F400875

General Info

Members Datasets Scaffolds Average Seq Length
310 204 620 272

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0142934|Ga0495597_0142934_55_933
Length 292
Sequence MSVAALPRKRHWRLTIMPSFSLAALTVLELAPPALIDVAAACGYQQVGLRLLPAMQGGVAYPLMEDEAGLKETLARLDATGITVADLEVVALRPETEIAAFSAFFETGARLGARHVLVAAYDPDLHRFRDRYAAFCEAAAPYGLSADLEFMPWTYAPDLSTASSIVAQVGQPNAGVLVDALHFDRSRSSIDELARVPAHRLHYWQICDGPAERPITTEAMLHAARYERMFPGEGGIDLASLTRAMPADITVSIEVPTAELAKTMDAKARAQRALTAARNVIAGSRDPRSCCT

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
197 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
200 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
201 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
202 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
203 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
204 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0.32
Rhizoplane 8.71
Rhizosphere 71.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0142934 3300046542 Bacteria 986
2 rootH1_10121330 3300003323 Bacteria 1310
3 Ga0070690_100254988 3300005330 Bacteria 1242
4 Ga0070670_100235478 3300005331 Bacteria 1594
5 Ga0070677_10138140 3300005333 Bacteria 1121
6 Ga0068869_100042236 3300005334 Bacteria 3268
7 Ga0070666_10303504 3300005335 Bacteria 1137
8 Ga0070680_100131457 3300005336 Bacteria 2094
9 Ga0068868_100008937 3300005338 Bacteria 7188
10 Ga0068868_100299779 3300005338 Bacteria 1365
11 Ga0070661_100067412 3300005344 Bacteria 2630
12 Ga0070668_100129556 3300005347 Bacteria 2024
13 Ga0070668_100234105 3300005347 Bacteria 1519
14 Ga0070668_100303612 3300005347 Bacteria 1339
15 Ga0070671_100581414 3300005355 Bacteria 967
16 Ga0070673_100463916 3300005364 Bacteria 1141
17 Ga0070673_100467899 3300005364 Bacteria 1136
18 Ga0070713_100010228 3300005436 Bacteria 6771
19 Ga0070710_10069767 3300005437 Bacteria 2023
20 Ga0070663_100018267 3300005455 Bacteria 4593
21 Ga0070663_100263940 3300005455 Bacteria 1367
22 Ga0070678_100037153 3300005456 Bacteria 3417
23 Ga0070678_100122528 3300005456 Bacteria 2052
24 Ga0070678_100415420 3300005456 Bacteria 1172
25 Ga0070662_100282131 3300005457 Bacteria 1345
26 Ga0070662_100497258 3300005457 Bacteria 1017
27 Ga0068867_100424980 3300005459 Bacteria 1126
28 Ga0070679_100085440 3300005530 Bacteria 3143
29 Ga0070665_100044229 3300005548 Bacteria 4472
30 Ga0070665_100404594 3300005548 Bacteria 1373
31 Ga0070665_100417390 3300005548 Bacteria 1351
32 Ga0068855_100040085 3300005563 Bacteria 5559
33 Ga0068855_100042778 3300005563 Bacteria 5367
34 Ga0068855_100751058 3300005563 Bacteria 1040
35 Ga0070664_100257939 3300005564 Bacteria 1568
36 Ga0070664_100453323 3300005564 Bacteria 1178
37 Ga0068857_100284726 3300005577 Bacteria 1521
38 Ga0068854_100062282 3300005578 Bacteria 2704
39 Ga0068856_100765282 3300005614 Bacteria 986
40 Ga0070702_100054816 3300005615 Bacteria 2296
41 Ga0068852_100053958 3300005616 Bacteria 3463
42 Ga0068852_100081542 3300005616 Bacteria 2872
43 Ga0068852_100186992 3300005616 Bacteria 1951
44 Ga0068864_100102268 3300005618 Bacteria 2543
45 Ga0068861_100045927 3300005719 Bacteria 3291
46 Ga0068861_100057518 3300005719 Bacteria 2971
47 Ga0068861_100067100 3300005719 Bacteria 2767
48 Ga0068861_100249512 3300005719 Bacteria 1514
49 Ga0068851_10094067 3300005834 Bacteria 1582
50 Ga0068863_100116394 3300005841 Bacteria 2547
51 Ga0068863_100676429 3300005841 Bacteria 1025
52 Ga0068858_100016761 3300005842 Bacteria 6881
53 Ga0068860_100764001 3300005843 Bacteria 979
54 Ga0068862_100133943 3300005844 Bacteria 2194
55 Ga0068862_100266446 3300005844 Bacteria 1565
56 Ga0081455_10113157 3300005937 Bacteria 2153
57 Ga0070717_10060967 3300006028 Bacteria 3125
58 Ga0075368_10102968 3300006042 Bacteria 1174
59 Ga0075363_100125786 3300006048 Bacteria 1435
60 Ga0075363_100253997 3300006048 Bacteria 1013
61 Ga0075364_10192966 3300006051 Bacteria 1380
62 Ga0075364_10269161 3300006051 Bacteria 1159
63 Ga0075367_10205508 3300006178 Bacteria 1231
64 Ga0075369_10012242 3300006186 Bacteria 3388
65 Ga0097621_100094703 3300006237 Bacteria 2504
66 Ga0097621_100715189 3300006237 Bacteria 923
67 Ga0075370_10073167 3300006353 Bacteria 1962
68 Ga0075370_10075221 3300006353 Bacteria 1936
69 Ga0075428_100214898 3300006844 Bacteria 2077
70 Ga0075434_100176014 3300006871 Bacteria 2159
71 Ga0068865_100487147 3300006881 Bacteria 1026
72 Ga0099795_10062660 3300007788 Bacteria 1384
73 Ga0105240_10168587 3300009093 Bacteria 2595
74 Ga0111539_10187565 3300009094 Bacteria 2414
75 Ga0105245_10015457 3300009098 Bacteria 6654
76 Ga0105245_10272602 3300009098 Bacteria 1651
77 Ga0105247_10022493 3300009101 Bacteria 3796
78 Ga0105247_10068514 3300009101 Bacteria 2212
79 Ga0105247_10128346 3300009101 Bacteria 1650
80 Ga0105247_10442993 3300009101 Bacteria 935
81 Ga0114129_10037785 3300009147 Bacteria 6814
82 Ga0105243_10159916 3300009148 Bacteria 1941
83 Ga0105241_10098687 3300009174 Bacteria 2318
84 Ga0105241_10481483 3300009174 Bacteria 1103
85 Ga0105248_10030563 3300009177 Bacteria 6015
86 Ga0105248_10097776 3300009177 Bacteria 3307
87 Ga0105237_10034201 3300009545 Bacteria 5147
88 Ga0105238_10022369 3300009551 Bacteria 6443
89 Ga0105238_10192322 3300009551 Bacteria 2016
90 Ga0105249_10392882 3300009553 Bacteria 1415
91 Ga0105239_10016701 3300010375 Bacteria 8113
92 Ga0105239_10017719 3300010375 Bacteria 7879
93 Ga0105239_10080181 3300010375 Bacteria 3591
94 Ga0105246_10025043 3300011119 Bacteria 3887
95 Ga0105246_10038399 3300011119 Bacteria 3219
96 Ga0105246_10111269 3300011119 Bacteria 2012
97 Ga0157370_10102472 3300013104 Bacteria 2680
98 Ga0157374_10066256 3300013296 Bacteria 3394
99 Ga0157374_10532428 3300013296 Bacteria 1181
100 Ga0157378_10039963 3300013297 Bacteria 4160
101 Ga0157378_10080000 3300013297 Bacteria 2952
102 Ga0163162_10304124 3300013306 Bacteria 1727
103 Ga0163162_10446568 3300013306 Bacteria 1425
104 Ga0157375_10016388 3300013308 Bacteria 6656
105 Ga0163163_10205992 3300014325 Bacteria 2015
106 Ga0163163_10664214 3300014325 Bacteria 1106
107 Ga0157380_10537174 3300014326 Bacteria 1144
108 Ga0157379_10025267 3300014968 Bacteria 5275
109 Ga0157379_10155023 3300014968 Bacteria 2066
110 Ga0157376_10215371 3300014969 Bacteria 1776
111 Ga0157376_10714210 3300014969 Bacteria 1009
112 Ga0163161_10117335 3300017792 Bacteria 1996
113 Ga0213876_10111671 3300021384 Bacteria 1451
114 Ga0213875_10002492 3300021388 Bacteria 10999
115 Ga0213875_10002800 3300021388 Bacteria 10256
116 Ga0213875_10010719 3300021388 Bacteria 4583
117 Ga0213875_10014393 3300021388 Bacteria 3859
118 Ga0213875_10149672 3300021388 Bacteria 1093
119 Ga0209758_1026047 3300025297 Bacteria 2545
120 Ga0207692_10119079 3300025898 Bacteria 1476
121 Ga0207710_10014600 3300025900 Bacteria 3315
122 Ga0207710_10088408 3300025900 Bacteria 1447
123 Ga0207688_10065556 3300025901 Bacteria 2052
124 Ga0207688_10244483 3300025901 Bacteria 1086
125 Ga0207699_10317939 3300025906 Bacteria 1091
126 Ga0207645_10018670 3300025907 Bacteria 4555
127 Ga0207654_10018655 3300025911 Bacteria 3645
128 Ga0207707_10309866 3300025912 Bacteria 1364
129 Ga0207695_10370787 3300025913 Bacteria 1318
130 Ga0207671_10094044 3300025914 Bacteria 2262
131 Ga0207652_10079123 3300025921 Bacteria 2871
132 Ga0207694_10171341 3300025924 Bacteria 1757
133 Ga0207650_10449668 3300025925 Bacteria 1072
134 Ga0207687_10034122 3300025927 Bacteria 3454
135 Ga0207687_10044389 3300025927 Bacteria 3067
136 Ga0207700_10016292 3300025928 Bacteria 4934
137 Ga0207669_10220197 3300025937 Bacteria 1392
138 Ga0207711_10037439 3300025941 Bacteria 4120
139 Ga0207711_10294826 3300025941 Bacteria 1495
140 Ga0207711_10358159 3300025941 Bacteria 1351
141 Ga0207689_10084253 3300025942 Bacteria 2613
142 Ga0207689_10161440 3300025942 Bacteria 1846
143 Ga0207679_10282315 3300025945 Bacteria 1424
144 Ga0207667_10045957 3300025949 Bacteria 4623
145 Ga0207667_10353967 3300025949 Bacteria 1497
146 Ga0207651_10046603 3300025960 Bacteria 2917
147 Ga0207668_10027223 3300025972 Bacteria 3723
148 Ga0207668_10031173 3300025972 Bacteria 3509
149 Ga0207640_10048533 3300025981 Bacteria 2745
150 Ga0207658_10120951 3300025986 Bacteria 2088
151 Ga0207677_10016880 3300026023 Bacteria 4336
152 Ga0207677_10158477 3300026023 Bacteria 1755
153 Ga0207703_10034619 3300026035 Bacteria 4008
154 Ga0207678_10002499 3300026067 Bacteria 16723
155 Ga0207678_10167109 3300026067 Bacteria 1878
156 Ga0207678_10183803 3300026067 Bacteria 1785
157 Ga0207708_10181381 3300026075 Bacteria 1672
158 Ga0207641_10677554 3300026088 Bacteria 1014
159 Ga0207648_10160853 3300026089 Bacteria 1983
160 Ga0207676_10486524 3300026095 Bacteria 1170
161 Ga0207674_10014693 3300026116 Bacteria 8634
162 Ga0207674_10252162 3300026116 Bacteria 1712
163 Ga0207675_100334240 3300026118 Bacteria 1482
164 Ga0207675_100419521 3300026118 Bacteria 1321
165 Ga0207675_100429138 3300026118 Bacteria 1306
166 Ga0207675_100562115 3300026118 Bacteria 1141
167 Ga0207683_10051188 3300026121 Bacteria 3618
168 Ga0207683_10056680 3300026121 Bacteria 3438
169 Ga0207683_10061269 3300026121 Bacteria 3311
170 Ga0207683_10268145 3300026121 Bacteria 1559
171 Ga0207698_10128271 3300026142 Bacteria 2162
172 Ga0207428_10337878 3300027907 Bacteria 1110
173 Ga0268266_10003057 3300028379 Bacteria 17106
174 Ga0268265_10164852 3300028380 Bacteria 1887
175 Ga0268265_10266984 3300028380 Bacteria 1524
176 Ga0268264_10144460 3300028381 Bacteria 2125
177 Ga0268264_10438999 3300028381 Bacteria 1262
178 Ga0307517_10205042 3300028786 Bacteria 1225
179 Ga0307515_10045799 3300028794 Bacteria 6707
180 Ga0307515_10266670 3300028794 Bacteria 1440
181 Ga0307513_10078699 3300031456 Bacteria 3409
182 Ga0307513_10356851 3300031456 Bacteria 1208
183 Ga0307509_10025858 3300031507 Bacteria 6555
184 Ga0307508_10224090 3300031616 Bacteria 1480
185 Ga0307411_10204004 3300032005 Bacteria 1521
186 Ga0307411_10386538 3300032005 Bacteria 1153
187 Ga0307510_10011942 3300033180 Bacteria 10295
188 Ga0307510_10023053 3300033180 Bacteria 7221
189 Ga0373936_0068835 3300035113 Bacteria 1456
190 Ga0373931_0006703 3300035691 Bacteria 5402
191 Ga0373931_0066332 3300035691 Bacteria 1958
192 Ga0373925_0377236 3300037068 Bacteria 1154
193 Ga0436364_0780058 3300037853 Bacteria 25161
194 Ga0436364_0788237 3300037853 Bacteria 24655
195 Ga0436364_0872542 3300037853 Bacteria 6827
196 Ga0436364_1438746 3300037853 Bacteria 6947
197 Ga0436365_0294055 3300039437 Bacteria 2354
198 Ga0436365_1301875 3300039437 Bacteria 5118
199 Ga0451798_0308785 3300041458 Bacteria 1249
200 Ga0451843_0702286 3300041509 Bacteria 1232
201 Ga0466963_0034328 3300044694 Bacteria 3300
202 Ga0495617_061004 3300046452 Bacteria 1247
203 Ga0495603_0005987 3300046455 Bacteria 7272
204 Ga0495603_0040659 3300046455 Bacteria 2782
205 Ga0495603_0214527 3300046455 Bacteria 1111
206 Ga0495638_0177573 3300046460 Bacteria 1217
207 Ga0495638_0196726 3300046460 Bacteria 1140
208 Ga0495582_0044901 3300046473 Bacteria 2434
209 Ga0495605_0179438 3300046474 Bacteria 932
210 Ga0495639_0161341 3300046475 Bacteria 1085
211 Ga0495639_0180396 3300046475 Bacteria 1028
212 Ga0495664_0354404 3300046477 Bacteria 883
213 Ga0495585_0025119 3300046492 Bacteria 3415
214 Ga0495585_0100645 3300046492 Bacteria 1546
215 Ga0495585_0168407 3300046492 Bacteria 1133
216 Ga0495596_0164330 3300046500 Bacteria 863
217 Ga0495616_0067976 3300046513 Bacteria 1731
218 Ga0495630_0144483 3300046517 Bacteria 1809
219 Ga0495631_0055750 3300046518 Bacteria 1722
220 Ga0495631_0084165 3300046518 Bacteria 1371
221 Ga0495631_0203164 3300046518 Bacteria 847
222 Ga0495632_0131563 3300046519 Bacteria 1164
223 Ga0495632_0192082 3300046519 Bacteria 932
224 Ga0495643_0100162 3300046522 Bacteria 1486
225 Ga0495643_0271088 3300046522 Bacteria 784
226 Ga0495644_0051131 3300046523 Bacteria 1551
227 Ga0495654_0059031 3300046530 Bacteria 1849
228 Ga0495598_0017558 3300046537 Bacteria 1847
229 Ga0495621_0050068 3300046539 Bacteria 1492
230 Ga0495622_0036875 3300046557 Bacteria 2278
231 Ga0495656_0021836 3300046615 Bacteria 2497
232 Ga0495668_0082774 3300046616 Bacteria 1760
233 Ga0495668_0116153 3300046616 Bacteria 1463
234 Ga0495668_0185195 3300046616 Bacteria 1140
235 Ga0495611_0048660 3300046648 Bacteria 1906
236 Ga0495611_0257925 3300046648 Bacteria 807
237 Ga0495625_0061800 3300046660 Bacteria 2649
238 Ga0495625_0495038 3300046660 Bacteria 748
239 Ga0495659_0006030 3300046664 Bacteria 3830
240 Ga0495588_0189457 3300046674 Bacteria 1086
241 Ga0495647_0083776 3300046681 Bacteria 1297
242 Ga0495658_0208734 3300046683 Bacteria 1220
243 Ga0495669_0071313 3300046684 Bacteria 1584
244 Ga0495669_0186271 3300046684 Bacteria 990
245 Ga0495670_0112459 3300046691 Bacteria 1410
246 Ga0495581_0200986 3300047315 Bacteria 1166
247 Ga0495636_0058098 3300047318 Bacteria 1630
248 Ga0495672_0015945 3300047320 Bacteria 5086
249 Ga0495672_0221841 3300047320 Bacteria 933
250 Ga0495676_0177450 3300047321 Bacteria 1495
251 Ga0495686_0167106 3300047472 Bacteria 1282
252 Ga0495614_0295128 3300048089 Bacteria 748
253 Ga0496100_0016603 3300048903 Bacteria 4327
254 Ga0496100_0113597 3300048903 Bacteria 1885
255 Ga0496100_0194895 3300048903 Bacteria 1473
256 Ga0496101_0036936 3300048904 Bacteria 3462
257 Ga0496101_0043077 3300048904 Bacteria 3224
258 Ga0496102_0006975 3300048905 Bacteria 9639
259 Ga0496102_0008353 3300048905 Bacteria 8866
260 Ga0496103_0045176 3300048906 Bacteria 2718
261 Ga0496103_0074343 3300048906 Bacteria 2130
262 Ga0496104_0038826 3300048907 Bacteria 4456
263 Ga0496105_0039450 3300048908 Bacteria 3892
264 Ga0496106_0114219 3300048909 Bacteria 2105
265 Ga0496107_0188400 3300048910 Bacteria 1532
266 Ga0496108_0038100 3300048911 Bacteria 4005
267 Ga0496108_0133166 3300048911 Bacteria 2137
268 Ga0496109_0608022 3300048912 Bacteria 1029
269 Ga0496110_0009704 3300048913 Bacteria 7796
270 Ga0496111_0088008 3300048914 Bacteria 2274
271 Ga0496111_0211806 3300048914 Bacteria 1439
272 Ga0496113_0100195 3300048916 Bacteria 2244
273 Ga0496113_0192352 3300048916 Bacteria 1620
274 Ga0496114_0013311 3300048917 Bacteria 6594
275 Ga0496114_0295420 3300048917 Bacteria 1430
276 Ga0496114_0367116 3300048917 Bacteria 1274
277 Ga0496115_0004316 3300048918 Bacteria 10289
278 Ga0496117_0261249 3300048920 Bacteria 938
279 Ga0496118_0237936 3300048921 Bacteria 1045
280 Ga0496121_0028985 3300048924 Bacteria 5136
281 Ga0496121_0088828 3300048924 Bacteria 2421
282 Ga0496121_0218489 3300048924 Bacteria 1344
283 Ga0496126_0028084 3300048929 Bacteria 5365
284 Ga0501067_0109988 3300049583 Bacteria 1532
285 Ga0501076_0502754 3300049592 Bacteria 999
286 nmdc:mga03683_5518_c1 3300050489 Bacteria 4276
287 nmdc:mga03n38_128369_c1 3300050490 Bacteria 1254
288 nmdc:mga00v17_23153_c1 3300050491 Bacteria 3591
289 nmdc:mga00v17_93786_c1 3300050491 Bacteria 1888
290 nmdc:mga0yw44_14033_c1 3300050492 Bacteria 4240
291 nmdc:mga0yw44_143828_c1 3300050492 Bacteria 1551
292 nmdc:mga0yw44_87452_c1 3300050492 Bacteria 1964
293 nmdc:mga0k408_192855_c1 3300050493 Bacteria 1216
294 nmdc:mga0k408_262200_c1 3300050493 Bacteria 1032
295 nmdc:mga07m45_163456_c1 3300050496 Bacteria 1293
296 nmdc:mga05p37_76186_c1 3300050507 Bacteria 4130
297 nmdc:mga0sz30_24814_c1 3300050516 Bacteria 2449
298 Ga0500635_0002446 3300053080 Bacteria 4606
299 Ga0495655_0031461 3300053083 Bacteria 1291
300 Ga0495619_0099783 3300053085 Bacteria 1975
301 Ga0500595_001251 3300053119 Bacteria 13996
302 Ga0500603_068361 3300053150 Bacteria 1007
303 Ga0500604_0105897 3300053151 Bacteria 931
304 Ga0500637_0035805 3300053178 Bacteria 2784
305 2599720514 2599185236 Bacteria 6875203
306 2824656226 2824653114 Bacteria 8493680
307 2876815903 2876808645 Bacteria 8824342
308 2879112851 2879110137 Bacteria 8907982
309 2885386188 2885383462 Bacteria 9473874
310 8006992393 8006984368 Bacteria 9651211
311 Ga0495597_0142934
312 rootH1_10121330
313 Ga0070690_100254988
314 Ga0070670_100235478
315 Ga0070677_10138140
316 Ga0068869_100042236
317 Ga0070666_10303504
318 Ga0070680_100131457
319 Ga0068868_100008937
320 Ga0068868_100299779
321 Ga0070661_100067412
322 Ga0070668_100129556
323 Ga0070668_100234105
324 Ga0070668_100303612
325 Ga0070671_100581414
326 Ga0070673_100463916
327 Ga0070673_100467899
328 Ga0070713_100010228
329 Ga0070710_10069767
330 Ga0070663_100018267
331 Ga0070663_100263940
332 Ga0070678_100037153
333 Ga0070678_100122528
334 Ga0070678_100415420
335 Ga0070662_100282131
336 Ga0070662_100497258
337 Ga0068867_100424980
338 Ga0070679_100085440
339 Ga0070665_100044229
340 Ga0070665_100404594
341 Ga0070665_100417390
342 Ga0068855_100040085
343 Ga0068855_100042778
344 Ga0068855_100751058
345 Ga0070664_100257939
346 Ga0070664_100453323
347 Ga0068857_100284726
348 Ga0068854_100062282
349 Ga0068856_100765282
350 Ga0070702_100054816
351 Ga0068852_100053958
352 Ga0068852_100081542
353 Ga0068852_100186992
354 Ga0068864_100102268
355 Ga0068861_100045927
356 Ga0068861_100057518
357 Ga0068861_100067100
358 Ga0068861_100249512
359 Ga0068851_10094067
360 Ga0068863_100116394
361 Ga0068863_100676429
362 Ga0068858_100016761
363 Ga0068860_100764001
364 Ga0068862_100133943
365 Ga0068862_100266446
366 Ga0081455_10113157
367 Ga0070717_10060967
368 Ga0075368_10102968
369 Ga0075363_100125786
370 Ga0075363_100253997
371 Ga0075364_10192966
372 Ga0075364_10269161
373 Ga0075367_10205508
374 Ga0075369_10012242
375 Ga0097621_100094703
376 Ga0097621_100715189
377 Ga0075370_10073167
378 Ga0075370_10075221
379 Ga0075428_100214898
380 Ga0075434_100176014
381 Ga0068865_100487147
382 Ga0099795_10062660
383 Ga0105240_10168587
384 Ga0111539_10187565
385 Ga0105245_10015457
386 Ga0105245_10272602
387 Ga0105247_10022493
388 Ga0105247_10068514
389 Ga0105247_10128346
390 Ga0105247_10442993
391 Ga0114129_10037785
392 Ga0105243_10159916
393 Ga0105241_10098687
394 Ga0105241_10481483
395 Ga0105248_10030563
396 Ga0105248_10097776
397 Ga0105237_10034201
398 Ga0105238_10022369
399 Ga0105238_10192322
400 Ga0105249_10392882
401 Ga0105239_10016701
402 Ga0105239_10017719
403 Ga0105239_10080181
404 Ga0105246_10025043
405 Ga0105246_10038399
406 Ga0105246_10111269
407 Ga0157370_10102472
408 Ga0157374_10066256
409 Ga0157374_10532428
410 Ga0157378_10039963
411 Ga0157378_10080000
412 Ga0163162_10304124
413 Ga0163162_10446568
414 Ga0157375_10016388
415 Ga0163163_10205992
416 Ga0163163_10664214
417 Ga0157380_10537174
418 Ga0157379_10025267
419 Ga0157379_10155023
420 Ga0157376_10215371
421 Ga0157376_10714210
422 Ga0163161_10117335
423 Ga0213876_10111671
424 Ga0213875_10002492
425 Ga0213875_10002800
426 Ga0213875_10010719
427 Ga0213875_10014393
428 Ga0213875_10149672
429 Ga0209758_1026047
430 Ga0207692_10119079
431 Ga0207710_10014600
432 Ga0207710_10088408
433 Ga0207688_10065556
434 Ga0207688_10244483
435 Ga0207699_10317939
436 Ga0207645_10018670
437 Ga0207654_10018655
438 Ga0207707_10309866
439 Ga0207695_10370787
440 Ga0207671_10094044
441 Ga0207652_10079123
442 Ga0207694_10171341
443 Ga0207650_10449668
444 Ga0207687_10034122
445 Ga0207687_10044389
446 Ga0207700_10016292
447 Ga0207669_10220197
448 Ga0207711_10037439
449 Ga0207711_10294826
450 Ga0207711_10358159
451 Ga0207689_10084253
452 Ga0207689_10161440
453 Ga0207679_10282315
454 Ga0207667_10045957
455 Ga0207667_10353967
456 Ga0207651_10046603
457 Ga0207668_10027223
458 Ga0207668_10031173
459 Ga0207640_10048533
460 Ga0207658_10120951
461 Ga0207677_10016880
462 Ga0207677_10158477
463 Ga0207703_10034619
464 Ga0207678_10002499
465 Ga0207678_10167109
466 Ga0207678_10183803
467 Ga0207708_10181381
468 Ga0207641_10677554
469 Ga0207648_10160853
470 Ga0207676_10486524
471 Ga0207674_10014693
472 Ga0207674_10252162
473 Ga0207675_100334240
474 Ga0207675_100419521
475 Ga0207675_100429138
476 Ga0207675_100562115
477 Ga0207683_10051188
478 Ga0207683_10056680
479 Ga0207683_10061269
480 Ga0207683_10268145
481 Ga0207698_10128271
482 Ga0207428_10337878
483 Ga0268266_10003057
484 Ga0268265_10164852
485 Ga0268265_10266984
486 Ga0268264_10144460
487 Ga0268264_10438999
488 Ga0307517_10205042
489 Ga0307515_10045799
490 Ga0307515_10266670
491 Ga0307513_10078699
492 Ga0307513_10356851
493 Ga0307509_10025858
494 Ga0307508_10224090
495 Ga0307411_10204004
496 Ga0307411_10386538
497 Ga0307510_10011942
498 Ga0307510_10023053
499 Ga0373936_0068835
500 Ga0373931_0006703
501 Ga0373931_0066332
502 Ga0373925_0377236
503 Ga0436364_0780058
504 Ga0436364_0788237
505 Ga0436364_0872542
506 Ga0436364_1438746
507 Ga0436365_0294055
508 Ga0436365_1301875
509 Ga0451798_0308785
510 Ga0451843_0702286
511 Ga0466963_0034328
512 Ga0495617_061004
513 Ga0495603_0005987
514 Ga0495603_0040659
515 Ga0495603_0214527
516 Ga0495638_0177573
517 Ga0495638_0196726
518 Ga0495582_0044901
519 Ga0495605_0179438
520 Ga0495639_0161341
521 Ga0495639_0180396
522 Ga0495664_0354404
523 Ga0495585_0025119
524 Ga0495585_0100645
525 Ga0495585_0168407
526 Ga0495596_0164330
527 Ga0495616_0067976
528 Ga0495630_0144483
529 Ga0495631_0055750
530 Ga0495631_0084165
531 Ga0495631_0203164
532 Ga0495632_0131563
533 Ga0495632_0192082
534 Ga0495643_0100162
535 Ga0495643_0271088
536 Ga0495644_0051131
537 Ga0495654_0059031
538 Ga0495598_0017558
539 Ga0495621_0050068
540 Ga0495622_0036875
541 Ga0495656_0021836
542 Ga0495668_0082774
543 Ga0495668_0116153
544 Ga0495668_0185195
545 Ga0495611_0048660
546 Ga0495611_0257925
547 Ga0495625_0061800
548 Ga0495625_0495038
549 Ga0495659_0006030
550 Ga0495588_0189457
551 Ga0495647_0083776
552 Ga0495658_0208734
553 Ga0495669_0071313
554 Ga0495669_0186271
555 Ga0495670_0112459
556 Ga0495581_0200986
557 Ga0495636_0058098
558 Ga0495672_0015945
559 Ga0495672_0221841
560 Ga0495676_0177450
561 Ga0495686_0167106
562 Ga0495614_0295128
563 Ga0496100_0016603
564 Ga0496100_0113597
565 Ga0496100_0194895
566 Ga0496101_0036936
567 Ga0496101_0043077
568 Ga0496102_0006975
569 Ga0496102_0008353
570 Ga0496103_0045176
571 Ga0496103_0074343
572 Ga0496104_0038826
573 Ga0496105_0039450
574 Ga0496106_0114219
575 Ga0496107_0188400
576 Ga0496108_0038100
577 Ga0496108_0133166
578 Ga0496109_0608022
579 Ga0496110_0009704
580 Ga0496111_0088008
581 Ga0496111_0211806
582 Ga0496113_0100195
583 Ga0496113_0192352
584 Ga0496114_0013311
585 Ga0496114_0295420
586 Ga0496114_0367116
587 Ga0496115_0004316
588 Ga0496117_0261249
589 Ga0496118_0237936
590 Ga0496121_0028985
591 Ga0496121_0088828
592 Ga0496121_0218489
593 Ga0496126_0028084
594 Ga0501067_0109988
595 Ga0501076_0502754
596 nmdc:mga03683_5518_c1
597 nmdc:mga03n38_128369_c1
598 nmdc:mga00v17_23153_c1
599 nmdc:mga00v17_93786_c1
600 nmdc:mga0yw44_14033_c1
601 nmdc:mga0yw44_143828_c1
602 nmdc:mga0yw44_87452_c1
603 nmdc:mga0k408_192855_c1
604 nmdc:mga0k408_262200_c1
605 nmdc:mga07m45_163456_c1
606 nmdc:mga05p37_76186_c1
607 nmdc:mga0sz30_24814_c1
608 Ga0500635_0002446
609 Ga0495655_0031461
610 Ga0495619_0099783
611 Ga0500595_001251
612 Ga0500603_068361
613 Ga0500604_0105897
614 Ga0500637_0035805
615 2599720514
616 2824656226
617 2876815903
618 2879112851
619 2885386188
620 8006992393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

36

280

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g0w-assembly1.cif.gz_A crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution 0.8623 1 268
2g0w-assembly1.cif.gz_A crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution 0.8474 1 268
1i6n-assembly1.cif.gz_A 1.8 a crystal structure of ioli protein with a binding zinc atom 0.8336 3 268
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8142 2 262
1i6n-assembly1.cif.gz_A 1.8 a crystal structure of ioli protein with a binding zinc atom 0.8134 3 268
ID Description Score Start End Superfamily
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8422 2 268 3.20.20.150
2q02C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8143 4 265 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8101 3 268 3.20.20.150
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8092 3 264 3.20.20.150
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8074 2 268 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4R5Q8W8-F1-model_v4 Sugar phosphate isomerase/epimerase 0.992 2 268 GO:0016853
AF-A0A6P2F215-F1-model_v4 Xylose isomerase-like TIM barrel 0.9899 1 265 GO:0016853
AF-A0A849MVV1-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9891 2 270 GO:0016853
AF-A0A7K1PVE6-F1-model_v4 deleted 0.988 2 266
AF-A0A2E9DHP9-F1-model_v4 deleted 0.9878 2 268

Map