F400636

General Info

Members Datasets Scaffolds Average Seq Length
310 171 295 136

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10291134|Ga0068870_102911342
Length 148
Sequence MRQGGAVASFVSHTTIDCTNAYELSEWWKPVLGYVDIDGDPNLPGHEECMIRDPESGHQVLFIEVPEPVRGKNWHFDVRPRERNRDDEVAWLVEYGATVVADHRGIYGPGSGWVTLADPEGNQLCVLRSRAELAAQEQAHQQTQEQDA

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221604 Nocardioides sp. Root190 Isolate Unclassified
3 2643221617 Nocardioides sp. Root79 Isolate Unclassified
4 2643221620 Nocardioides sp. Root240 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
7 2738541305 Nocardioides sp. CF167 Isolate Unclassified
8 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
9 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
10 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
11 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
12 2808606394 Promicromonospora sp. C35 Isolate Unclassified
13 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
14 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
15 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0.65
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.06
Nodule 0
Rhizoplane 9.35
Rhizosphere 55.16
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1056804 3300003578 Bacteria 2170
2 Ga0006562J51391_1056806 3300003578 Bacteria 1070
3 Ga0070658_10986308 3300005327 Bacteria 733
4 Ga0070683_102386652 3300005329 Bacteria 507
5 Ga0070668_100710893 3300005347 Bacteria 887
6 Ga0070675_101087463 3300005354 Bacteria 735
7 Ga0070674_100370104 3300005356 Bacteria 1163
8 Ga0070667_100020360 3300005367 Bacteria 5508
9 Ga0070667_100035648 3300005367 Bacteria 4169
10 Ga0070663_100053107 3300005455 Bacteria 2892
11 Ga0070684_100052735 3300005535 Bacteria 3538
12 Ga0068853_100024497 3300005539 Bacteria 5060
13 Ga0070693_100576884 3300005547 Bacteria 809
14 Ga0070665_100213044 3300005548 Bacteria 1933
15 Ga0070664_100006095 3300005564 Bacteria 9749
16 Ga0068857_100409951 3300005577 Bacteria 1262
17 Ga0068857_101345244 3300005577 Bacteria 694
18 Ga0068854_101369758 3300005578 Bacteria 639
19 Ga0068852_101237769 3300005616 Bacteria 768
20 Ga0068861_100432806 3300005719 Bacteria 1175
21 Ga0068851_10369377 3300005834 Bacteria 838
22 Ga0068870_10291134 3300005840 Bacteria 1027
23 Ga0068870_10310386 3300005840 Bacteria 999
24 Ga0068858_100127299 3300005842 Bacteria 2386
25 Ga0068860_100000300 3300005843 Bacteria 68717
26 Ga0081455_10214321 3300005937 Bacteria 1432
27 Ga0081538_10206576 3300005981 Bacteria 798
28 Ga0075365_10005971 3300006038 Bacteria 6642
29 Ga0075365_10008608 3300006038 Bacteria 5809
30 Ga0075365_10013208 3300006038 Bacteria 4927
31 Ga0075365_10014316 3300006038 Bacteria 4770
32 Ga0075365_10017941 3300006038 Bacteria 4342
33 Ga0075365_10045444 3300006038 Bacteria 2881
34 Ga0075365_10127346 3300006038 Bacteria 1760
35 Ga0075365_10173316 3300006038 Bacteria 1506
36 Ga0075365_10205539 3300006038 Bacteria 1380
37 Ga0075365_10215169 3300006038 Bacteria 1347
38 Ga0075365_10305406 3300006038 Bacteria 1120
39 Ga0075365_10455592 3300006038 Bacteria 903
40 Ga0075365_10548339 3300006038 Bacteria 818
41 Ga0075365_10789915 3300006038 Bacteria 670
42 Ga0075365_10903307 3300006038 Bacteria 623
43 Ga0075368_10010867 3300006042 Bacteria 3300
44 Ga0075368_10069023 3300006042 Bacteria 1425
45 Ga0075363_100017565 3300006048 Bacteria 3549
46 Ga0075363_100122493 3300006048 Bacteria 1453
47 Ga0075363_100139634 3300006048 Bacteria 1363
48 Ga0075363_100200364 3300006048 Bacteria 1140
49 Ga0075363_100618835 3300006048 Bacteria 650
50 Ga0075363_100737415 3300006048 Bacteria 596
51 Ga0075364_10002626 3300006051 Bacteria 10097
52 Ga0075364_10004169 3300006051 Bacteria 8292
53 Ga0075364_10007843 3300006051 Bacteria 6356
54 Ga0075364_10103153 3300006051 Bacteria 1899
55 Ga0075364_10233335 3300006051 Bacteria 1249
56 Ga0075364_10471743 3300006051 Bacteria 858
57 Ga0075364_10527881 3300006051 Bacteria 807
58 Ga0075364_11153604 3300006051 Bacteria 525
59 Ga0075362_10020546 3300006177 Bacteria 2761
60 Ga0075367_10011192 3300006178 Bacteria 4736
61 Ga0075367_10060748 3300006178 Bacteria 2254
62 Ga0075367_10085646 3300006178 Bacteria 1912
63 Ga0075367_10443993 3300006178 Bacteria 822
64 Ga0075369_10126321 3300006186 Bacteria 1160
65 Ga0097621_100315475 3300006237 Bacteria 1384
66 Ga0075370_10002047 3300006353 Bacteria 9160
67 Ga0075370_10002298 3300006353 Bacteria 8815
68 Ga0075370_10052959 3300006353 Bacteria 2303
69 Ga0075370_10084992 3300006353 Bacteria 1822
70 Ga0075370_10148185 3300006353 Bacteria 1375
71 Ga0075370_10445818 3300006353 Bacteria 779
72 Ga0075370_10980504 3300006353 Bacteria 518
73 Ga0075430_100084608 3300006846 Bacteria 2656
74 Ga0075431_100006469 3300006847 Bacteria 11634
75 Ga0075429_100178682 3300006880 Bacteria 1860
76 Ga0105245_10213862 3300009098 Bacteria 1857
77 Ga0105245_10279323 3300009098 Bacteria 1632
78 Ga0105245_12600978 3300009098 Bacteria 559
79 Ga0105243_10050215 3300009148 Bacteria 3294
80 Ga0105243_10338133 3300009148 Bacteria 1378
81 Ga0105243_10410497 3300009148 Bacteria 1260
82 Ga0105241_10335780 3300009174 Bacteria 1308
83 Ga0105242_10204387 3300009176 Bacteria 1756
84 Ga0105242_11320700 3300009176 Bacteria 746
85 Ga0105248_10063587 3300009177 Bacteria 4142
86 Ga0105238_10333242 3300009551 Bacteria 1505
87 Ga0105238_10622665 3300009551 Bacteria 1088
88 Ga0105249_10138819 3300009553 Bacteria 2328
89 Ga0105249_11557032 3300009553 Bacteria 733
90 Ga0105246_10372687 3300011119 Bacteria 1177
91 Ga0163162_10719043 3300013306 Bacteria 1119
92 Ga0157372_10796824 3300013307 Bacteria 1098
93 Ga0157372_11050945 3300013307 Bacteria 943
94 Ga0157375_10253844 3300013308 Bacteria 1919
95 Ga0157375_10416569 3300013308 Bacteria 1509
96 Ga0157375_10492828 3300013308 Bacteria 1390
97 Ga0157375_10895689 3300013308 Bacteria 1031
98 Ga0163163_10151685 3300014325 Bacteria 2361
99 Ga0163163_10704428 3300014325 Bacteria 1073
100 Ga0163163_12130537 3300014325 Bacteria 620
101 Ga0157380_11904647 3300014326 Bacteria 655
102 Ga0157377_10748830 3300014745 Bacteria 715
103 Ga0157379_10488369 3300014968 Bacteria 1140
104 Ga0163161_10041584 3300017792 Bacteria 3303
105 Ga0163161_10042982 3300017792 Bacteria 3252
106 Ga0207682_10386158 3300025893 Bacteria 661
107 Ga0207688_10161133 3300025901 Bacteria 1330
108 Ga0207643_10343357 3300025908 Bacteria 936
109 Ga0207654_10419105 3300025911 Bacteria 934
110 Ga0207687_10023009 3300025927 Bacteria 4150
111 Ga0207709_10497561 3300025935 Bacteria 951
112 Ga0207691_10605257 3300025940 Bacteria 927
113 Ga0207691_10865508 3300025940 Bacteria 757
114 Ga0207711_11253212 3300025941 Bacteria 683
115 Ga0207661_10618305 3300025944 Bacteria 995
116 Ga0207679_10005563 3300025945 Bacteria 7898
117 Ga0207679_10131296 3300025945 Bacteria 2010
118 Ga0207668_10501057 3300025972 Bacteria 1045
119 Ga0207658_10014306 3300025986 Bacteria 5434
120 Ga0207658_10028297 3300025986 Bacteria 3946
121 Ga0207677_10651321 3300026023 Bacteria 930
122 Ga0207678_10071734 3300026067 Bacteria 2969
123 Ga0207678_11746614 3300026067 Bacteria 546
124 Ga0207708_10118581 3300026075 Bacteria 2061
125 Ga0207698_12533931 3300026142 Bacteria 523
126 Ga0209813_10001311 3300027866 Bacteria 5558
127 Ga0268264_10000859 3300028381 Bacteria 32246
128 Ga0316177_1128929 3300030731 Bacteria 1084
129 Ga0307409_101035122 3300031995 Bacteria 840
130 Ga0307416_100729253 3300032002 Bacteria 1082
131 Ga0395900_0214598 3300037418 Bacteria 1942
132 Ga0395898_0154414 3300037466 Bacteria 2196
133 Ga0395905_1181405 3300037471 Bacteria 669
134 Ga0395901_0011790 3300038443 Bacteria 8864
135 Ga0451793_1916494 3300041452 Bacteria 1081
136 Ga0451806_038946 3300041462 Bacteria 562
137 Ga0451839_0817004 3300041496 Bacteria 645
138 Ga0451839_1218444 3300041496 Bacteria 2142
139 Ga0451851_1181004 3300041507 Bacteria 797
140 Ga0451853_0455593 3300041512 Bacteria 831
141 Ga0451853_1219260 3300041512 Bacteria 1299
142 Ga0450907_003155 3300042146 Bacteria 2984
143 Ga0466961_0022336 3300044693 Bacteria 4070
144 Ga0466963_0058751 3300044694 Bacteria 2565
145 Ga0466964_0046739 3300044706 Bacteria 1765
146 Ga0466964_0173799 3300044706 Bacteria 1016
147 Ga0466970_0111927 3300044765 Bacteria 1491
148 Ga0466960_0209388 3300044901 Bacteria 1068
149 Ga0495610_0143826 3300046512 Bacteria 1024
150 Ga0495658_0910122 3300046683 Bacteria 562
151 Ga0495680_0426952 3300047322 Bacteria 911
152 Ga0496100_0001175 3300048903 Bacteria 12744
153 Ga0496101_0018669 3300048904 Bacteria 4719
154 Ga0496101_0045186 3300048904 Bacteria 3154
155 Ga0496102_0208941 3300048905 Bacteria 1840
156 Ga0496102_0631798 3300048905 Bacteria 994
157 Ga0496103_0031265 3300048906 Bacteria 3242
158 Ga0496104_0002467 3300048907 Bacteria 15937
159 Ga0496104_1009027 3300048907 Bacteria 736
160 Ga0496105_0001589 3300048908 Bacteria 16093
161 Ga0496106_0007343 3300048909 Bacteria 8146
162 Ga0496106_0278763 3300048909 Bacteria 1339
163 Ga0496107_0005177 3300048910 Bacteria 8904
164 Ga0496108_0043557 3300048911 Bacteria 3749
165 Ga0496108_0434324 3300048911 Bacteria 1147
166 Ga0496108_0572126 3300048911 Bacteria 985
167 Ga0496108_1655284 3300048911 Bacteria 528
168 Ga0496109_0011650 3300048912 Bacteria 7562
169 Ga0496109_0392369 3300048912 Bacteria 1311
170 Ga0496110_0383951 3300048913 Bacteria 1280
171 Ga0496111_0282180 3300048914 Bacteria 1232
172 Ga0496112_0506069 3300048915 Bacteria 1143
173 Ga0496114_0001399 3300048917 Bacteria 18339
174 Ga0496114_0298512 3300048917 Bacteria 1422
175 Ga0496114_0307928 3300048917 Bacteria 1399
176 Ga0496114_0387428 3300048917 Bacteria 1237
177 Ga0496114_0442493 3300048917 Bacteria 1151
178 Ga0496115_0001142 3300048918 Bacteria 19160
179 Ga0496124_0993413 3300048927 Bacteria 501
180 Ga0501031_0129787 3300049568 Bacteria 1646
181 Ga0501031_0379767 3300049568 Bacteria 914
182 Ga0501032_0054038 3300049569 Bacteria 2704
183 Ga0501032_0080171 3300049569 Bacteria 2172
184 Ga0501033_0002604 3300049570 Bacteria 15204
185 Ga0501034_0006560 3300049571 Bacteria 12499
186 Ga0501034_0032665 3300049571 Bacteria 5285
187 Ga0501034_0332100 3300049571 Bacteria 1452
188 Ga0501034_0897909 3300049571 Bacteria 774
189 Ga0501036_0003946 3300049572 Bacteria 11922
190 Ga0501037_0004583 3300049573 Bacteria 10045
191 Ga0501037_0477204 3300049573 Bacteria 848
192 Ga0501038_0054997 3300049574 Bacteria 3421
193 Ga0501039_0001112 3300049575 Bacteria 19777
194 Ga0501039_0123635 3300049575 Bacteria 2029
195 Ga0501040_0454338 3300049576 Bacteria 922
196 Ga0501042_0260818 3300049578 Bacteria 1251
197 Ga0501042_0364091 3300049578 Bacteria 1046
198 Ga0501043_0003518 3300049579 Bacteria 12884
199 Ga0501043_0063002 3300049579 Bacteria 2912
200 Ga0501043_0213455 3300049579 Bacteria 1495
201 Ga0501043_0426924 3300049579 Bacteria 999
202 Ga0501046_0000071 3300049580 Bacteria 107260
203 Ga0501046_0561580 3300049580 Bacteria 813
204 Ga0501047_0254305 3300049581 Bacteria 1605
205 Ga0501047_0759186 3300049581 Bacteria 785
206 Ga0501048_0001814 3300049582 Bacteria 16221
207 Ga0501048_0359409 3300049582 Bacteria 1039
208 Ga0501048_0626815 3300049582 Bacteria 772
209 Ga0501067_0000668 3300049583 Bacteria 18450
210 Ga0501067_0072708 3300049583 Bacteria 1905
211 Ga0501067_0137524 3300049583 Bacteria 1360
212 Ga0501068_0006555 3300049584 Bacteria 6420
213 Ga0501068_0410329 3300049584 Bacteria 874
214 Ga0501068_0991016 3300049584 Bacteria 554
215 Ga0501069_0073903 3300049585 Bacteria 1912
216 Ga0501069_0830717 3300049585 Bacteria 561
217 Ga0501070_0014887 3300049586 Bacteria 6543
218 Ga0501070_0094471 3300049586 Bacteria 2474
219 Ga0501070_0110871 3300049586 Bacteria 2268
220 Ga0501070_0397165 3300049586 Bacteria 1115
221 Ga0501071_0049232 3300049587 Bacteria 3033
222 Ga0501071_0144205 3300049587 Bacteria 1775
223 Ga0501073_0001611 3300049589 Bacteria 16718
224 Ga0501073_0403524 3300049589 Bacteria 944
225 Ga0501074_0002738 3300049590 Bacteria 12327
226 Ga0501074_0362181 3300049590 Bacteria 1029
227 Ga0501074_0451647 3300049590 Bacteria 911
228 Ga0501075_0380593 3300049591 Bacteria 1076
229 Ga0501077_0010417 3300049593 Bacteria 5785
230 Ga0501079_0010519 3300049741 Bacteria 7034
231 Ga0501080_0003517 3300049742 Bacteria 13793
232 Ga0501080_0455097 3300049742 Bacteria 1147
233 Ga0501083_0053968 3300049744 Bacteria 2697
234 Ga0501035_0714397 3300049822 Bacteria 807
235 Ga0501044_0193227 3300049823 Bacteria 1997
236 Ga0501044_1256265 3300049823 Bacteria 608
237 Ga0501044_1350432 3300049823 Bacteria 579
238 Ga0501045_0057709 3300049824 Bacteria 2841
239 Ga0501045_0518114 3300049824 Bacteria 885
240 nmdc:mga03683_72320_c1 3300050489 Bacteria 1477
241 nmdc:mga03n38_207528_c1 3300050490 Bacteria 1017
242 nmdc:mga00v17_136780_c1 3300050491 Bacteria 1569
243 nmdc:mga00v17_176557_c1 3300050491 Bacteria 1378
244 nmdc:mga00v17_206912_c1 3300050491 Bacteria 1269
245 nmdc:mga00v17_211959_c1 3300050491 Bacteria 1253
246 nmdc:mga00v17_35804_c1 3300050491 Bacteria 2957
247 nmdc:mga00v17_401888_c1 3300050491 Bacteria 890
248 nmdc:mga00v17_542082_c1 3300050491 Bacteria 753
249 nmdc:mga00v17_607726_c1 3300050491 Bacteria 705
250 nmdc:mga00v17_611263_c1 3300050491 Bacteria 702
251 nmdc:mga00v17_845645_c1 3300050491 Bacteria 581
252 nmdc:mga0yw44_104906_c1 3300050492 Bacteria 1805
253 nmdc:mga0yw44_170262_c1 3300050492 Bacteria 1430
254 nmdc:mga0yw44_17371_c1 3300050492 Bacteria 3913
255 nmdc:mga0yw44_195458_c1 3300050492 Bacteria 1335
256 nmdc:mga0yw44_2118_c1 3300050492 Bacteria 8316
257 nmdc:mga0yw44_265764_c1 3300050492 Bacteria 1144
258 nmdc:mga0yw44_370909_c1 3300050492 Bacteria 966
259 nmdc:mga0yw44_389807_c1 3300050492 Bacteria 941
260 nmdc:mga0yw44_49220_c1 3300050492 Bacteria 2543
261 nmdc:mga0yw44_518794_c1 3300050492 Bacteria 809
262 nmdc:mga0yw44_60297_c1 3300050492 Bacteria 2324
263 nmdc:mga0yw44_6224_c1 3300050492 Bacteria 5742
264 nmdc:mga0yw44_696158_c1 3300050492 Bacteria 690
265 nmdc:mga0yw44_87959_c1 3300050492 Bacteria 1959
266 nmdc:mga06z11_118121_c1 3300050494 Bacteria 1477
267 nmdc:mga06z11_24047_c1 3300050494 Bacteria 2869
268 nmdc:mga06z11_38895_c1 3300050494 Bacteria 2365
269 nmdc:mga06z11_584194_c1 3300050494 Bacteria 679
270 nmdc:mga04h51_3471_c1 3300050495 Bacteria 3835
271 nmdc:mga04h51_474803_c1 3300050495 Bacteria 532
272 nmdc:mga07m45_150012_c1 3300050496 Bacteria 1352
273 nmdc:mga07m45_15661_c1 3300050496 Bacteria 4050
274 nmdc:mga07m45_275177_c1 3300050496 Bacteria 979
275 nmdc:mga07m45_318735_c1 3300050496 Bacteria 904
276 nmdc:mga09592_213936_c1 3300050508 Bacteria 1670
277 nmdc:mga0qj67_84222_c1 3300050509 Bacteria 2549
278 nmdc:mga06r32_1297990_c1 3300050510 Bacteria 672
279 nmdc:mga06r32_6799_c1 3300050510 Bacteria 10281
280 nmdc:mga0sz30_202844_c1 3300050516 Bacteria 880
281 Ga0495601_0982577 3300053077 Bacteria 531
282 Ga0495619_0817319 3300053085 Bacteria 630
283 Ga0495619_1010371 3300053085 Bacteria 556
284 Ga0500644_0000093 3300053088 Bacteria 55990
285 Ga0500644_0391058 3300053088 Bacteria 605
286 Ga0500556_0011659 3300053104 Bacteria 2606
287 Ga0500593_004317 3300053117 Bacteria 5495
288 Ga0500568_0164480 3300053139 Bacteria 818
289 Ga0501084_0030503 3300054114 Bacteria 4508
290 Ga0590077_046598 3300059426 Bacteria 970
291 Ga0501082_0003526 3300060353 Bacteria 13661
292 Ga0501082_1160284 3300060353 Bacteria 675
293 Ga0501082_1653260 3300060353 Bacteria 559
294 Ga0530510_0288243 3300061734 Bacteria 1227
295 Ga0530510_0397382 3300061734 Bacteria 1039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_35804_c1 nmdc:mga00v17_35804_c1_26_421 123
2 3300050495 nmdc:mga04h51_474803_c1 nmdc:mga04h51_474803_c1_123_518 123
3 3300030731 Ga0316177_1128929 Ga0316177_11289292 125
4 iso_pu_bacteria 2643221604 2644033212 126
5 iso_pu_bacteria 2643221617 2644098270 126
6 iso_pu_bacteria 2643221620 2644119003 126
7 iso_pu_bacteria 2808606394 2809029727 126
8 iso_pu_bacteria 2811994874 2812334528 127
9 3300006038 Ga0075365_10005971 Ga0075365_100059713 128
10 3300006038 Ga0075365_10548339 Ga0075365_105483392 128
11 3300050492 nmdc:mga0yw44_389807_c1 nmdc:mga0yw44_389807_c1_310_696 128
12 3300050492 nmdc:mga0yw44_6224_c1 nmdc:mga0yw44_6224_c1_1409_1804 128
13 iso_pu_bacteria 2643221561 2643827727 128
14 iso_pu_bacteria 2643221696 2644534979 128
15 iso_pu_bacteria 2738541305 2738869954 128
16 iso_pu_bacteria 2738543027 2739324606 128
17 iso_pu_bacteria 2739367654 2739606501 128
18 iso_pu_bacteria 2758568522 2760306703 128
19 iso_pu_bacteria 2758568621 2760624815 128
20 iso_pu_bacteria 2835188231 2835191585 128
21 iso_pu_bacteria 2857481737 2857485905 128
22 3300005616 Ga0068852_101237769 Ga0068852_1012377691 129
23 3300005981 Ga0081538_10206576 Ga0081538_102065761 129
24 3300006038 Ga0075365_10789915 Ga0075365_107899152 129
25 3300006048 Ga0075363_100200364 Ga0075363_1002003641 129
26 3300006051 Ga0075364_10004169 Ga0075364_100041694 129
27 3300006353 Ga0075370_10002298 Ga0075370_100022984 129
28 3300006846 Ga0075430_100084608 Ga0075430_1000846084 129
29 3300006847 Ga0075431_100006469 Ga0075431_10000646911 129
30 3300006880 Ga0075429_100178682 Ga0075429_1001786822 129
31 3300013307 Ga0157372_10796824 Ga0157372_107968242 129
32 3300013308 Ga0157375_10253844 Ga0157375_102538441 129
33 3300014326 Ga0157380_11904647 Ga0157380_119046471 129
34 3300025901 Ga0207688_10161133 Ga0207688_101611332 129
35 3300044694 Ga0466963_0058751 Ga0466963_0058751_1724_2113 129
36 3300044706 Ga0466964_0046739 Ga0466964_0046739_671_1060 129
37 3300048917 Ga0496114_0307928 Ga0496114_0307928_151_567 129
38 3300050508 nmdc:mga09592_213936_c1 nmdc:mga09592_213936_c1_410_817 129
39 3300050509 nmdc:mga0qj67_84222_c1 nmdc:mga0qj67_84222_c1_1071_1478 129
40 3300050510 nmdc:mga06r32_6799_c1 nmdc:mga06r32_6799_c1_6019_6426 129
41 3300059426 Ga0590077_046598 Ga0590077_046598_539_946 129
42 3300005354 Ga0070675_101087463 Ga0070675_1010874631 130
43 3300005548 Ga0070665_100213044 Ga0070665_1002130444 130
44 3300006038 Ga0075365_10008608 Ga0075365_100086085 130
45 3300006038 Ga0075365_10127346 Ga0075365_101273463 130
46 3300006038 Ga0075365_10173316 Ga0075365_101733162 130
47 3300006038 Ga0075365_10455592 Ga0075365_104555922 130
48 3300006051 Ga0075364_10233335 Ga0075364_102333352 130
49 3300006051 Ga0075364_10527881 Ga0075364_105278812 130
50 3300006051 Ga0075364_11153604 Ga0075364_111536041 130
51 3300006353 Ga0075370_10148185 Ga0075370_101481852 130
52 3300009098 Ga0105245_10279323 Ga0105245_102793232 130
53 3300009174 Ga0105241_10335780 Ga0105241_103357802 130
54 3300009553 Ga0105249_11557032 Ga0105249_115570321 130
55 3300013308 Ga0157375_10492828 Ga0157375_104928281 130
56 3300014325 Ga0163163_10704428 Ga0163163_107044282 130
57 3300025908 Ga0207643_10343357 Ga0207643_103433572 130
58 3300025911 Ga0207654_10419105 Ga0207654_104191052 130
59 3300037418 Ga0395900_0214598 Ga0395900_0214598_373_765 130
60 3300044693 Ga0466961_0022336 Ga0466961_0022336_1472_1882 130
61 3300044765 Ga0466970_0111927 Ga0466970_0111927_428_838 130
62 3300048917 Ga0496114_0442493 Ga0496114_0442493_567_968 130
63 3300049570 Ga0501033_0002604 Ga0501033_0002604_13404_13796 130
64 3300049571 Ga0501034_0332100 Ga0501034_0332100_940_1332 130
65 3300049579 Ga0501043_0063002 Ga0501043_0063002_815_1207 130
66 3300049579 Ga0501043_0213455 Ga0501043_0213455_261_653 130
67 3300049580 Ga0501046_0000071 Ga0501046_0000071_29961_30353 130
68 3300049586 Ga0501070_0397165 Ga0501070_0397165_193_585 130
69 3300049742 Ga0501080_0455097 Ga0501080_0455097_122_514 130
70 3300049823 Ga0501044_1256265 Ga0501044_1256265_137_529 130
71 3300050491 nmdc:mga00v17_136780_c1 nmdc:mga00v17_136780_c1_422_829 130
72 3300050492 nmdc:mga0yw44_104906_c1 nmdc:mga0yw44_104906_c1_1096_1491 130
73 3300050492 nmdc:mga0yw44_265764_c1 nmdc:mga0yw44_265764_c1_555_950 130
74 3300050492 nmdc:mga0yw44_370909_c1 nmdc:mga0yw44_370909_c1_257_664 130
75 3300050492 nmdc:mga0yw44_518794_c1 nmdc:mga0yw44_518794_c1_139_534 130
76 3300050492 nmdc:mga0yw44_87959_c1 nmdc:mga0yw44_87959_c1_1514_1909 130
77 3300050496 nmdc:mga07m45_150012_c1 nmdc:mga07m45_150012_c1_783_1181 130
78 3300050510 nmdc:mga06r32_1297990_c1 nmdc:mga06r32_1297990_c1_255_653 130
79 3300053088 Ga0500644_0000093 Ga0500644_0000093_43319_43711 130
80 3300005347 Ga0070668_100710893 Ga0070668_1007108931 131
81 3300005840 Ga0068870_10291134 Ga0068870_102911342 131
82 3300005842 Ga0068858_100127299 Ga0068858_1001272993 131
83 3300006038 Ga0075365_10215169 Ga0075365_102151692 131
84 3300006048 Ga0075363_100017565 Ga0075363_1000175654 131
85 3300006178 Ga0075367_10060748 Ga0075367_100607481 131
86 3300006353 Ga0075370_10980504 Ga0075370_109805041 131
87 3300009098 Ga0105245_10213862 Ga0105245_102138622 131
88 3300009148 Ga0105243_10050215 Ga0105243_100502154 131
89 3300009176 Ga0105242_10204387 Ga0105242_102043873 131
90 3300009177 Ga0105248_10063587 Ga0105248_100635872 131
91 3300009551 Ga0105238_10333242 Ga0105238_103332423 131
92 3300009553 Ga0105249_10138819 Ga0105249_101388194 131
93 3300013308 Ga0157375_10416569 Ga0157375_104165692 131
94 3300014325 Ga0163163_10151685 Ga0163163_101516851 131
95 3300014745 Ga0157377_10748830 Ga0157377_107488302 131
96 3300014968 Ga0157379_10488369 Ga0157379_104883692 131
97 3300025927 Ga0207687_10023009 Ga0207687_100230093 131
98 3300025940 Ga0207691_10865508 Ga0207691_108655082 131
99 3300025945 Ga0207679_10131296 Ga0207679_101312962 131
100 3300025972 Ga0207668_10501057 Ga0207668_105010572 131
101 3300026023 Ga0207677_10651321 Ga0207677_106513212 131
102 3300027866 Ga0209813_10001311 Ga0209813_100013114 131
103 3300037466 Ga0395898_0154414 Ga0395898_0154414_645_1040 131
104 3300037471 Ga0395905_1181405 Ga0395905_1181405_29_424 131
105 3300038443 Ga0395901_0011790 Ga0395901_0011790_180_575 131
106 3300041496 Ga0451839_0817004 Ga0451839_0817004_171_593 131
107 3300041496 Ga0451839_1218444 Ga0451839_1218444_1698_2102 131
108 3300041507 Ga0451851_1181004 Ga0451851_1181004_202_606 131
109 3300048927 Ga0496124_0993413 Ga0496124_0993413_77_475 131
110 3300049571 Ga0501034_0897909 Ga0501034_0897909_287_682 131
111 3300049584 Ga0501068_0991016 Ga0501068_0991016_22_417 131
112 3300050490 nmdc:mga03n38_207528_c1 nmdc:mga03n38_207528_c1_173_583 131
113 3300050491 nmdc:mga00v17_401888_c1 nmdc:mga00v17_401888_c1_373_783 131
114 3300050491 nmdc:mga00v17_611263_c1 nmdc:mga00v17_611263_c1_20_418 131
115 3300050492 nmdc:mga0yw44_2118_c1 nmdc:mga0yw44_2118_c1_4708_5106 131
116 3300050494 nmdc:mga06z11_38895_c1 nmdc:mga06z11_38895_c1_1783_2193 131
117 3300050495 nmdc:mga04h51_3471_c1 nmdc:mga04h51_3471_c1_2144_2554 131
118 3300060353 Ga0501082_1160284 Ga0501082_1160284_223_618 131
119 3300003578 Ga0006562J51391_1056804 Ga0006562J51391_10568043 132
120 3300003578 Ga0006562J51391_1056806 Ga0006562J51391_10568062 132
121 3300005327 Ga0070658_10986308 Ga0070658_109863081 132
122 3300005329 Ga0070683_102386652 Ga0070683_1023866521 132
123 3300005356 Ga0070674_100370104 Ga0070674_1003701042 132
124 3300005367 Ga0070667_100020360 Ga0070667_1000203603 132
125 3300005367 Ga0070667_100035648 Ga0070667_1000356484 132
126 3300005455 Ga0070663_100053107 Ga0070663_1000531074 132
127 3300005535 Ga0070684_100052735 Ga0070684_1000527353 132
128 3300005539 Ga0068853_100024497 Ga0068853_1000244971 132
129 3300005547 Ga0070693_100576884 Ga0070693_1005768842 132
130 3300005564 Ga0070664_100006095 Ga0070664_1000060952 132
131 3300005577 Ga0068857_100409951 Ga0068857_1004099512 132
132 3300005577 Ga0068857_101345244 Ga0068857_1013452442 132
133 3300005578 Ga0068854_101369758 Ga0068854_1013697581 132
134 3300005719 Ga0068861_100432806 Ga0068861_1004328062 132
135 3300005834 Ga0068851_10369377 Ga0068851_103693771 132
136 3300005840 Ga0068870_10310386 Ga0068870_103103863 132
137 3300005843 Ga0068860_100000300 Ga0068860_10000030010 132
138 3300005937 Ga0081455_10214321 Ga0081455_102143212 132
139 3300006038 Ga0075365_10013208 Ga0075365_100132082 132
140 3300006038 Ga0075365_10014316 Ga0075365_100143163 132
141 3300006038 Ga0075365_10017941 Ga0075365_100179413 132
142 3300006038 Ga0075365_10045444 Ga0075365_100454443 132
143 3300006038 Ga0075365_10205539 Ga0075365_102055392 132
144 3300006038 Ga0075365_10305406 Ga0075365_103054062 132
145 3300006038 Ga0075365_10903307 Ga0075365_109033071 132
146 3300006042 Ga0075368_10010867 Ga0075368_100108672 132
147 3300006042 Ga0075368_10069023 Ga0075368_100690232 132
148 3300006048 Ga0075363_100122493 Ga0075363_1001224932 132
149 3300006048 Ga0075363_100139634 Ga0075363_1001396342 132
150 3300006048 Ga0075363_100618835 Ga0075363_1006188352 132
151 3300006048 Ga0075363_100737415 Ga0075363_1007374152 132
152 3300006051 Ga0075364_10002626 Ga0075364_100026265 132
153 3300006051 Ga0075364_10007843 Ga0075364_100078436 132
154 3300006051 Ga0075364_10103153 Ga0075364_101031533 132
155 3300006051 Ga0075364_10471743 Ga0075364_104717432 132
156 3300006177 Ga0075362_10020546 Ga0075362_100205463 132
157 3300006178 Ga0075367_10011192 Ga0075367_100111922 132
158 3300006178 Ga0075367_10085646 Ga0075367_100856463 132
159 3300006178 Ga0075367_10443993 Ga0075367_104439932 132
160 3300006186 Ga0075369_10126321 Ga0075369_101263212 132
161 3300006237 Ga0097621_100315475 Ga0097621_1003154754 132
162 3300006353 Ga0075370_10002047 Ga0075370_100020475 132
163 3300006353 Ga0075370_10052959 Ga0075370_100529593 132
164 3300006353 Ga0075370_10084992 Ga0075370_100849922 132
165 3300006353 Ga0075370_10445818 Ga0075370_104458182 132
166 3300009098 Ga0105245_12600978 Ga0105245_126009781 132
167 3300009148 Ga0105243_10338133 Ga0105243_103381332 132
168 3300009148 Ga0105243_10410497 Ga0105243_104104972 132
169 3300009176 Ga0105242_11320700 Ga0105242_113207001 132
170 3300009551 Ga0105238_10622665 Ga0105238_106226651 132
171 3300011119 Ga0105246_10372687 Ga0105246_103726871 132
172 3300013306 Ga0163162_10719043 Ga0163162_107190432 132
173 3300013307 Ga0157372_11050945 Ga0157372_110509452 132
174 3300013308 Ga0157375_10895689 Ga0157375_108956892 132
175 3300014325 Ga0163163_12130537 Ga0163163_121305371 132
176 3300017792 Ga0163161_10041584 Ga0163161_100415842 132
177 3300017792 Ga0163161_10042982 Ga0163161_100429822 132
178 3300025893 Ga0207682_10386158 Ga0207682_103861581 132
179 3300025935 Ga0207709_10497561 Ga0207709_104975611 132
180 3300025940 Ga0207691_10605257 Ga0207691_106052572 132
181 3300025941 Ga0207711_11253212 Ga0207711_112532122 132
182 3300025944 Ga0207661_10618305 Ga0207661_106183052 132
183 3300025945 Ga0207679_10005563 Ga0207679_100055637 132
184 3300025986 Ga0207658_10014306 Ga0207658_100143063 132
185 3300025986 Ga0207658_10028297 Ga0207658_100282973 132
186 3300026067 Ga0207678_10071734 Ga0207678_100717344 132
187 3300026067 Ga0207678_11746614 Ga0207678_117466141 132
188 3300026075 Ga0207708_10118581 Ga0207708_101185812 132
189 3300026142 Ga0207698_12533931 Ga0207698_125339311 132
190 3300028381 Ga0268264_10000859 Ga0268264_100008595 132
191 3300031995 Ga0307409_101035122 Ga0307409_1010351221 132
192 3300032002 Ga0307416_100729253 Ga0307416_1007292532 132
193 3300041452 Ga0451793_1916494 Ga0451793_1916494_565_978 132
194 3300041462 Ga0451806_038946 Ga0451806_038946_128_532 132
195 3300041512 Ga0451853_0455593 Ga0451853_0455593_264_689 132
196 3300041512 Ga0451853_1219260 Ga0451853_1219260_268_681 132
197 3300042146 Ga0450907_003155 Ga0450907_003155_282_698 132
198 3300044706 Ga0466964_0173799 Ga0466964_0173799_216_659 132
199 3300044901 Ga0466960_0209388 Ga0466960_0209388_215_613 132
200 3300046512 Ga0495610_0143826 Ga0495610_0143826_345_848 132
201 3300046683 Ga0495658_0910122 Ga0495658_0910122_24_455 132
202 3300047322 Ga0495680_0426952 Ga0495680_0426952_115_528 132
203 3300048903 Ga0496100_0001175 Ga0496100_0001175_11863_12291 132
204 3300048904 Ga0496101_0018669 Ga0496101_0018669_3800_4228 132
205 3300048904 Ga0496101_0045186 Ga0496101_0045186_43_471 132
206 3300048905 Ga0496102_0208941 Ga0496102_0208941_151_579 132
207 3300048905 Ga0496102_0631798 Ga0496102_0631798_130_528 132
208 3300048906 Ga0496103_0031265 Ga0496103_0031265_221_649 132
209 3300048907 Ga0496104_0002467 Ga0496104_0002467_15096_15524 132
210 3300048907 Ga0496104_1009027 Ga0496104_1009027_43_441 132
211 3300048908 Ga0496105_0001589 Ga0496105_0001589_2586_3014 132
212 3300048909 Ga0496106_0007343 Ga0496106_0007343_1142_1570 132
213 3300048909 Ga0496106_0278763 Ga0496106_0278763_540_968 132
214 3300048910 Ga0496107_0005177 Ga0496107_0005177_102_530 132
215 3300048911 Ga0496108_0043557 Ga0496108_0043557_1344_1772 132
216 3300048911 Ga0496108_0434324 Ga0496108_0434324_308_733 132
217 3300048911 Ga0496108_0572126 Ga0496108_0572126_281_709 132
218 3300048911 Ga0496108_1655284 Ga0496108_1655284_85_513 132
219 3300048912 Ga0496109_0011650 Ga0496109_0011650_2478_2906 132
220 3300048912 Ga0496109_0392369 Ga0496109_0392369_260_688 132
221 3300048913 Ga0496110_0383951 Ga0496110_0383951_411_839 132
222 3300048914 Ga0496111_0282180 Ga0496111_0282180_314_742 132
223 3300048915 Ga0496112_0506069 Ga0496112_0506069_427_855 132
224 3300048917 Ga0496114_0001399 Ga0496114_0001399_600_1028 132
225 3300048917 Ga0496114_0298512 Ga0496114_0298512_135_554 132
226 3300048917 Ga0496114_0387428 Ga0496114_0387428_230_658 132
227 3300048918 Ga0496115_0001142 Ga0496115_0001142_7860_8288 132
228 3300049568 Ga0501031_0129787 Ga0501031_0129787_1009_1419 132
229 3300049568 Ga0501031_0379767 Ga0501031_0379767_165_563 132
230 3300049569 Ga0501032_0054038 Ga0501032_0054038_1904_2323 132
231 3300049569 Ga0501032_0080171 Ga0501032_0080171_305_703 132
232 3300049571 Ga0501034_0006560 Ga0501034_0006560_7136_7555 132
233 3300049571 Ga0501034_0032665 Ga0501034_0032665_2931_3329 132
234 3300049572 Ga0501036_0003946 Ga0501036_0003946_8594_8992 132
235 3300049573 Ga0501037_0004583 Ga0501037_0004583_1090_1488 132
236 3300049573 Ga0501037_0477204 Ga0501037_0477204_35_454 132
237 3300049574 Ga0501038_0054997 Ga0501038_0054997_1511_1909 132
238 3300049575 Ga0501039_0001112 Ga0501039_0001112_12983_13381 132
239 3300049575 Ga0501039_0123635 Ga0501039_0123635_890_1288 132
240 3300049576 Ga0501040_0454338 Ga0501040_0454338_123_539 132
241 3300049578 Ga0501042_0260818 Ga0501042_0260818_805_1221 132
242 3300049578 Ga0501042_0364091 Ga0501042_0364091_169_567 132
243 3300049579 Ga0501043_0003518 Ga0501043_0003518_5473_5871 132
244 3300049579 Ga0501043_0426924 Ga0501043_0426924_356_772 132
245 3300049580 Ga0501046_0561580 Ga0501046_0561580_82_498 132
246 3300049581 Ga0501047_0254305 Ga0501047_0254305_360_779 132
247 3300049581 Ga0501047_0759186 Ga0501047_0759186_157_555 132
248 3300049582 Ga0501048_0001814 Ga0501048_0001814_14298_14696 132
249 3300049582 Ga0501048_0359409 Ga0501048_0359409_345_743 132
250 3300049582 Ga0501048_0626815 Ga0501048_0626815_180_596 132
251 3300049583 Ga0501067_0000668 Ga0501067_0000668_18014_18433 132
252 3300049583 Ga0501067_0072708 Ga0501067_0072708_988_1398 132
253 3300049583 Ga0501067_0137524 Ga0501067_0137524_349_747 132
254 3300049584 Ga0501068_0006555 Ga0501068_0006555_326_745 132
255 3300049584 Ga0501068_0410329 Ga0501068_0410329_25_435 132
256 3300049585 Ga0501069_0073903 Ga0501069_0073903_1075_1488 132
257 3300049585 Ga0501069_0830717 Ga0501069_0830717_80_496 132
258 3300049586 Ga0501070_0014887 Ga0501070_0014887_5932_6351 132
259 3300049586 Ga0501070_0094471 Ga0501070_0094471_543_941 132
260 3300049586 Ga0501070_0110871 Ga0501070_0110871_743_1156 132
261 3300049587 Ga0501071_0049232 Ga0501071_0049232_2087_2506 132
262 3300049587 Ga0501071_0144205 Ga0501071_0144205_746_1162 132
263 3300049589 Ga0501073_0001611 Ga0501073_0001611_14574_14993 132
264 3300049589 Ga0501073_0403524 Ga0501073_0403524_298_714 132
265 3300049590 Ga0501074_0002738 Ga0501074_0002738_686_1105 132
266 3300049590 Ga0501074_0362181 Ga0501074_0362181_120_536 132
267 3300049590 Ga0501074_0451647 Ga0501074_0451647_13_495 132
268 3300049591 Ga0501075_0380593 Ga0501075_0380593_436_852 132
269 3300049593 Ga0501077_0010417 Ga0501077_0010417_3629_4048 132
270 3300049741 Ga0501079_0010519 Ga0501079_0010519_1861_2280 132
271 3300049742 Ga0501080_0003517 Ga0501080_0003517_11505_11924 132
272 3300049744 Ga0501083_0053968 Ga0501083_0053968_1905_2324 132
273 3300049822 Ga0501035_0714397 Ga0501035_0714397_86_505 132
274 3300049823 Ga0501044_0193227 Ga0501044_0193227_856_1275 132
275 3300049823 Ga0501044_1350432 Ga0501044_1350432_15_413 132
276 3300049824 Ga0501045_0057709 Ga0501045_0057709_290_688 132
277 3300049824 Ga0501045_0518114 Ga0501045_0518114_416_814 132
278 3300050489 nmdc:mga03683_72320_c1 nmdc:mga03683_72320_c1_869_1291 132
279 3300050491 nmdc:mga00v17_176557_c1 nmdc:mga00v17_176557_c1_519_923 132
280 3300050491 nmdc:mga00v17_206912_c1 nmdc:mga00v17_206912_c1_17_433 132
281 3300050491 nmdc:mga00v17_211959_c1 nmdc:mga00v17_211959_c1_56_457 132
282 3300050491 nmdc:mga00v17_542082_c1 nmdc:mga00v17_542082_c1_161_577 132
283 3300050491 nmdc:mga00v17_607726_c1 nmdc:mga00v17_607726_c1_209_622 132
284 3300050491 nmdc:mga00v17_845645_c1 nmdc:mga00v17_845645_c1_38_445 132
285 3300050492 nmdc:mga0yw44_170262_c1 nmdc:mga0yw44_170262_c1_771_1175 132
286 3300050492 nmdc:mga0yw44_17371_c1 nmdc:mga0yw44_17371_c1_1188_1589 132
287 3300050492 nmdc:mga0yw44_195458_c1 nmdc:mga0yw44_195458_c1_259_675 132
288 3300050492 nmdc:mga0yw44_49220_c1 nmdc:mga0yw44_49220_c1_487_900 132
289 3300050492 nmdc:mga0yw44_60297_c1 nmdc:mga0yw44_60297_c1_327_749 132
290 3300050492 nmdc:mga0yw44_696158_c1 nmdc:mga0yw44_696158_c1_16_423 132
291 3300050494 nmdc:mga06z11_118121_c1 nmdc:mga06z11_118121_c1_378_800 132
292 3300050494 nmdc:mga06z11_24047_c1 nmdc:mga06z11_24047_c1_1623_2036 132
293 3300050494 nmdc:mga06z11_584194_c1 nmdc:mga06z11_584194_c1_101_508 132
294 3300050496 nmdc:mga07m45_15661_c1 nmdc:mga07m45_15661_c1_1160_1582 132
295 3300050496 nmdc:mga07m45_275177_c1 nmdc:mga07m45_275177_c1_510_917 132
296 3300050496 nmdc:mga07m45_318735_c1 nmdc:mga07m45_318735_c1_385_801 132
297 3300050516 nmdc:mga0sz30_202844_c1 nmdc:mga0sz30_202844_c1_282_704 132
298 3300053077 Ga0495601_0982577 Ga0495601_0982577_90_515 132
299 3300053085 Ga0495619_0817319 Ga0495619_0817319_95_505 132
300 3300053085 Ga0495619_1010371 Ga0495619_1010371_45_470 132
301 3300053088 Ga0500644_0391058 Ga0500644_0391058_19_426 132
302 3300053104 Ga0500556_0011659 Ga0500556_0011659_83_481 132
303 3300053117 Ga0500593_004317 Ga0500593_004317_115_513 132
304 3300053139 Ga0500568_0164480 Ga0500568_0164480_50_451 132
305 3300054114 Ga0501084_0030503 Ga0501084_0030503_2010_2429 132
306 3300060353 Ga0501082_0003526 Ga0501082_0003526_10970_11389 132
307 3300060353 Ga0501082_1653260 Ga0501082_1653260_49_531 132
308 3300061734 Ga0530510_0288243 Ga0530510_0288243_513_923 132
309 3300061734 Ga0530510_0397382 Ga0530510_0397382_528_944 132
310 iso_pu_bacteria 2738541272 2738696864 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

13

127

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p7o-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (tetragonal form) 0.7581 1 124
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7578 1 127
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7535 1 131
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7479 1 127
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7449 1 131
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8789 2 121 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8507 2 121 3.10.180.10
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7926 2 58 3.30.720.120
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7606 69 124 3.30.720.110
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7476 1 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6G6WGM4-F1-model_v4 VOC family protein 0.9821 1 126
AF-A0A1H4KD70-F1-model_v4 Glyoxalase-like domain-containing protein 0.9801 1 130
AF-A1SF52-F1-model_v4 Glyoxalase-like domain-containing protein 0.9783 1 129
AF-A0A6M1QTS4-F1-model_v4 VOC family protein 0.9762 1 131
AF-A0A3D9UMZ4-F1-model_v4 Glyoxalase-like domain-containing protein 0.9691 1 123

Feature Viewer

pLDDT pTM Quality
93.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map