F400640

General Info

Members Datasets Scaffolds Average Seq Length
310 219 622 253

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100462167|Ga0068862_1004621671
Length 304
Sequence VRLQIETGKRNMQIVRFFSWGVDYDPNIRIVTDESSPLNLHCNLHKMLIDTHCHLYLPEFDDDREEMLRRADEIGVKNFMLPNIDSSSIESMLSLCKEHASSCFPMMGLHPCSVKESWKTENREIENHLFDRKQKWYGIGETGLDFFWDKTFIDQQKENFQQHIDWAKQLHLPIIIHSRDALDDCIAMIRKNKDENLAGIFHCFSGTVEQANQIMDLGFYLGIGGVVTFKNSGLDKVMEEISLSRVVLETDSPYLSPVPFRGKRNESSYLKFVVKKISELKKIPEEEIAEITTRNAQKVFQISA

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
151 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
177 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
181 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
191 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
192 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
193 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
199 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
200 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
201 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
202 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
203 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
204 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
205 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
206 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
207 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
208 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
209 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
210 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
211 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
212 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
213 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
214 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
215 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
216 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
217 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
218 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
219 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0.32
Isolates 7.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.77
Nodule 0
Rhizoplane 1.61
Rhizosphere 69.03
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100462167 3300005844 Bacteria 1198
2 SwRhRL2b_contig_1949829 2162886007 Bacteria 1154
3 SwRhRL2b_contig_2949545 2162886007 Bacteria 1350
4 JGI25162J39368_1000563 3300002737 Bacteria 27213
5 JGI25158J39367_1002677 3300002739 Bacteria 2852
6 JGI25157J39369_1009920 3300002741 Bacteria 1264
7 JGI25153J46596_10028872 3300003215 Bacteria 1915
8 rootH2_10024240 3300003320 Bacteria 36961
9 rootH2_10076019 3300003320 Bacteria 7044
10 rootH2_10335410 3300003320 Bacteria 1143
11 rootL2_10023280 3300003322 Bacteria 25020
12 rootL2_10067655 3300003322 Unclassified 3758
13 rootL2_10079324 3300003322 Bacteria 3811
14 rootL2_10233549 3300003322 Bacteria 2055
15 rootH1_10007323 3300003323 Bacteria 15190
16 rootH1_10011647 3300003316 Bacteria 23921
17 rootH1_10011647 3300003323 Bacteria 2102
18 rootH1_10046243 3300003316 Bacteria 7856
19 rootH1_10046243 3300003323 Bacteria 5916
20 rootH1_10080363 3300003323 Bacteria 5682
21 JGI25160J50197_1000810 3300003354 Bacteria 16801
22 JGI25160J50197_1007425 3300003354 Bacteria 4289
23 Ga0055526_1008490 3300003771 Bacteria 5118
24 Ga0055526_1010377 3300003771 Bacteria 4341
25 Ga0055528_1000338 3300003790 Bacteria 39174
26 Ga0055530_10002988 3300003791 Bacteria 10162
27 Ga0055531_10000014 3300003794 Bacteria 184532
28 Ga0058863_11005245 3300004799 Bacteria 3341
29 Ga0065165_1000100 3300005262 Bacteria 141963
30 Ga0065165_1004399 3300005262 Bacteria 8785
31 Ga0065714_10002205 3300005288 Bacteria 57702
32 Ga0065714_10006137 3300005288 Bacteria 6853
33 Ga0065704_10072088 3300005289 Bacteria 9189
34 Ga0065704_10233339 3300005289 Bacteria 1030
35 Ga0070658_10029507 3300005327 Bacteria 4407
36 Ga0070658_10050510 3300005327 Bacteria 3371
37 Ga0070676_10043367 3300005328 Bacteria 2614
38 Ga0070683_100026708 3300005329 Bacteria 5202
39 Ga0068869_100048381 3300005334 Bacteria 3074
40 Ga0070680_100001753 3300005336 Bacteria 15938
41 Ga0068868_100028894 3300005338 Bacteria 4244
42 Ga0070691_10025083 3300005341 Bacteria 2774
43 Ga0070674_100154165 3300005356 Bacteria 1736
44 Ga0070673_100068052 3300005364 Bacteria 2850
45 Ga0070659_100101692 3300005366 Bacteria 2314
46 Ga0070667_100064693 3300005367 Bacteria 3104
47 Ga0070678_100580827 3300005456 Bacteria 998
48 Ga0070662_100000003 3300005457 Bacteria 239813
49 Ga0070681_10024611 3300005458 Bacteria 6057
50 Ga0070707_100458301 3300005468 Bacteria 1236
51 Ga0070698_100013395 3300005471 Bacteria 8679
52 Ga0070699_100066386 3300005518 Bacteria 3132
53 Ga0070679_100002253 3300005530 Bacteria 17431
54 Ga0070684_100043313 3300005535 Bacteria 3886
55 Ga0070684_100137221 3300005535 Bacteria 2210
56 Ga0068853_100047125 3300005539 Bacteria 3699
57 Ga0068853_100488208 3300005539 Bacteria 1162
58 Ga0070665_100000212 3300005548 Bacteria 100019
59 Ga0070665_100077242 3300005548 Bacteria 3336
60 Ga0070665_100199308 3300005548 Bacteria 2002
61 Ga0068855_100478707 3300005563 Bacteria 1355
62 Ga0068857_100139253 3300005577 Bacteria 2193
63 Ga0068856_100000036 3300005614 Bacteria 121468
64 Ga0068852_100104477 3300005616 Bacteria 2564
65 Ga0068864_100055232 3300005618 Bacteria 3428
66 Ga0068864_100442238 3300005618 Bacteria 1242
67 Ga0068866_10011709 3300005718 Bacteria 3804
68 Ga0068861_100187666 3300005719 Bacteria 1726
69 Ga0068870_10105926 3300005840 Bacteria 1598
70 Ga0068858_100080903 3300005842 Bacteria 3019
71 Ga0068858_100113254 3300005842 Bacteria 2533
72 Ga0068860_100004577 3300005843 Bacteria 14118
73 Ga0068860_100323252 3300005843 Bacteria 1514
74 Ga0075366_10000073 3300006195 Bacteria 38953
75 Ga0097621_100097743 3300006237 Bacteria 2465
76 Ga0097621_100576320 3300006237 Bacteria 1026
77 Ga0068871_100092975 3300006358 Bacteria 2516
78 Ga0075428_100004788 3300006844 Bacteria 14994
79 Ga0075429_100460311 3300006880 Bacteria 1114
80 Ga0068865_100459085 3300006881 Bacteria 1055
81 Ga0105251_10076451 3300009011 Unclassified 1554
82 Ga0105240_10022581 3300009093 Bacteria 8338
83 Ga0105240_10089237 3300009093 Bacteria 3771
84 Ga0105240_10118003 3300009093 Bacteria 3198
85 Ga0111539_10230717 3300009094 Bacteria 2155
86 Ga0105245_10196727 3300009098 Bacteria 1934
87 Ga0105245_10573551 3300009098 Bacteria 1152
88 Ga0114129_10415559 3300009147 Unclassified 1770
89 Ga0114129_10596199 3300009147 Bacteria 1432
90 Ga0105243_10000003 3300009148 Bacteria 712931
91 Ga0105241_10378726 3300009174 Bacteria 1236
92 Ga0105242_10043325 3300009176 Bacteria 3640
93 Ga0105242_10121832 3300009176 Unclassified 2239
94 Ga0105242_10716753 3300009176 Bacteria 981
95 Ga0105237_10098164 3300009545 Bacteria 2920
96 Ga0105249_10018966 3300009553 Bacteria 6132
97 Ga0105249_10123231 3300009553 Bacteria 2466
98 Ga0105239_10000446 3300010375 Bacteria 60289
99 Ga0105239_10098888 3300010375 Bacteria 3225
100 Ga0105239_10104999 3300010375 Bacteria 3128
101 Ga0105239_10342818 3300010375 Bacteria 1686
102 Ga0105239_10507891 3300010375 Bacteria 1371
103 Ga0105239_10693848 3300010375 Bacteria 1164
104 Ga0157371_10042384 3300013102 Bacteria 3244
105 Ga0157371_10048693 3300013102 Bacteria 3013
106 Ga0157371_10213930 3300013102 Bacteria 1384
107 Ga0157370_10220302 3300013104 Bacteria 1757
108 Ga0157369_10319868 3300013105 Bacteria 1613
109 Ga0157374_10009075 3300013296 Bacteria 8521
110 Ga0157374_10063765 3300013296 Bacteria 3456
111 Ga0157374_10125185 3300013296 Bacteria 2484
112 Ga0157374_10561393 3300013296 Bacteria 1150
113 Ga0157378_10012146 3300013297 Bacteria 7542
114 Ga0157378_10012765 3300013297 Bacteria 7353
115 Ga0157378_10043428 3300013297 Bacteria 3991
116 Ga0163162_10199742 3300013306 Bacteria 2128
117 Ga0163162_10633288 3300013306 Bacteria 1194
118 Ga0157372_10121354 3300013307 Bacteria 3002
119 Ga0157375_10006376 3300013308 Bacteria 10285
120 Ga0157375_10228714 3300013308 Bacteria 2019
121 Ga0157376_10680855 3300014969 Bacteria 1032
122 Ga0157376_10785265 3300014969 Bacteria 964
123 Ga0182005_1000061 3300015265 Bacteria 98415
124 Ga0163161_10214741 3300017792 Bacteria 1487
125 Ga0213872_10013780 3300021361 Bacteria 3782
126 Ga0213876_10011312 3300021384 Bacteria 4765
127 Ga0209436_106343 3300025208 Bacteria 2605
128 Ga0209437_100507 3300025233 Bacteria 27709
129 Ga0209258_100029 3300025242 Bacteria 490648
130 Ga0209646_1000005 3300025246 Bacteria 717627
131 Ga0209026_1000344 3300025250 Bacteria 44543
132 Ga0209148_1000089 3300025254 Bacteria 253548
133 Ga0209129_1006483 3300025258 Bacteria 3766
134 Ga0209673_1000113 3300025273 Bacteria 179012
135 Ga0209130_1003558 3300025284 Bacteria 6519
136 Ga0209564_1017940 3300025295 Bacteria 2725
137 Ga0209564_1018401 3300025295 Bacteria 2665
138 Ga0209758_1001350 3300025297 Bacteria 29547
139 Ga0209758_1006022 3300025297 Bacteria 8957
140 Ga0209050_1000907 3300025298 Bacteria 39185
141 Ga0207426_1000415 3300025302 Bacteria 70247
142 Ga0207426_1000536 3300025302 Bacteria 54323
143 Ga0207426_1000636 3300025302 Bacteria 44207
144 Ga0207426_1009564 3300025302 Bacteria 3824
145 Ga0209257_1000004 3300025304 Bacteria 1678347
146 Ga0209257_1002522 3300025304 Bacteria 17986
147 Ga0207642_10175305 3300025899 Bacteria 1163
148 Ga0207688_10012663 3300025901 Bacteria 4590
149 Ga0207680_10098004 3300025903 Bacteria 1878
150 Ga0207647_10035660 3300025904 Bacteria 3168
151 Ga0207645_10014805 3300025907 Bacteria 5206
152 Ga0207643_10105886 3300025908 Bacteria 1653
153 Ga0207705_10039697 3300025909 Bacteria 3374
154 Ga0207707_10247614 3300025912 Bacteria 1548
155 Ga0207695_10000051 3300025913 Bacteria 399641
156 Ga0207695_10000056 3300025913 Bacteria 382433
157 Ga0207695_10000081 3300025913 Bacteria 284797
158 Ga0207695_10011948 3300025913 Bacteria 10454
159 Ga0207695_10183251 3300025913 Bacteria 2014
160 Ga0207695_10226678 3300025913 Bacteria 1774
161 Ga0207695_10295974 3300025913 Bacteria 1510
162 Ga0207671_10195443 3300025914 Bacteria 1578
163 Ga0207660_10008055 3300025917 Bacteria 6817
164 Ga0207652_10011555 3300025921 Bacteria 7120
165 Ga0207681_10261027 3300025923 Bacteria 1356
166 Ga0207650_10147343 3300025925 Bacteria 1855
167 Ga0207690_10230037 3300025932 Bacteria 1423
168 Ga0207706_10000009 3300025933 Bacteria 200607
169 Ga0207706_10131365 3300025933 Bacteria 2203
170 Ga0207686_10093287 3300025934 Unclassified 1993
171 Ga0207709_10000008 3300025935 Bacteria 713099
172 Ga0207691_10014699 3300025940 Bacteria 7461
173 Ga0207689_10009792 3300025942 Bacteria 8258
174 Ga0207712_10106798 3300025961 Bacteria 2092
175 Ga0207712_10136348 3300025961 Bacteria 1877
176 Ga0207668_10136133 3300025972 Bacteria 1882
177 Ga0207677_10453453 3300026023 Bacteria 1099
178 Ga0207639_10372583 3300026041 Bacteria 1280
179 Ga0207648_10059946 3300026089 Bacteria 3319
180 Ga0207648_10173662 3300026089 Bacteria 1905
181 Ga0207676_10072765 3300026095 Bacteria 2764
182 Ga0207675_100375933 3300026118 Bacteria 1396
183 Ga0207683_10003276 3300026121 Bacteria 14111
184 Ga0268266_10152701 3300028379 Bacteria 2083
185 Ga0268264_10012720 3300028381 Bacteria 6924
186 Ga0265323_10000258 3300028653 Bacteria 31094
187 Ga0307515_10000437 3300028794 Bacteria 100047
188 Ga0265330_10139789 3300031235 Bacteria 1030
189 Ga0265327_10000034 3300031251 Bacteria 316018
190 Ga0265327_10032005 3300031251 Bacteria 2950
191 Ga0265327_10219693 3300031251 Bacteria 855
192 Ga0265316_10005133 3300031344 Bacteria 12830
193 Ga0265316_10016192 3300031344 Bacteria 6477
194 Ga0307408_100001899 3300031548 Bacteria 15198
195 Ga0307408_100013466 3300031548 Bacteria 5429
196 Ga0316578_10117805 3300031728 Bacteria 1596
197 Ga0307412_10000925 3300031911 Bacteria 16779
198 Ga0307416_100208610 3300032002 Bacteria 1861
199 Ga0316574_0171854 3300035398 Bacteria 1395
200 Ga0373927_0277070 3300035695 Bacteria 1103
201 Ga0395899_0000021 3300037312 Bacteria 391702
202 Ga0395899_0009924 3300037312 Bacteria 7302
203 Ga0395900_0000197 3300037418 Bacteria 95775
204 Ga0395898_0011895 3300037466 Bacteria 9012
205 Ga0395905_0000186 3300037471 Bacteria 99159
206 Ga0395901_0000368 3300038443 Bacteria 54066
207 Ga0436365_1397768 3300039437 Bacteria 16178
208 Ga0436361_0967822 3300039447 Bacteria 7535
209 Ga0439436_0025243 3300041404 Bacteria 1747
210 Ga0451793_0247067 3300041452 Unclassified 1262
211 Ga0451795_0012540 3300041456 Bacteria 1515
212 Ga0451795_1190055 3300041456 Bacteria 974
213 Ga0451804_0030469 3300041463 Bacteria 787
214 Ga0439431_0015141 3300041997 Bacteria 1793
215 Ga0439431_0069722 3300041997 Bacteria 935
216 Ga0439445_0050955 3300042004 Bacteria 1117
217 Ga0439448_0001244 3300042005 Bacteria 6503
218 Ga0439457_007669 3300042014 Bacteria 2582
219 Ga0450894_002479 3300042131 Bacteria 2476
220 Ga0450896_006379 3300042133 Bacteria 1618
221 Ga0451577_0075696 3300042876 Bacteria 3001
222 Ga0451577_0139127 3300042876 Bacteria 2181
223 Ga0466972_0000212 3300044658 Bacteria 41192
224 Ga0453684_0000604 3300044712 Bacteria 132335
225 Ga0453684_0012787 3300044712 Bacteria 13768
226 Ga0453684_0017737 3300044712 Bacteria 10994
227 Ga0466970_0020982 3300044765 Bacteria 3400
228 Ga0466957_0015506 3300044842 Bacteria 4451
229 Ga0466957_0191897 3300044842 Bacteria 1339
230 Ga0466959_0063684 3300045049 Bacteria 2677
231 Ga0495650_0033440 3300046471 Bacteria 2288
232 Ga0495606_0011030 3300046507 Bacteria 7416
233 Ga0495606_0113921 3300046507 Bacteria 1627
234 Ga0495606_0255699 3300046507 Bacteria 969
235 Ga0495632_0072123 3300046519 Bacteria 1658
236 Ga0495632_0149632 3300046519 Bacteria 1080
237 Ga0495648_0031261 3300046524 Bacteria 3508
238 Ga0495625_0119158 3300046660 Bacteria 1798
239 Ga0495625_0221312 3300046660 Bacteria 1240
240 Ga0495687_054504 3300047443 Bacteria 1678
241 Ga0495686_0000010 3300047472 Bacteria 573229
242 Ga0495686_0000587 3300047472 Bacteria 51313
243 Ga0496115_0378172 3300048918 Bacteria 1152
244 Ga0496116_0005899 3300048919 Bacteria 11244
245 Ga0496117_0005949 3300048920 Bacteria 12577
246 Ga0496121_0000008 3300048924 Bacteria 843593
247 Ga0496122_0000198 3300048925 Bacteria 135710
248 Ga0496122_0003774 3300048925 Bacteria 19531
249 Ga0496122_0272878 3300048925 Bacteria 930
250 Ga0496123_0018910 3300048926 Bacteria 5453
251 Ga0496123_0062314 3300048926 Bacteria 2391
252 Ga0496124_0153682 3300048927 Bacteria 1802
253 Ga0496126_0000354 3300048929 Bacteria 96154
254 Ga0496126_0033056 3300048929 Bacteria 4868
255 Ga0501032_0212465 3300049569 Bacteria 1261
256 Ga0501034_0037681 3300049571 Bacteria 4897
257 Ga0501034_0176966 3300049571 Bacteria 2099
258 Ga0501034_0707635 3300049571 Bacteria 905
259 Ga0501047_0050690 3300049581 Bacteria 4009
260 Ga0501047_0154694 3300049581 Bacteria 2167
261 Ga0501199_003046 3300049650 Bacteria 1596
262 Ga0501242_014883 3300049674 Unclassified 966
263 Ga0501257_015088 3300049686 Bacteria 1782
264 Ga0501225_0021821 3300049705 Bacteria 1767
265 Ga0501241_001452 3300049758 Bacteria 4816
266 Ga0501241_021544 3300049758 Bacteria 1189
267 Ga0501264_008176 3300049761 Unclassified 985
268 Ga0501035_0263741 3300049822 Bacteria 1460
269 nmdc:mga0k408_18810_c1 3300050493 Bacteria 3856
270 nmdc:mga0k408_46785_c1 3300050493 Bacteria 2499
271 nmdc:mga0k408_626_c1 3300050493 Bacteria 19472
272 nmdc:mga05p37_1161189_c1 3300050507 Bacteria 802
273 Ga0500635_0011480 3300053080 Bacteria 2519
274 Ga0500644_0000155 3300053088 Bacteria 42910
275 Ga0500644_0088681 3300053088 Unclassified 1153
276 Ga0500646_0044858 3300053090 Bacteria 1256
277 Ga0500583_0000124 3300053092 Bacteria 35474
278 Ga0500641_0187236 3300053096 Bacteria 887
279 Ga0500650_0140196 3300053098 Bacteria 1121
280 Ga0500660_098004 3300053100 Bacteria 1288
281 Ga0500569_007553 3300053109 Bacteria 2447
282 Ga0500607_070661 3300053121 Bacteria 1804
283 Ga0500607_111803 3300053121 Bacteria 1337
284 Ga0500608_001805 3300053122 Bacteria 7635
285 Ga0500568_0038690 3300053139 Bacteria 1929
286 Ga0500616_0091732 3300053153 Bacteria 1503
287 Ga0500622_0000003 3300053156 Bacteria 613483
288 Ga0500622_0000225 3300053156 Bacteria 58778
289 Ga0500622_0000891 3300053156 Bacteria 25423
290 Ga0500622_0024042 3300053156 Bacteria 3224
291 2722730552 2721755487 Bacteria 6357185
292 2819576606 2818991442 Bacteria 8318214
293 2819677352 2818991460 Bacteria 7595395
294 2821143168 2821136567 Bacteria 8080116
295 2840679190 2840677318 Bacteria 2664183
296 2883070034 2883068021 Bacteria 6192739
297 2884797285 2884791551 Bacteria 8511252
298 2884935749 2884933994 Bacteria 4535041
299 2896087001 2896085136 Bacteria 6129793
300 2896114284 2896109856 Bacteria 7140722
301 2896319556 2896317667 Bacteria 4606601
302 2896346001 2896344016 Bacteria 3811746
303 2904470886 2904467357 Bacteria 8057758
304 2904785178 2904780799 Bacteria 5840761
305 2919181748 2919177583 Bacteria 5641607
306 2919440179 2919437846 Bacteria 6199444
307 2929177246 2929177148 Bacteria 7883697
308 2929239668 2929239360 Bacteria 7745570
309 2929921303 2929921140 Bacteria 8649150
310 2945979615 2945977869 Bacteria 7777518
311 2946014518 2946013367 Bacteria 7766675
312 8003157651 8003151029 Bacteria 8187759
313 Ga0068862_100462167
314 SwRhRL2b_contig_1949829
315 SwRhRL2b_contig_2949545
316 JGI25162J39368_1000563
317 JGI25158J39367_1002677
318 JGI25157J39369_1009920
319 JGI25153J46596_10028872
320 rootH2_10024240
321 rootH2_10076019
322 rootH2_10335410
323 rootL2_10023280
324 rootL2_10067655
325 rootL2_10079324
326 rootL2_10233549
327 rootH1_10007323
328 rootH1_10011647
329 rootH1_10046243
330 rootH1_10080363
331 JGI25160J50197_1000810
332 JGI25160J50197_1007425
333 Ga0055526_1008490
334 Ga0055526_1010377
335 Ga0055528_1000338
336 Ga0055530_10002988
337 Ga0055531_10000014
338 Ga0058863_11005245
339 Ga0065165_1000100
340 Ga0065165_1004399
341 Ga0065714_10002205
342 Ga0065714_10006137
343 Ga0065704_10072088
344 Ga0065704_10233339
345 Ga0070658_10029507
346 Ga0070658_10050510
347 Ga0070676_10043367
348 Ga0070683_100026708
349 Ga0068869_100048381
350 Ga0070680_100001753
351 Ga0068868_100028894
352 Ga0070691_10025083
353 Ga0070674_100154165
354 Ga0070673_100068052
355 Ga0070659_100101692
356 Ga0070667_100064693
357 Ga0070678_100580827
358 Ga0070662_100000003
359 Ga0070681_10024611
360 Ga0070707_100458301
361 Ga0070698_100013395
362 Ga0070699_100066386
363 Ga0070679_100002253
364 Ga0070684_100043313
365 Ga0070684_100137221
366 Ga0068853_100047125
367 Ga0068853_100488208
368 Ga0070665_100000212
369 Ga0070665_100077242
370 Ga0070665_100199308
371 Ga0068855_100478707
372 Ga0068857_100139253
373 Ga0068856_100000036
374 Ga0068852_100104477
375 Ga0068864_100055232
376 Ga0068864_100442238
377 Ga0068866_10011709
378 Ga0068861_100187666
379 Ga0068870_10105926
380 Ga0068858_100080903
381 Ga0068858_100113254
382 Ga0068860_100004577
383 Ga0068860_100323252
384 Ga0075366_10000073
385 Ga0097621_100097743
386 Ga0097621_100576320
387 Ga0068871_100092975
388 Ga0075428_100004788
389 Ga0075429_100460311
390 Ga0068865_100459085
391 Ga0105251_10076451
392 Ga0105240_10022581
393 Ga0105240_10089237
394 Ga0105240_10118003
395 Ga0111539_10230717
396 Ga0105245_10196727
397 Ga0105245_10573551
398 Ga0114129_10415559
399 Ga0114129_10596199
400 Ga0105243_10000003
401 Ga0105241_10378726
402 Ga0105242_10043325
403 Ga0105242_10121832
404 Ga0105242_10716753
405 Ga0105237_10098164
406 Ga0105249_10018966
407 Ga0105249_10123231
408 Ga0105239_10000446
409 Ga0105239_10098888
410 Ga0105239_10104999
411 Ga0105239_10342818
412 Ga0105239_10507891
413 Ga0105239_10693848
414 Ga0157371_10042384
415 Ga0157371_10048693
416 Ga0157371_10213930
417 Ga0157370_10220302
418 Ga0157369_10319868
419 Ga0157374_10009075
420 Ga0157374_10063765
421 Ga0157374_10125185
422 Ga0157374_10561393
423 Ga0157378_10012146
424 Ga0157378_10012765
425 Ga0157378_10043428
426 Ga0163162_10199742
427 Ga0163162_10633288
428 Ga0157372_10121354
429 Ga0157375_10006376
430 Ga0157375_10228714
431 Ga0157376_10680855
432 Ga0157376_10785265
433 Ga0182005_1000061
434 Ga0163161_10214741
435 Ga0213872_10013780
436 Ga0213876_10011312
437 Ga0209436_106343
438 Ga0209437_100507
439 Ga0209258_100029
440 Ga0209646_1000005
441 Ga0209026_1000344
442 Ga0209148_1000089
443 Ga0209129_1006483
444 Ga0209673_1000113
445 Ga0209130_1003558
446 Ga0209564_1017940
447 Ga0209564_1018401
448 Ga0209758_1001350
449 Ga0209758_1006022
450 Ga0209050_1000907
451 Ga0207426_1000415
452 Ga0207426_1000536
453 Ga0207426_1000636
454 Ga0207426_1009564
455 Ga0209257_1000004
456 Ga0209257_1002522
457 Ga0207642_10175305
458 Ga0207688_10012663
459 Ga0207680_10098004
460 Ga0207647_10035660
461 Ga0207645_10014805
462 Ga0207643_10105886
463 Ga0207705_10039697
464 Ga0207707_10247614
465 Ga0207695_10000051
466 Ga0207695_10000056
467 Ga0207695_10000081
468 Ga0207695_10011948
469 Ga0207695_10183251
470 Ga0207695_10226678
471 Ga0207695_10295974
472 Ga0207671_10195443
473 Ga0207660_10008055
474 Ga0207652_10011555
475 Ga0207681_10261027
476 Ga0207650_10147343
477 Ga0207690_10230037
478 Ga0207706_10000009
479 Ga0207706_10131365
480 Ga0207686_10093287
481 Ga0207709_10000008
482 Ga0207691_10014699
483 Ga0207689_10009792
484 Ga0207712_10106798
485 Ga0207712_10136348
486 Ga0207668_10136133
487 Ga0207677_10453453
488 Ga0207639_10372583
489 Ga0207648_10059946
490 Ga0207648_10173662
491 Ga0207676_10072765
492 Ga0207675_100375933
493 Ga0207683_10003276
494 Ga0268266_10152701
495 Ga0268264_10012720
496 Ga0265323_10000258
497 Ga0307515_10000437
498 Ga0265330_10139789
499 Ga0265327_10000034
500 Ga0265327_10032005
501 Ga0265327_10219693
502 Ga0265316_10005133
503 Ga0265316_10016192
504 Ga0307408_100001899
505 Ga0307408_100013466
506 Ga0316578_10117805
507 Ga0307412_10000925
508 Ga0307416_100208610
509 Ga0316574_0171854
510 Ga0373927_0277070
511 Ga0395899_0000021
512 Ga0395899_0009924
513 Ga0395900_0000197
514 Ga0395898_0011895
515 Ga0395905_0000186
516 Ga0395901_0000368
517 Ga0436365_1397768
518 Ga0436361_0967822
519 Ga0439436_0025243
520 Ga0451793_0247067
521 Ga0451795_0012540
522 Ga0451795_1190055
523 Ga0451804_0030469
524 Ga0439431_0015141
525 Ga0439431_0069722
526 Ga0439445_0050955
527 Ga0439448_0001244
528 Ga0439457_007669
529 Ga0450894_002479
530 Ga0450896_006379
531 Ga0451577_0075696
532 Ga0451577_0139127
533 Ga0466972_0000212
534 Ga0453684_0000604
535 Ga0453684_0012787
536 Ga0453684_0017737
537 Ga0466970_0020982
538 Ga0466957_0015506
539 Ga0466957_0191897
540 Ga0466959_0063684
541 Ga0495650_0033440
542 Ga0495606_0011030
543 Ga0495606_0113921
544 Ga0495606_0255699
545 Ga0495632_0072123
546 Ga0495632_0149632
547 Ga0495648_0031261
548 Ga0495625_0119158
549 Ga0495625_0221312
550 Ga0495687_054504
551 Ga0495686_0000010
552 Ga0495686_0000587
553 Ga0496115_0378172
554 Ga0496116_0005899
555 Ga0496117_0005949
556 Ga0496121_0000008
557 Ga0496122_0000198
558 Ga0496122_0003774
559 Ga0496122_0272878
560 Ga0496123_0018910
561 Ga0496123_0062314
562 Ga0496124_0153682
563 Ga0496126_0000354
564 Ga0496126_0033056
565 Ga0501032_0212465
566 Ga0501034_0037681
567 Ga0501034_0176966
568 Ga0501034_0707635
569 Ga0501047_0050690
570 Ga0501047_0154694
571 Ga0501199_003046
572 Ga0501242_014883
573 Ga0501257_015088
574 Ga0501225_0021821
575 Ga0501241_001452
576 Ga0501241_021544
577 Ga0501264_008176
578 Ga0501035_0263741
579 nmdc:mga0k408_18810_c1
580 nmdc:mga0k408_46785_c1
581 nmdc:mga0k408_626_c1
582 nmdc:mga05p37_1161189_c1
583 Ga0500635_0011480
584 Ga0500644_0000155
585 Ga0500644_0088681
586 Ga0500646_0044858
587 Ga0500583_0000124
588 Ga0500641_0187236
589 Ga0500650_0140196
590 Ga0500660_098004
591 Ga0500569_007553
592 Ga0500607_070661
593 Ga0500607_111803
594 Ga0500608_001805
595 Ga0500568_0038690
596 Ga0500616_0091732
597 Ga0500622_0000003
598 Ga0500622_0000225
599 Ga0500622_0000891
600 Ga0500622_0024042
601 2722730552
602 2819576606
603 2819677352
604 2821143168
605 2840679190
606 2883070034
607 2884797285
608 2884935749
609 2896087001
610 2896114284
611 2896319556
612 2896346001
613 2904470886
614 2904785178
615 2919181748
616 2919440179
617 2929177246
618 2929239668
619 2929921303
620 2945979615
621 2946014518
622 8003157651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

49

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9426 3 253
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9345 3 255
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9318 3 253
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9262 2 253
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9239 3 255
ID Description Score Start End Superfamily
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9389 1 254 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9365 3 253 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9319 1 254 3.20.20.140
af_Q55DK1_60_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9295 1 255 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9292 3 253 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1H7J1E2-F1-model_v4 TatD DNase family protein 0.9976 1 255 GO:0004536
GO:0005829
GO:0046872
AF-A0A3C0Z6M7-F1-model_v4 Hydrolase TatD 0.997 48 255 GO:0004536
GO:0005829
GO:0046872
AF-A0A6B3PV99-F1-model_v4 deleted 0.9954 1 255
AF-A0A520C897-F1-model_v4 TatD family deoxyribonuclease 0.9951 116 255 GO:0005829
GO:0016788
AF-A0A4U1C0V1-F1-model_v4 TatD family deoxyribonuclease 0.9949 1 255 GO:0004536
GO:0005829
GO:0046872

Map