
| 118 | Ga0207686_11437320 | 3300025934 | Unclassified | 568 |
| 119 | Ga0207665_10081869 | 3300025939 | Bacteria | 2224 |
| 120 | Ga0207711_10854625 | 3300025941 | Unclassified | 847 |
| 121 | Ga0207679_10317146 | 3300025945 | Bacteria | 1349 |
| 122 | Ga0207651_10668590 | 3300025960 | Unclassified | 913 |
| 123 | Ga0207702_10450219 | 3300026078 | Bacteria | 1249 |
| 124 | Ga0207641_10368633 | 3300026088 | Bacteria | 1373 |
| 125 | Ga0207428_10612425 | 3300027907 | Unclassified | 784 |
| 126 | Ga0265334_10024015 | 3300028573 | Bacteria | 2476 |
| 127 | Ga0265325_10224696 | 3300031241 | Bacteria | 858 |
| 128 | Ga0265340_10108006 | 3300031247 | Bacteria | 1288 |
| 129 | Ga0265331_10075696 | 3300031250 | Unclassified | 1569 |
| 130 | Ga0265331_10324638 | 3300031250 | Bacteria | 689 |
| 131 | Ga0265327_10358502 | 3300031251 | Bacteria | 636 |
| 132 | Ga0307408_100000406 | 3300031548 | Bacteria | 38727 |
| 133 | Ga0265314_10001402 | 3300031711 | Bacteria | 27034 |
| 134 | Ga0265342_10043116 | 3300031712 | Bacteria | 2724 |
| 135 | Ga0307405_10173624 | 3300031731 | Bacteria | 1540 |
| 136 | Ga0307405_10176231 | 3300031731 | Bacteria | 1530 |
| 137 | Ga0307406_10253542 | 3300031901 | Bacteria | 1327 |
| 138 | Ga0307412_10000207 | 3300031911 | Bacteria | 40047 |
| 139 | Ga0307412_10015597 | 3300031911 | Bacteria | 4510 |
| 140 | Ga0307416_100131729 | 3300032002 | Bacteria | 2252 |
| 141 | Ga0307414_10229930 | 3300032004 | Bacteria | 1528 |
| 142 | Ga0307411_10000086 | 3300032005 | Bacteria | 28813 |
| 143 | Ga0307411_10192576 | 3300032005 | Bacteria | 1558 |
| 144 | Ga0373934_0003919 | 3300035086 | Bacteria | 5467 |
| 145 | Ga0373939_0015281 | 3300035114 | Bacteria | 2007 |
| 146 | Ga0373954_0004243 | 3300035118 | Bacteria | 6158 |
| 147 | Ga0373954_0231581 | 3300035118 | Bacteria | 909 |
| 148 | Ga0373956_0000584 | 3300035119 | Bacteria | 14945 |
| 149 | Ga0373956_0185401 | 3300035119 | Unclassified | 984 |
| 150 | Ga0373957_0024429 | 3300035120 | Bacteria | 2170 |
| 151 | Ga0373957_0025642 | 3300035120 | Bacteria | 2126 |
| 152 | Ga0373957_0183851 | 3300035120 | Unclassified | 867 |
| 153 | Ga0373955_0030373 | 3300035172 | Bacteria | 2820 |
| 154 | Ga0373955_0035088 | 3300035172 | Bacteria | 2654 |
| 155 | Ga0373955_0787172 | 3300035172 | Bacteria | 584 |
| 156 | Ga0373931_0643572 | 3300035691 | Bacteria | 696 |
| 157 | Ga0373935_0125178 | 3300035692 | Bacteria | 1721 |
| 158 | Ga0373935_0171258 | 3300035692 | Bacteria | 1485 |
| 159 | Ga0373927_0557219 | 3300035695 | Unclassified | 757 |
| 160 | Ga0373933_0000759 | 3300035724 | Bacteria | 19748 |
| 161 | Ga0373933_0007330 | 3300035724 | Bacteria | 6018 |
| 162 | Ga0373933_0554278 | 3300035724 | Bacteria | 754 |
| 163 | Ga0373937_0000931 | 3300036401 | Bacteria | 24797 |
| 164 | Ga0373937_0009125 | 3300036401 | Bacteria | 8607 |
| 165 | Ga0373937_0151134 | 3300036401 | Bacteria | 2175 |
| 166 | Ga0373937_0351451 | 3300036401 | Unclassified | 1396 |
| 167 | Ga0373925_0153164 | 3300037068 | Bacteria | 1812 |
| 168 | Ga0373925_0344517 | 3300037068 | Unclassified | 1209 |
| 169 | Ga0436364_0068638 | 3300037853 | Bacteria | 9742 |
| 170 | Ga0436364_0225243 | 3300037853 | Bacteria | 951 |
| 171 | Ga0436364_0535544 | 3300037853 | Bacteria | 2499 |
| 172 | Ga0436364_0974297 | 3300037853 | Bacteria | 2298 |
| 173 | Ga0436364_1214805 | 3300037853 | Bacteria | 741 |
| 174 | Ga0436364_1406937 | 3300037853 | Bacteria | 1200 |
| 175 | Ga0436365_0257297 | 3300039437 | Bacteria | 853 |
| 176 | Ga0436365_1138345 | 3300039437 | Bacteria | 1469 |
| 177 | Ga0436365_1326572 | 3300039437 | Unclassified | 1474 |
| 178 | Ga0436360_0288511 | 3300039438 | Bacteria | 573 |
| 179 | Ga0436360_0627708 | 3300039438 | Bacteria | 1952 |
| 180 | Ga0436360_0705875 | 3300039438 | Bacteria | 983 |
| 181 | Ga0436360_0996139 | 3300039438 | Bacteria | 1060 |
| 182 | Ga0436363_0180174 | 3300039450 | Bacteria | 1718 |
| 183 | Ga0436363_0360075 | 3300039450 | Bacteria | 868 |
| 184 | Ga0436363_0523233 | 3300039450 | Bacteria | 2396 |
| 185 | Ga0436363_0666119 | 3300039450 | Bacteria | 940 |
| 186 | Ga0436363_0878951 | 3300039450 | Bacteria | 1367 |
| 187 | Ga0436363_0908748 | 3300039450 | Bacteria | 765 |
| 188 | Ga0436363_1245511 | 3300039450 | Bacteria | 1101 |
| 189 | Ga0436363_1495593 | 3300039450 | Bacteria | 863 |
| 190 | Ga0436363_1654339 | 3300039450 | Bacteria | 4840 |
| 191 | Ga0436362_0782961 | 3300039453 | Bacteria | 3937 |
| 192 | Ga0436362_0906540 | 3300039453 | Bacteria | 1042 |
| 193 | Ga0439455_0237133 | 3300042012 | Bacteria | 532 |
| 194 | Ga0451577_0041582 | 3300042876 | Bacteria | 4126 |
| 195 | Ga0466972_0027862 | 3300044658 | Bacteria | 2793 |
| 196 | Ga0466966_0427173 | 3300044684 | Bacteria | 796 |
| 197 | Ga0466966_0751620 | 3300044684 | Bacteria | 588 |
| 198 | Ga0466960_0097634 | 3300044901 | Bacteria | 1508 |
| 199 | Ga0466958_1130794 | 3300045836 | Unclassified | 511 |
| 200 | Ga0466967_0813332 | 3300045976 | Bacteria | 928 |
| 201 | Ga0495592_0339033 | 3300046454 | Unclassified | 967 |
| 202 | Ga0495651_0000314 | 3300046462 | Bacteria | 37543 |
| 203 | Ga0495651_0181984 | 3300046462 | Bacteria | 1487 |
| 204 | Ga0495653_0299673 | 3300046463 | Bacteria | 1049 |
| 205 | Ga0495580_0100345 | 3300046472 | Bacteria | 2014 |
| 206 | Ga0495608_0019425 | 3300046511 | Bacteria | 4676 |
| 207 | Ga0495637_0271373 | 3300046520 | Bacteria | 607 |
| 208 | Ga0495640_0584315 | 3300046533 | Bacteria | 675 |
| 209 | Ga0495667_0004361 | 3300046559 | Bacteria | 9553 |
| 210 | Ga0495667_0199869 | 3300046559 | Unclassified | 1279 |
| 211 | Ga0495634_0110951 | 3300046642 | Bacteria | 1764 |
| 212 | Ga0495635_0084773 | 3300046663 | Bacteria | 2168 |
| 213 | Ga0495657_0147762 | 3300046675 | Bacteria | 1461 |
| 214 | Ga0495646_0454488 | 3300046680 | Bacteria | 661 |
| 215 | Ga0495671_0217250 | 3300046692 | Bacteria | 926 |
| 216 | Ga0495581_0252071 | 3300047315 | Bacteria | 1032 |
| 217 | Ga0495636_0029285 | 3300047318 | Bacteria | 2247 |
| 218 | Ga0495674_0016457 | 3300047319 | Bacteria | 6898 |
| 219 | Ga0495680_0009764 | 3300047322 | Bacteria | 8608 |
| 220 | Ga0495602_0069011 | 3300048088 | Bacteria | 3033 |
| 221 | Ga0496100_1347747 | 3300048903 | Bacteria | 563 |
| 222 | Ga0496102_0598233 | 3300048905 | Bacteria | 1026 |
| 223 | Ga0496104_1752786 | 3300048907 | Unclassified | 523 |
| 224 | Ga0496107_1059618 | 3300048910 | Unclassified | 587 |
| 225 | Ga0496108_0000835 | 3300048911 | Bacteria | 23948 |
| 226 | Ga0496109_0005707 | 3300048912 | Bacteria | 10416 |
| 227 | Ga0496110_0000379 | 3300048913 | Bacteria | 29816 |
| 228 | Ga0496110_0029405 | 3300048913 | Bacteria | 4729 |
| 229 | Ga0496110_0072736 | 3300048913 | Bacteria | 3051 |
| 230 | Ga0496111_0012963 | 3300048914 | Bacteria | 5658 |
| 231 | Ga0496112_0149887 | 3300048915 | Bacteria | 2299 |
| 232 | Ga0496113_0255194 | 3300048916 | Bacteria | 1400 |
| 233 | Ga0496114_1039957 | 3300048917 | Unclassified | 703 |
| 234 | Ga0496118_0571023 | 3300048921 | Bacteria | 547 |
| 235 | Ga0496126_0092089 | 3300048929 | Bacteria | 2664 |
| 236 | Ga0496126_0305209 | 3300048929 | Unclassified | 1312 |
| 237 | Ga0501034_0378418 | 3300049571 | Bacteria | 1341 |
| 238 | Ga0501034_1704881 | 3300049571 | Bacteria | 502 |
| 239 | Ga0501036_0406415 | 3300049572 | Bacteria | 1136 |
| 240 | Ga0501037_0686080 | 3300049573 | Bacteria | 682 |
| 241 | Ga0501038_0193488 | 3300049574 | Unclassified | 1636 |
| 242 | Ga0501042_0474450 | 3300049578 | Bacteria | 908 |
| 243 | Ga0501043_0651756 | 3300049579 | Unclassified | 773 |
| 244 | Ga0501046_0086337 | 3300049580 | Bacteria | 2419 |
| 245 | Ga0501046_0615492 | 3300049580 | Unclassified | 770 |
| 246 | Ga0501047_1106785 | 3300049581 | Bacteria | 605 |
| 247 | Ga0501068_0144303 | 3300049584 | Bacteria | 1494 |
| 248 | Ga0501070_0027720 | 3300049586 | Bacteria | 4752 |
| 249 | Ga0501070_0195522 | 3300049586 | Bacteria | 1661 |
| 250 | Ga0501073_0645071 | 3300049589 | Bacteria | 731 |
| 251 | Ga0501074_1249317 | 3300049590 | Bacteria | 521 |
| 252 | Ga0501077_0007955 | 3300049593 | Bacteria | 6552 |
| 253 | Ga0501079_0177196 | 3300049741 | Bacteria | 1663 |
| 254 | Ga0501079_0715995 | 3300049741 | Bacteria | 788 |
| 255 | Ga0501080_0838155 | 3300049742 | Bacteria | 804 |
| 256 | Ga0501081_0049680 | 3300049743 | Bacteria | 2889 |
| 257 | Ga0501035_0006037 | 3300049822 | Bacteria | 11406 |
| 258 | Ga0501044_0005411 | 3300049823 | Bacteria | 14184 |
| 259 | Ga0501045_0228457 | 3300049824 | Bacteria | 1385 |
| 260 | Ga0501045_1353277 | 3300049824 | Bacteria | 518 |
| 261 | nmdc:mga0yw44_302219_c1 | 3300050492 | Bacteria | 1072 |
| 262 | nmdc:mga0k408_589316_c1 | 3300050493 | Bacteria | 656 |
| 263 | nmdc:mga07m45_441071_c1 | 3300050496 | Bacteria | 755 |
| 264 | nmdc:mga07m45_786159_c1 | 3300050496 | Bacteria | 546 |
| 265 | nmdc:mga05p37_1045547_c1 | 3300050507 | Bacteria | 862 |
| 266 | nmdc:mga05p37_1460673_c1 | 3300050507 | Bacteria | 684 |
| 267 | nmdc:mga05p37_160126_c1 | 3300050507 | Bacteria | 2750 |
| 268 | nmdc:mga05p37_34686_c1 | 3300050507 | Bacteria | 6181 |
| 269 | nmdc:mga05p37_483738_c1 | 3300050507 | Bacteria | 1425 |
| 270 | nmdc:mga05p37_488981_c1 | 3300050507 | Bacteria | 1415 |
| 271 | nmdc:mga05p37_620249_c1 | 3300050507 | Bacteria | 1217 |
| 272 | nmdc:mga09592_125827_c1 | 3300050508 | Unclassified | 2203 |
| 273 | nmdc:mga0qj67_164021_c1 | 3300050509 | Unclassified | 1804 |
| 274 | nmdc:mga06r32_1376613_c1 | 3300050510 | Bacteria | 648 |
| 275 | nmdc:mga08y16_762162_c1 | 3300050511 | Bacteria | 963 |
| 276 | nmdc:mga0n895_123509_c1 | 3300050512 | Bacteria | 2611 |
| 277 | nmdc:mga0n895_1787453_c1 | 3300050512 | Unclassified | 576 |
| 278 | nmdc:mga0n895_430685_c1 | 3300050512 | Bacteria | 1333 |
| 279 | nmdc:mga0rr50_1053701_c1 | 3300050513 | Unclassified | 692 |
| 280 | nmdc:mga0sz30_144208_c1 | 3300050516 | Unclassified | 1052 |
| 281 | Ga0495601_0040562 | 3300053077 | Bacteria | 2916 |
| 282 | Ga0495601_0763048 | 3300053077 | Unclassified | 615 |
| 283 | Ga0500635_0001189 | 3300053080 | Bacteria | 6238 |
| 284 | Ga0495595_0066085 | 3300053084 | Bacteria | 1702 |
| 285 | Ga0495595_0141276 | 3300053084 | Bacteria | 1181 |
| 286 | Ga0495595_0211074 | 3300053084 | Unclassified | 968 |
| 287 | Ga0495619_0078791 | 3300053085 | Bacteria | 2215 |
| 288 | Ga0495619_0968226 | 3300053085 | Unclassified | 570 |
| 289 | Ga0495619_0997331 | 3300053085 | Unclassified | 560 |
| 290 | Ga0500578_0565779 | 3300053086 | Bacteria | 630 |
| 291 | Ga0500643_006784 | 3300053087 | Bacteria | 4722 |
| 292 | Ga0500644_0000856 | 3300053088 | Bacteria | 9989 |
| 293 | Ga0500651_0004404 | 3300053093 | Bacteria | 7877 |
| 294 | Ga0500651_0166281 | 3300053093 | Bacteria | 1317 |
| 295 | Ga0500650_0377582 | 3300053098 | Unclassified | 616 |
| 296 | Ga0500594_0066910 | 3300053118 | Unclassified | 1048 |
| 297 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 298 | Ga0500642_0086412 | 3300053130 | Bacteria | 1446 |
| 299 | Ga0500652_031333 | 3300053131 | Bacteria | 2085 |
| 300 | Ga0500655_014278 | 3300053133 | Bacteria | 1453 |
| 301 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 302 | Ga0500639_065737 | 3300053163 | Bacteria | 1860 |
| 303 | Ga0500637_0008502 | 3300053178 | Bacteria | 5182 |
| 304 | Ga0500645_000291 | 3300053730 | Bacteria | 35819 |
| 305 | Ga0500645_202517 | 3300053730 | Bacteria | 535 |
| 306 | Ga0501084_0841633 | 3300054114 | Bacteria | 772 |
| 307 | Ga0501082_0250250 | 3300060353 | Bacteria | 1542 |
| 308 | Ga0501082_1604181 | 3300060353 | Bacteria | 568 |
| 309 | Ga0530510_0498904 | 3300061734 | Bacteria | 923 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_1752786 | Ga0496104_1752786_174_506 | 110 |
| 2 | 3300035691 | Ga0373931_0643572 | Ga0373931_0643572_344_679 | 111 |
| 3 | 3300035724 | Ga0373933_0554278 | Ga0373933_0554278_42_380 | 112 |
| 4 | 3300037068 | Ga0373925_0344517 | Ga0373925_0344517_566_904 | 112 |
| 5 | 3300006163 | Ga0070715_10226372 | Ga0070715_102263722 | 115 |
| 6 | 3300005434 | Ga0070709_10267018 | Ga0070709_102670182 | 123 |
| 7 | 3300005436 | Ga0070713_100160090 | Ga0070713_1001600903 | 123 |
| 8 | 3300006847 | Ga0075431_100704606 | Ga0075431_1007046062 | 123 |
| 9 | 3300025915 | Ga0207693_10066481 | Ga0207693_100664813 | 123 |
| 10 | 3300025928 | Ga0207700_10131719 | Ga0207700_101317192 | 123 |
| 11 | 3300049571 | Ga0501034_1704881 | Ga0501034_1704881_97_468 | 123 |
| 12 | 3300049579 | Ga0501043_0651756 | Ga0501043_0651756_352_723 | 123 |
| 13 | 3300049584 | Ga0501068_0144303 | Ga0501068_0144303_598_969 | 123 |
| 14 | 3300049586 | Ga0501070_0027720 | Ga0501070_0027720_4019_4390 | 123 |
| 15 | 3300049589 | Ga0501073_0645071 | Ga0501073_0645071_142_513 | 123 |
| 16 | 3300049742 | Ga0501080_0838155 | Ga0501080_0838155_146_517 | 123 |
| 17 | 3300005353 | Ga0070669_102012397 | Ga0070669_1020123971 | 124 |
| 18 | 3300005356 | Ga0070674_101212339 | Ga0070674_1012123392 | 124 |
| 19 | 3300005366 | Ga0070659_100166334 | Ga0070659_1001663342 | 124 |
| 20 | 3300005435 | Ga0070714_100773209 | Ga0070714_1007732091 | 124 |
| 21 | 3300005564 | Ga0070664_100169455 | Ga0070664_1001694552 | 124 |
| 22 | 3300005841 | Ga0068863_100356077 | Ga0068863_1003560772 | 124 |
| 23 | 3300011119 | Ga0105246_10820892 | Ga0105246_108208922 | 124 |
| 24 | 3300013306 | Ga0163162_11206514 | Ga0163162_112065142 | 124 |
| 25 | 3300014325 | Ga0163163_11339502 | Ga0163163_113395022 | 124 |
| 26 | 3300025932 | Ga0207690_10259902 | Ga0207690_102599022 | 124 |
| 27 | 3300025945 | Ga0207679_10317146 | Ga0207679_103171461 | 124 |
| 28 | 3300026088 | Ga0207641_10368633 | Ga0207641_103686331 | 124 |
| 29 | 3300027907 | Ga0207428_10612425 | Ga0207428_106124252 | 124 |
| 30 | 3300031250 | Ga0265331_10075696 | Ga0265331_100756962 | 124 |
| 31 | 3300035118 | Ga0373954_0004243 | Ga0373954_0004243_3634_4065 | 124 |
| 32 | 3300035119 | Ga0373956_0185401 | Ga0373956_0185401_72_503 | 124 |
| 33 | 3300035120 | Ga0373957_0025642 | Ga0373957_0025642_1114_1545 | 124 |
| 34 | 3300035172 | Ga0373955_0030373 | Ga0373955_0030373_1475_1906 | 124 |
| 35 | 3300035724 | Ga0373933_0007330 | Ga0373933_0007330_4626_5057 | 124 |
| 36 | 3300036401 | Ga0373937_0009125 | Ga0373937_0009125_2475_2906 | 124 |
| 37 | 3300046559 | Ga0495667_0199869 | Ga0495667_0199869_531_962 | 124 |
| 38 | 3300048913 | Ga0496110_0072736 | Ga0496110_0072736_1367_1741 | 124 |
| 39 | 3300053077 | Ga0495601_0040562 | Ga0495601_0040562_559_990 | 124 |
| 40 | 3300053084 | Ga0495595_0066085 | Ga0495595_0066085_628_1059 | 124 |
| 41 | 3300053085 | Ga0495619_0078791 | Ga0495619_0078791_1110_1541 | 124 |
| 42 | iso_pu_bacteria | 2643221672 | 2644401315 | 124 |
| 43 | 3300005335 | Ga0070666_10060849 | Ga0070666_100608491 | 125 |
| 44 | 3300005355 | Ga0070671_100227640 | Ga0070671_1002276404 | 125 |
| 45 | 3300005364 | Ga0070673_100750020 | Ga0070673_1007500201 | 125 |
| 46 | 3300005435 | Ga0070714_100309625 | Ga0070714_1003096252 | 125 |
| 47 | 3300005437 | Ga0070710_11051463 | Ga0070710_110514631 | 125 |
| 48 | 3300005439 | Ga0070711_100346993 | Ga0070711_1003469932 | 125 |
| 49 | 3300005439 | Ga0070711_100718499 | Ga0070711_1007184992 | 125 |
| 50 | 3300005439 | Ga0070711_101776480 | Ga0070711_1017764801 | 125 |
| 51 | 3300005468 | Ga0070707_100230033 | Ga0070707_1002300332 | 125 |
| 52 | 3300005471 | Ga0070698_100001353 | Ga0070698_10000135332 | 125 |
| 53 | 3300005518 | Ga0070699_100787579 | Ga0070699_1007875791 | 125 |
| 54 | 3300005536 | Ga0070697_100424214 | Ga0070697_1004242143 | 125 |
| 55 | 3300005614 | Ga0068856_100570520 | Ga0068856_1005705201 | 125 |
| 56 | 3300005842 | Ga0068858_101789742 | Ga0068858_1017897422 | 125 |
| 57 | 3300006028 | Ga0070717_10000398 | Ga0070717_1000039832 | 125 |
| 58 | 3300006175 | Ga0070712_100429265 | Ga0070712_1004292651 | 125 |
| 59 | 3300009176 | Ga0105242_10495584 | Ga0105242_104955842 | 125 |
| 60 | 3300009177 | Ga0105248_10514090 | Ga0105248_105140902 | 125 |
| 61 | 3300014969 | Ga0157376_10509725 | Ga0157376_105097253 | 125 |
| 62 | 3300021377 | Ga0213874_10030026 | Ga0213874_100300262 | 125 |
| 63 | 3300021377 | Ga0213874_10073701 | Ga0213874_100737012 | 125 |
| 64 | 3300021384 | Ga0213876_10301904 | Ga0213876_103019042 | 125 |
| 65 | 3300025910 | Ga0207684_10099268 | Ga0207684_100992682 | 125 |
| 66 | 3300025915 | Ga0207693_10027560 | Ga0207693_100275605 | 125 |
| 67 | 3300025916 | Ga0207663_10178372 | Ga0207663_101783723 | 125 |
| 68 | 3300025922 | Ga0207646_10029981 | Ga0207646_100299812 | 125 |
| 69 | 3300025929 | Ga0207664_10116189 | Ga0207664_101161892 | 125 |
| 70 | 3300025929 | Ga0207664_10479895 | Ga0207664_104798952 | 125 |
| 71 | 3300025931 | Ga0207644_10287712 | Ga0207644_102877122 | 125 |
| 72 | 3300025934 | Ga0207686_11437320 | Ga0207686_114373202 | 125 |
| 73 | 3300025941 | Ga0207711_10854625 | Ga0207711_108546252 | 125 |
| 74 | 3300025960 | Ga0207651_10668590 | Ga0207651_106685902 | 125 |
| 75 | 3300026078 | Ga0207702_10450219 | Ga0207702_104502192 | 125 |
| 76 | 3300031241 | Ga0265325_10224696 | Ga0265325_102246962 | 125 |
| 77 | 3300037853 | Ga0436364_0535544 | Ga0436364_0535544_687_1064 | 125 |
| 78 | 3300037853 | Ga0436364_1214805 | Ga0436364_1214805_245_622 | 125 |
| 79 | 3300037853 | Ga0436364_1406937 | Ga0436364_1406937_560_937 | 125 |
| 80 | 3300039437 | Ga0436365_0257297 | Ga0436365_0257297_204_581 | 125 |
| 81 | 3300039438 | Ga0436360_0288511 | Ga0436360_0288511_102_563 | 125 |
| 82 | 3300039438 | Ga0436360_0996139 | Ga0436360_0996139_32_433 | 125 |
| 83 | 3300039450 | Ga0436363_0360075 | Ga0436363_0360075_397_774 | 125 |
| 84 | 3300039450 | Ga0436363_0523233 | Ga0436363_0523233_1764_2141 | 125 |
| 85 | 3300045976 | Ga0466967_0813332 | Ga0466967_0813332_99_476 | 125 |
| 86 | 3300048910 | Ga0496107_1059618 | Ga0496107_1059618_80_457 | 125 |
| 87 | 3300050507 | nmdc:mga05p37_1460673_c1 | nmdc:mga05p37_1460673_c1_158_535 | 125 |
| 88 | 3300053077 | Ga0495601_0763048 | Ga0495601_0763048_82_459 | 125 |
| 89 | 3300005434 | Ga0070709_10436704 | Ga0070709_104367042 | 126 |
| 90 | 3300005436 | Ga0070713_100846417 | Ga0070713_1008464172 | 126 |
| 91 | 3300006028 | Ga0070717_10235603 | Ga0070717_102356032 | 126 |
| 92 | 3300006173 | Ga0070716_100245168 | Ga0070716_1002451682 | 126 |
| 93 | 3300006173 | Ga0070716_100930447 | Ga0070716_1009304471 | 126 |
| 94 | 3300006186 | Ga0075369_10157728 | Ga0075369_101577282 | 126 |
| 95 | 3300006195 | Ga0075366_10644659 | Ga0075366_106446591 | 126 |
| 96 | 3300009147 | Ga0114129_10593499 | Ga0114129_105934992 | 126 |
| 97 | 3300009553 | Ga0105249_12790261 | Ga0105249_127902611 | 126 |
| 98 | 3300014325 | Ga0163163_10073347 | Ga0163163_100733474 | 126 |
| 99 | 3300021358 | Ga0213873_10092389 | Ga0213873_100923891 | 126 |
| 100 | 3300021377 | Ga0213874_10029195 | Ga0213874_100291952 | 126 |
| 101 | 3300021377 | Ga0213874_10120661 | Ga0213874_101206612 | 126 |
| 102 | 3300021388 | Ga0213875_10209385 | Ga0213875_102093852 | 126 |
| 103 | 3300021388 | Ga0213875_10340269 | Ga0213875_103402692 | 126 |
| 104 | 3300025906 | Ga0207699_10202700 | Ga0207699_102027002 | 126 |
| 105 | 3300025928 | Ga0207700_10414185 | Ga0207700_104141852 | 126 |
| 106 | 3300025939 | Ga0207665_10081869 | Ga0207665_100818691 | 126 |
| 107 | 3300031250 | Ga0265331_10324638 | Ga0265331_103246381 | 126 |
| 108 | 3300031251 | Ga0265327_10358502 | Ga0265327_103585022 | 126 |
| 109 | 3300031711 | Ga0265314_10001402 | Ga0265314_1000140232 | 126 |
| 110 | 3300031712 | Ga0265342_10043116 | Ga0265342_100431163 | 126 |
| 111 | 3300035118 | Ga0373954_0231581 | Ga0373954_0231581_160_540 | 126 |
| 112 | 3300035172 | Ga0373955_0787172 | Ga0373955_0787172_126_506 | 126 |
| 113 | 3300035692 | Ga0373935_0125178 | Ga0373935_0125178_138_518 | 126 |
| 114 | 3300035692 | Ga0373935_0171258 | Ga0373935_0171258_441_821 | 126 |
| 115 | 3300035695 | Ga0373927_0557219 | Ga0373927_0557219_350_730 | 126 |
| 116 | 3300036401 | Ga0373937_0151134 | Ga0373937_0151134_921_1301 | 126 |
| 117 | 3300037068 | Ga0373925_0153164 | Ga0373925_0153164_1195_1575 | 126 |
| 118 | 3300037853 | Ga0436364_0068638 | Ga0436364_0068638_3322_3702 | 126 |
| 119 | 3300037853 | Ga0436364_0225243 | Ga0436364_0225243_522_902 | 126 |
| 120 | 3300037853 | Ga0436364_0974297 | Ga0436364_0974297_1776_2156 | 126 |
| 121 | 3300039437 | Ga0436365_1138345 | Ga0436365_1138345_98_478 | 126 |
| 122 | 3300039437 | Ga0436365_1326572 | Ga0436365_1326572_385_765 | 126 |
| 123 | 3300039450 | Ga0436363_0180174 | Ga0436363_0180174_909_1289 | 126 |
| 124 | 3300039450 | Ga0436363_0666119 | Ga0436363_0666119_125_505 | 126 |
| 125 | 3300039450 | Ga0436363_0878951 | Ga0436363_0878951_735_1115 | 126 |
| 126 | 3300039450 | Ga0436363_0908748 | Ga0436363_0908748_58_438 | 126 |
| 127 | 3300039450 | Ga0436363_1245511 | Ga0436363_1245511_400_780 | 126 |
| 128 | 3300039450 | Ga0436363_1495593 | Ga0436363_1495593_156_536 | 126 |
| 129 | 3300039450 | Ga0436363_1654339 | Ga0436363_1654339_3096_3482 | 126 |
| 130 | 3300039453 | Ga0436362_0782961 | Ga0436362_0782961_2217_2597 | 126 |
| 131 | 3300044684 | Ga0466966_0427173 | Ga0466966_0427173_359_739 | 126 |
| 132 | 3300044684 | Ga0466966_0751620 | Ga0466966_0751620_86_466 | 126 |
| 133 | 3300045836 | Ga0466958_1130794 | Ga0466958_1130794_46_426 | 126 |
| 134 | 3300046454 | Ga0495592_0339033 | Ga0495592_0339033_204_605 | 126 |
| 135 | 3300046462 | Ga0495651_0181984 | Ga0495651_0181984_756_1157 | 126 |
| 136 | 3300046463 | Ga0495653_0299673 | Ga0495653_0299673_58_459 | 126 |
| 137 | 3300046472 | Ga0495580_0100345 | Ga0495580_0100345_507_887 | 126 |
| 138 | 3300046511 | Ga0495608_0019425 | Ga0495608_0019425_2782_3183 | 126 |
| 139 | 3300046520 | Ga0495637_0271373 | Ga0495637_0271373_65_445 | 126 |
| 140 | 3300046533 | Ga0495640_0584315 | Ga0495640_0584315_245_646 | 126 |
| 141 | 3300046559 | Ga0495667_0004361 | Ga0495667_0004361_8100_8501 | 126 |
| 142 | 3300046642 | Ga0495634_0110951 | Ga0495634_0110951_523_924 | 126 |
| 143 | 3300046663 | Ga0495635_0084773 | Ga0495635_0084773_1416_1817 | 126 |
| 144 | 3300046675 | Ga0495657_0147762 | Ga0495657_0147762_767_1168 | 126 |
| 145 | 3300046680 | Ga0495646_0454488 | Ga0495646_0454488_176_577 | 126 |
| 146 | 3300047315 | Ga0495581_0252071 | Ga0495581_0252071_551_952 | 126 |
| 147 | 3300047319 | Ga0495674_0016457 | Ga0495674_0016457_421_822 | 126 |
| 148 | 3300047322 | Ga0495680_0009764 | Ga0495680_0009764_7425_7826 | 126 |
| 149 | 3300048088 | Ga0495602_0069011 | Ga0495602_0069011_1777_2178 | 126 |
| 150 | 3300048913 | Ga0496110_0029405 | Ga0496110_0029405_970_1350 | 126 |
| 151 | 3300048917 | Ga0496114_1039957 | Ga0496114_1039957_282_662 | 126 |
| 152 | 3300048921 | Ga0496118_0571023 | Ga0496118_0571023_37_417 | 126 |
| 153 | 3300048929 | Ga0496126_0092089 | Ga0496126_0092089_2163_2543 | 126 |
| 154 | 3300049571 | Ga0501034_0378418 | Ga0501034_0378418_201_581 | 126 |
| 155 | 3300049574 | Ga0501038_0193488 | Ga0501038_0193488_1036_1416 | 126 |
| 156 | 3300049580 | Ga0501046_0086337 | Ga0501046_0086337_1098_1478 | 126 |
| 157 | 3300049580 | Ga0501046_0615492 | Ga0501046_0615492_341_721 | 126 |
| 158 | 3300049590 | Ga0501074_1249317 | Ga0501074_1249317_118_498 | 126 |
| 159 | 3300049593 | Ga0501077_0007955 | Ga0501077_0007955_1488_1868 | 126 |
| 160 | 3300049741 | Ga0501079_0177196 | Ga0501079_0177196_301_681 | 126 |
| 161 | 3300049743 | Ga0501081_0049680 | Ga0501081_0049680_901_1281 | 126 |
| 162 | 3300049824 | Ga0501045_0228457 | Ga0501045_0228457_435_815 | 126 |
| 163 | 3300050492 | nmdc:mga0yw44_302219_c1 | nmdc:mga0yw44_302219_c1_181_561 | 126 |
| 164 | 3300050493 | nmdc:mga0k408_589316_c1 | nmdc:mga0k408_589316_c1_227_607 | 126 |
| 165 | 3300050496 | nmdc:mga07m45_786159_c1 | nmdc:mga07m45_786159_c1_50_430 | 126 |
| 166 | 3300050507 | nmdc:mga05p37_620249_c1 | nmdc:mga05p37_620249_c1_360_740 | 126 |
| 167 | 3300050510 | nmdc:mga06r32_1376613_c1 | nmdc:mga06r32_1376613_c1_13_399 | 126 |
| 168 | 3300050512 | nmdc:mga0n895_430685_c1 | nmdc:mga0n895_430685_c1_838_1218 | 126 |
| 169 | 3300050516 | nmdc:mga0sz30_144208_c1 | nmdc:mga0sz30_144208_c1_82_462 | 126 |
| 170 | 3300053080 | Ga0500635_0001189 | Ga0500635_0001189_4151_4531 | 126 |
| 171 | 3300053084 | Ga0495595_0141276 | Ga0495595_0141276_658_1059 | 126 |
| 172 | 3300053086 | Ga0500578_0565779 | Ga0500578_0565779_50_430 | 126 |
| 173 | 3300053087 | Ga0500643_006784 | Ga0500643_006784_2846_3226 | 126 |
| 174 | 3300053088 | Ga0500644_0000856 | Ga0500644_0000856_7327_7707 | 126 |
| 175 | 3300053093 | Ga0500651_0004404 | Ga0500651_0004404_6439_6819 | 126 |
| 176 | 3300053093 | Ga0500651_0166281 | Ga0500651_0166281_359_739 | 126 |
| 177 | 3300053098 | Ga0500650_0377582 | Ga0500650_0377582_171_551 | 126 |
| 178 | 3300053118 | Ga0500594_0066910 | Ga0500594_0066910_61_441 | 126 |
| 179 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_831679_832059 | 126 |
| 180 | 3300053130 | Ga0500642_0086412 | Ga0500642_0086412_516_896 | 126 |
| 181 | 3300053131 | Ga0500652_031333 | Ga0500652_031333_694_1074 | 126 |
| 182 | 3300053133 | Ga0500655_014278 | Ga0500655_014278_142_522 | 126 |
| 183 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1506363_1506743 | 126 |
| 184 | 3300053163 | Ga0500639_065737 | Ga0500639_065737_1442_1822 | 126 |
| 185 | 3300053178 | Ga0500637_0008502 | Ga0500637_0008502_4165_4545 | 126 |
| 186 | 3300053730 | Ga0500645_000291 | Ga0500645_000291_29426_29806 | 126 |
| 187 | 3300053730 | Ga0500645_202517 | Ga0500645_202517_53_433 | 126 |
| 188 | 3300054114 | Ga0501084_0841633 | Ga0501084_0841633_333_713 | 126 |
| 189 | 3300061734 | Ga0530510_0498904 | Ga0530510_0498904_454_834 | 126 |
| 190 | 3300005614 | Ga0068856_100184716 | Ga0068856_1001847162 | 127 |
| 191 | 3300009147 | Ga0114129_10115221 | Ga0114129_101152213 | 127 |
| 192 | 3300048929 | Ga0496126_0305209 | Ga0496126_0305209_131_514 | 127 |
| 193 | 3300050507 | nmdc:mga05p37_483738_c1 | nmdc:mga05p37_483738_c1_208_594 | 127 |
| 194 | 3300005937 | Ga0081455_10008425 | Ga0081455_1000842511 | 128 |
| 195 | 3300006844 | Ga0075428_101177106 | Ga0075428_1011771062 | 128 |
| 196 | 3300006844 | Ga0075428_102528664 | Ga0075428_1025286641 | 128 |
| 197 | 3300006871 | Ga0075434_100232660 | Ga0075434_1002326602 | 128 |
| 198 | 3300006914 | Ga0075436_100888745 | Ga0075436_1008887451 | 128 |
| 199 | 3300007076 | Ga0075435_100113076 | Ga0075435_1001130762 | 128 |
| 200 | 3300009094 | Ga0111539_10435848 | Ga0111539_104358482 | 128 |
| 201 | 3300009147 | Ga0114129_10206546 | Ga0114129_102065463 | 128 |
| 202 | 3300009176 | Ga0105242_11166915 | Ga0105242_111669151 | 128 |
| 203 | 3300009545 | Ga0105237_10754884 | Ga0105237_107548841 | 128 |
| 204 | 3300028573 | Ga0265334_10024015 | Ga0265334_100240152 | 128 |
| 205 | 3300031247 | Ga0265340_10108006 | Ga0265340_101080062 | 128 |
| 206 | 3300031548 | Ga0307408_100000406 | Ga0307408_10000040618 | 128 |
| 207 | 3300031731 | Ga0307405_10173624 | Ga0307405_101736242 | 128 |
| 208 | 3300031731 | Ga0307405_10176231 | Ga0307405_101762312 | 128 |
| 209 | 3300031901 | Ga0307406_10253542 | Ga0307406_102535421 | 128 |
| 210 | 3300031911 | Ga0307412_10000207 | Ga0307412_1000020723 | 128 |
| 211 | 3300031911 | Ga0307412_10015597 | Ga0307412_100155975 | 128 |
| 212 | 3300032002 | Ga0307416_100131729 | Ga0307416_1001317292 | 128 |
| 213 | 3300032004 | Ga0307414_10229930 | Ga0307414_102299302 | 128 |
| 214 | 3300032005 | Ga0307411_10000086 | Ga0307411_1000008629 | 128 |
| 215 | 3300032005 | Ga0307411_10192576 | Ga0307411_101925762 | 128 |
| 216 | 3300044658 | Ga0466972_0027862 | Ga0466972_0027862_1781_2173 | 128 |
| 217 | 3300044901 | Ga0466960_0097634 | Ga0466960_0097634_474_866 | 128 |
| 218 | 3300046692 | Ga0495671_0217250 | Ga0495671_0217250_19_405 | 128 |
| 219 | 3300049573 | Ga0501037_0686080 | Ga0501037_0686080_63_449 | 128 |
| 220 | 3300049581 | Ga0501047_1106785 | Ga0501047_1106785_13_399 | 128 |
| 221 | 3300049586 | Ga0501070_0195522 | Ga0501070_0195522_817_1203 | 128 |
| 222 | 3300049822 | Ga0501035_0006037 | Ga0501035_0006037_1180_1566 | 128 |
| 223 | 3300049823 | Ga0501044_0005411 | Ga0501044_0005411_4204_4590 | 128 |
| 224 | 3300049824 | Ga0501045_1353277 | Ga0501045_1353277_78_464 | 128 |
| 225 | 3300050496 | nmdc:mga07m45_441071_c1 | nmdc:mga07m45_441071_c1_292_684 | 128 |
| 226 | 3300050507 | nmdc:mga05p37_160126_c1 | nmdc:mga05p37_160126_c1_1655_2041 | 128 |
| 227 | 3300050511 | nmdc:mga08y16_762162_c1 | nmdc:mga08y16_762162_c1_128_514 | 128 |
| 228 | 3300050512 | nmdc:mga0n895_123509_c1 | nmdc:mga0n895_123509_c1_244_630 | 128 |
| 229 | 3300050513 | nmdc:mga0rr50_1053701_c1 | nmdc:mga0rr50_1053701_c1_42_428 | 128 |
| 230 | 3300060353 | Ga0501082_1604181 | Ga0501082_1604181_113_505 | 128 |
| 231 | 3300005458 | Ga0070681_10006879 | Ga0070681_1000687910 | 129 |
| 232 | 3300009174 | Ga0105241_10618093 | Ga0105241_106180932 | 129 |
| 233 | 3300013308 | Ga0157375_12248159 | Ga0157375_122481591 | 129 |
| 234 | 3300021441 | Ga0213871_10064835 | Ga0213871_100648352 | 129 |
| 235 | 3300025912 | Ga0207707_10102927 | Ga0207707_101029273 | 129 |
| 236 | 3300035086 | Ga0373934_0003919 | Ga0373934_0003919_196_585 | 129 |
| 237 | 3300035119 | Ga0373956_0000584 | Ga0373956_0000584_5907_6296 | 129 |
| 238 | 3300035120 | Ga0373957_0024429 | Ga0373957_0024429_1728_2117 | 129 |
| 239 | 3300035172 | Ga0373955_0035088 | Ga0373955_0035088_1883_2272 | 129 |
| 240 | 3300035724 | Ga0373933_0000759 | Ga0373933_0000759_3211_3600 | 129 |
| 241 | 3300036401 | Ga0373937_0000931 | Ga0373937_0000931_8428_8817 | 129 |
| 242 | 3300039438 | Ga0436360_0627708 | Ga0436360_0627708_519_908 | 129 |
| 243 | 3300039438 | Ga0436360_0705875 | Ga0436360_0705875_502_891 | 129 |
| 244 | 3300039453 | Ga0436362_0906540 | Ga0436362_0906540_490_879 | 129 |
| 245 | 3300046462 | Ga0495651_0000314 | Ga0495651_0000314_13010_13399 | 129 |
| 246 | 3300047318 | Ga0495636_0029285 | Ga0495636_0029285_1460_1849 | 129 |
| 247 | 3300050507 | nmdc:mga05p37_34686_c1 | nmdc:mga05p37_34686_c1_1624_2016 | 129 |
| 248 | 3300053085 | Ga0495619_0997331 | Ga0495619_0997331_69_458 | 129 |
| 249 | 3300005434 | Ga0070709_10289582 | Ga0070709_102895821 | 130 |
| 250 | 3300005435 | Ga0070714_100024958 | Ga0070714_1000249589 | 130 |
| 251 | 3300005436 | Ga0070713_100370015 | Ga0070713_1003700152 | 130 |
| 252 | 3300005437 | Ga0070710_10003275 | Ga0070710_100032752 | 130 |
| 253 | 3300005439 | Ga0070711_100011962 | Ga0070711_10001196210 | 130 |
| 254 | 3300005546 | Ga0070696_100274044 | Ga0070696_1002740441 | 130 |
| 255 | 3300006028 | Ga0070717_10014369 | Ga0070717_100143692 | 130 |
| 256 | 3300006058 | Ga0075432_10093293 | Ga0075432_100932932 | 130 |
| 257 | 3300006163 | Ga0070715_10001174 | Ga0070715_100011744 | 130 |
| 258 | 3300006173 | Ga0070716_100034542 | Ga0070716_1000345423 | 130 |
| 259 | 3300006175 | Ga0070712_100125464 | Ga0070712_1001254645 | 130 |
| 260 | 3300006852 | Ga0075433_10756802 | Ga0075433_107568022 | 130 |
| 261 | 3300013306 | Ga0163162_13210464 | Ga0163162_132104641 | 130 |
| 262 | 3300025898 | Ga0207692_10005371 | Ga0207692_100053712 | 130 |
| 263 | 3300025905 | Ga0207685_10002372 | Ga0207685_100023722 | 130 |
| 264 | 3300025906 | Ga0207699_10050173 | Ga0207699_100501733 | 130 |
| 265 | 3300025915 | Ga0207693_10013785 | Ga0207693_100137852 | 130 |
| 266 | 3300025916 | Ga0207663_10073476 | Ga0207663_100734762 | 130 |
| 267 | 3300025928 | Ga0207700_11464368 | Ga0207700_114643681 | 130 |
| 268 | 3300048905 | Ga0496102_0598233 | Ga0496102_0598233_168_560 | 130 |
| 269 | 3300050507 | nmdc:mga05p37_488981_c1 | nmdc:mga05p37_488981_c1_962_1354 | 130 |
| 270 | 3300050512 | nmdc:mga0n895_1787453_c1 | nmdc:mga0n895_1787453_c1_30_422 | 130 |
| 271 | 3300005436 | Ga0070713_100779150 | Ga0070713_1007791501 | 131 |
| 272 | 3300006847 | Ga0075431_100073668 | Ga0075431_1000736685 | 131 |
| 273 | 3300006880 | Ga0075429_100120456 | Ga0075429_1001204563 | 131 |
| 274 | 3300009147 | Ga0114129_10929741 | Ga0114129_109297412 | 131 |
| 275 | 3300025928 | Ga0207700_10555599 | Ga0207700_105555992 | 131 |
| 276 | 3300035120 | Ga0373957_0183851 | Ga0373957_0183851_254_649 | 131 |
| 277 | 3300036401 | Ga0373937_0351451 | Ga0373937_0351451_947_1342 | 131 |
| 278 | 3300048903 | Ga0496100_1347747 | Ga0496100_1347747_56_451 | 131 |
| 279 | 3300048911 | Ga0496108_0000835 | Ga0496108_0000835_2451_2846 | 131 |
| 280 | 3300048912 | Ga0496109_0005707 | Ga0496109_0005707_1184_1579 | 131 |
| 281 | 3300048913 | Ga0496110_0000379 | Ga0496110_0000379_8826_9221 | 131 |
| 282 | 3300048914 | Ga0496111_0012963 | Ga0496111_0012963_1119_1514 | 131 |
| 283 | 3300048915 | Ga0496112_0149887 | Ga0496112_0149887_1344_1739 | 131 |
| 284 | 3300048916 | Ga0496113_0255194 | Ga0496113_0255194_658_1053 | 131 |
| 285 | 3300050507 | nmdc:mga05p37_1045547_c1 | nmdc:mga05p37_1045547_c1_212_607 | 131 |
| 286 | 3300050508 | nmdc:mga09592_125827_c1 | nmdc:mga09592_125827_c1_847_1242 | 131 |
| 287 | 3300050509 | nmdc:mga0qj67_164021_c1 | nmdc:mga0qj67_164021_c1_664_1059 | 131 |
| 288 | 3300053084 | Ga0495595_0211074 | Ga0495595_0211074_538_933 | 131 |
| 289 | 3300053085 | Ga0495619_0968226 | Ga0495619_0968226_140_535 | 131 |
| 290 | 3300005406 | Ga0070703_10022570 | Ga0070703_100225703 | 132 |
| 291 | 3300005440 | Ga0070705_100694308 | Ga0070705_1006943082 | 132 |
| 292 | 3300005444 | Ga0070694_100930987 | Ga0070694_1009309871 | 132 |
| 293 | 3300005545 | Ga0070695_100217297 | Ga0070695_1002172972 | 132 |
| 294 | 3300005546 | Ga0070696_100334625 | Ga0070696_1003346252 | 132 |
| 295 | 3300009148 | Ga0105243_10008835 | Ga0105243_100088358 | 132 |
| 296 | 3300009176 | Ga0105242_10350892 | Ga0105242_103508921 | 132 |
| 297 | 3300025934 | Ga0207686_10298479 | Ga0207686_102984792 | 132 |
| 298 | 3300003320 | rootH2_10340526 | rootH2_103405262 | 134 |
| 299 | 3300005444 | Ga0070694_100145095 | Ga0070694_1001450952 | 134 |
| 300 | 3300005545 | Ga0070695_100002021 | Ga0070695_1000020216 | 134 |
| 301 | 3300005547 | Ga0070693_101239169 | Ga0070693_1012391691 | 134 |
| 302 | 3300005549 | Ga0070704_100297363 | Ga0070704_1002973633 | 134 |
| 303 | 3300005843 | Ga0068860_100315647 | Ga0068860_1003156472 | 134 |
| 304 | 3300035114 | Ga0373939_0015281 | Ga0373939_0015281_1206_1610 | 134 |
| 305 | 3300042012 | Ga0439455_0237133 | Ga0439455_0237133_46_450 | 134 |
| 306 | 3300042876 | Ga0451577_0041582 | Ga0451577_0041582_1892_2296 | 134 |
| 307 | 3300049572 | Ga0501036_0406415 | Ga0501036_0406415_561_965 | 134 |
| 308 | 3300049578 | Ga0501042_0474450 | Ga0501042_0474450_161_565 | 134 |
| 309 | 3300049741 | Ga0501079_0715995 | Ga0501079_0715995_214_618 | 134 |
| 310 | 3300060353 | Ga0501082_0250250 | Ga0501082_0250250_502_906 | 134 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ozj-assembly2.cif.gz_B-3 | crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution | 0.8515 | 27 | 124 |
| 2qdr-assembly1.cif.gz_A | crystal structure of a putative dioxygenase (npun_f5605) from nostoc punctiforme pcc 73102 at 2.60 a resolution | 0.848 | 19 | 124 |
| 5j4f-assembly1.cif.gz_A | crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 | 0.8478 | 46 | 124 |
| 2q1z-assembly2.cif.gz_D | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.8264 | 15 | 121 |
| 5wse-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8196 | 28 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qdrA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8458 | 19 | 124 | 2.60.120.10 |
| 1sefA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7888 | 27 | 122 | 2.60.120.10 |
| af_I1N5B5_339_414_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7826 | 46 | 122 | 2.60.120.10 |
| 2ozjB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7787 | 31 | 124 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7769 | 9 | 122 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833LPJ2-F1-model_v4 | Cupin | 0.9905 | 15 | 124 |
|
| AF-A0A536SI27-F1-model_v4 | Cupin | 0.99 | 4 | 124 |
|
| AF-A0A4Q8QX69-F1-model_v4 | Cupin | 0.9891 | 59 | 124 |
|
| AF-A0A848Y6P2-F1-model_v4 | Cupin | 0.9872 | 38 | 124 |
|
| AF-A0A177R1U6-F1-model_v4 | Cupin | 0.9858 | 4 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar