F400593

General Info

Members Datasets Scaffolds Average Seq Length
310 212 620 137

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101024248|Ga0070706_1010242481
Length 142
Sequence MSKSEMSNCIFCRIVAKENPAAVVFEDEHTLAFMDAGQVNPGHVLVAAKGHAENLYELNDAQAGALLRTAVRVARAVRDAYQPQGLSVYQANGKAAWQTVFHYHMHLVPRHDGDGMALTWPAKNPPREKLAEYAAQIRRTLA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 2547132512 Azospira oryzae 6a3 Isolate Unclassified
210 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
211 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
212 2848858292 Azospirillum brasilense Az39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 3.23
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 0.97
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_101024248 3300005467 Bacteria 761
2 JGI25406J46586_10011860 3300003203 Bacteria 3805
3 Ga0065704_10145223 3300005289 Bacteria 1478
4 Ga0065715_10339658 3300005293 Bacteria 969
5 Ga0070658_11387119 3300005327 Bacteria 610
6 Ga0070690_100074421 3300005330 Bacteria 2212
7 Ga0070690_101750073 3300005330 Bacteria 506
8 Ga0070680_100452327 3300005336 Bacteria 1097
9 Ga0070689_100061503 3300005340 Bacteria 2921
10 Ga0070687_100836738 3300005343 Unclassified 655
11 Ga0070668_100577511 3300005347 Bacteria 981
12 Ga0070673_100254111 3300005364 Bacteria 1533
13 Ga0070673_100273685 3300005364 Bacteria 1479
14 Ga0070711_100365944 3300005439 Bacteria 1162
15 Ga0070711_101391471 3300005439 Bacteria 610
16 Ga0070705_100001918 3300005440 Bacteria 10686
17 Ga0070705_101175846 3300005440 Unclassified 631
18 Ga0070700_101663543 3300005441 Bacteria 547
19 Ga0070694_100038233 3300005444 Bacteria 3188
20 Ga0070694_100102140 3300005444 Bacteria 2030
21 Ga0070708_101474619 3300005445 Bacteria 634
22 Ga0070678_100128151 3300005456 Bacteria 2012
23 Ga0070681_10000399 3300005458 Bacteria 35221
24 Ga0068867_100312499 3300005459 Bacteria 1299
25 Ga0070706_101029844 3300005467 Unclassified 759
26 Ga0070707_100450207 3300005468 Bacteria 1248
27 Ga0070707_101211736 3300005468 Unclassified 721
28 Ga0070698_100380665 3300005471 Bacteria 1344
29 Ga0070699_100244181 3300005518 Bacteria 1603
30 Ga0070699_100626472 3300005518 Bacteria 981
31 Ga0070679_100105969 3300005530 Bacteria 2797
32 Ga0070697_100000648 3300005536 Bacteria 26304
33 Ga0070672_100137758 3300005543 Bacteria 2011
34 Ga0070686_100218230 3300005544 Bacteria 1377
35 Ga0070695_100002348 3300005545 Bacteria 10850
36 Ga0070696_100004442 3300005546 Bacteria 9360
37 Ga0070696_100040818 3300005546 Bacteria 3205
38 Ga0070696_100180911 3300005546 Bacteria 1564
39 Ga0070696_100442521 3300005546 Bacteria 1024
40 Ga0070693_100463335 3300005547 Bacteria 892
41 Ga0070665_100854783 3300005548 Bacteria 923
42 Ga0070704_100314847 3300005549 Bacteria 1309
43 Ga0070704_100641062 3300005549 Bacteria 937
44 Ga0068855_101054460 3300005563 Bacteria 852
45 Ga0068857_100790753 3300005577 Bacteria 905
46 Ga0068857_101157422 3300005577 Bacteria 748
47 Ga0068856_100110478 3300005614 Bacteria 2746
48 Ga0068852_101837950 3300005616 Bacteria 628
49 Ga0068859_100441838 3300005617 Bacteria 1397
50 Ga0068859_101250548 3300005617 Bacteria 818
51 Ga0068864_100290007 3300005618 Bacteria 1530
52 Ga0068870_10376190 3300005840 Bacteria 918
53 Ga0068863_100160280 3300005841 Bacteria 2155
54 Ga0068863_101095654 3300005841 Bacteria 801
55 Ga0068858_100023585 3300005842 Bacteria 5732
56 Ga0068858_100357327 3300005842 Bacteria 1400
57 Ga0068860_100061663 3300005843 Bacteria 3563
58 Ga0081539_10004364 3300005985 Bacteria 15760
59 Ga0075365_10142888 3300006038 Bacteria 1662
60 Ga0075368_10034139 3300006042 Bacteria 1981
61 Ga0075363_100471300 3300006048 Bacteria 743
62 Ga0070715_10007353 3300006163 Bacteria 3790
63 Ga0070716_100112121 3300006173 Bacteria 1692
64 Ga0070716_100115152 3300006173 Bacteria 1673
65 Ga0075367_10200627 3300006178 Bacteria 1246
66 Ga0075367_10530372 3300006178 Unclassified 747
67 Ga0075369_10033627 3300006186 Bacteria 2173
68 Ga0075366_10067811 3300006195 Bacteria 2123
69 Ga0075370_10025222 3300006353 Bacteria 3286
70 Ga0075428_100089743 3300006844 Bacteria 3352
71 Ga0075433_10244712 3300006852 Bacteria 1592
72 Ga0075434_100000011 3300006871 Bacteria 86261
73 Ga0075434_100000064 3300006871 Bacteria 54394
74 Ga0075434_100066657 3300006871 Bacteria 3586
75 Ga0068865_101243400 3300006881 Bacteria 660
76 Ga0075436_100000050 3300006914 Bacteria 71245
77 Ga0075436_100001875 3300006914 Bacteria 14444
78 Ga0075436_100012843 3300006914 Bacteria 5741
79 Ga0075436_100032347 3300006914 Bacteria 3605
80 Ga0075436_100036877 3300006914 Bacteria 3375
81 Ga0075436_100255381 3300006914 Bacteria 1249
82 Ga0075436_100460728 3300006914 Bacteria 927
83 Ga0097620_100441858 3300006931 Bacteria 1397
84 Ga0097620_101250723 3300006931 Bacteria 818
85 Ga0075435_100001865 3300007076 Bacteria 13702
86 Ga0075435_100002850 3300007076 Bacteria 11577
87 Ga0075435_100021245 3300007076 Bacteria 4988
88 Ga0075435_100041710 3300007076 Bacteria 3669
89 Ga0075435_100542431 3300007076 Bacteria 1007
90 Ga0111539_10011245 3300009094 Bacteria 11244
91 Ga0111539_10108906 3300009094 Bacteria 3251
92 Ga0114129_10365327 3300009147 Bacteria 1909
93 Ga0114129_10912719 3300009147 Bacteria 1112
94 Ga0114129_12714506 3300009147 Bacteria 590
95 Ga0105242_12295193 3300009176 Bacteria 586
96 Ga0105249_12042286 3300009553 Bacteria 646
97 Ga0157378_13153059 3300013297 Bacteria 512
98 Ga0157375_10603815 3300013308 Bacteria 1256
99 Ga0157375_10995759 3300013308 Bacteria 978
100 Ga0207685_10051653 3300025905 Bacteria 1589
101 Ga0207707_10006862 3300025912 Bacteria 9930
102 Ga0207660_11192687 3300025917 Unclassified 619
103 Ga0207662_10295786 3300025918 Bacteria 1075
104 Ga0207662_10381681 3300025918 Bacteria 952
105 Ga0207652_10156352 3300025921 Bacteria 2043
106 Ga0207646_10605984 3300025922 Bacteria 983
107 Ga0207650_10426133 3300025925 Bacteria 1101
108 Ga0207659_11337140 3300025926 Bacteria 615
109 Ga0207644_10423793 3300025931 Bacteria 1091
110 Ga0207644_10513959 3300025931 Bacteria 989
111 Ga0207706_10457721 3300025933 Bacteria 1103
112 Ga0207670_10109996 3300025936 Bacteria 1984
113 Ga0207665_10032225 3300025939 Bacteria 3470
114 Ga0207665_10155085 3300025939 Bacteria 1643
115 Ga0207665_10337047 3300025939 Bacteria 1135
116 Ga0207711_10270955 3300025941 Bacteria 1562
117 Ga0207651_10303924 3300025960 Bacteria 1328
118 Ga0207703_10013617 3300026035 Bacteria 6338
119 Ga0207703_11283574 3300026035 Bacteria 704
120 Ga0207708_10329415 3300026075 Bacteria 1248
121 Ga0207702_10168555 3300026078 Bacteria 2006
122 Ga0207641_10151766 3300026088 Bacteria 2099
123 Ga0207641_10179562 3300026088 Bacteria 1938
124 Ga0207641_10739983 3300026088 Bacteria 970
125 Ga0207641_11182765 3300026088 Bacteria 764
126 Ga0207648_10278529 3300026089 Bacteria 1495
127 Ga0207648_10703673 3300026089 Bacteria 936
128 Ga0207676_10026632 3300026095 Bacteria 4300
129 Ga0207674_10640579 3300026116 Bacteria 1026
130 Ga0207683_10209871 3300026121 Bacteria 1772
131 Ga0209813_10052513 3300027866 Bacteria 1279
132 Ga0207428_10003935 3300027907 Bacteria 14240
133 Ga0268265_10568578 3300028380 Bacteria 1079
134 Ga0265334_10040659 3300028573 Bacteria 1820
135 Ga0265318_10014542 3300028577 Bacteria 3302
136 Ga0265338_10000164 3300028800 Bacteria 121166
137 Ga0307511_10000019 3300030521 Bacteria 117947
138 Ga0265330_10072180 3300031235 Unclassified 1493
139 Ga0265330_10330236 3300031235 Bacteria 644
140 Ga0265332_10000004 3300031238 Bacteria 426592
141 Ga0265328_10123045 3300031239 Unclassified 968
142 Ga0265325_10021515 3300031241 Bacteria 3542
143 Ga0265339_10000441 3300031249 Bacteria 32457
144 Ga0265339_10050703 3300031249 Bacteria 2269
145 Ga0265331_10010579 3300031250 Bacteria 5097
146 Ga0265327_10013587 3300031251 Bacteria 5400
147 Ga0265316_10004534 3300031344 Bacteria 13807
148 Ga0307408_100150214 3300031548 Bacteria 1838
149 Ga0265314_10000434 3300031711 Bacteria 55920
150 Ga0265342_10031208 3300031712 Bacteria 3296
151 Ga0265342_10083646 3300031712 Bacteria 1839
152 Ga0316578_10519002 3300031728 Bacteria 701
153 Ga0307405_10010623 3300031731 Bacteria 4784
154 Ga0307405_10054071 3300031731 Bacteria 2504
155 Ga0316577_10109195 3300031733 Bacteria 1552
156 Ga0307413_10088343 3300031824 Bacteria 2010
157 Ga0307410_10072464 3300031852 Bacteria 2392
158 Ga0307406_11304810 3300031901 Bacteria 633
159 Ga0307406_11324388 3300031901 Bacteria 629
160 Ga0307407_10037603 3300031903 Bacteria 2676
161 Ga0307412_10316581 3300031911 Bacteria 1240
162 Ga0307409_100029194 3300031995 Bacteria 3943
163 Ga0307409_100135769 3300031995 Bacteria 2111
164 Ga0307416_100909965 3300032002 Bacteria 980
165 Ga0307416_101177364 3300032002 Bacteria 872
166 Ga0307411_10004745 3300032005 Bacteria 6573
167 Ga0307411_10128812 3300032005 Bacteria 1846
168 Ga0307411_12241530 3300032005 Bacteria 512
169 Ga0307507_10127384 3300033179 Bacteria 2007
170 Ga0373926_0007307 3300035083 Bacteria 3680
171 Ga0373926_0119501 3300035083 Bacteria 993
172 Ga0373944_0032295 3300035089 Bacteria 1580
173 Ga0373944_0063361 3300035089 Bacteria 1190
174 Ga0373949_0054896 3300035090 Bacteria 1012
175 Ga0373936_0014294 3300035113 Bacteria 3032
176 Ga0373936_0022746 3300035113 Bacteria 2440
177 Ga0373936_0324289 3300035113 Bacteria 698
178 Ga0373939_0198607 3300035114 Bacteria 757
179 Ga0373945_0004362 3300035116 Bacteria 4491
180 Ga0373953_0445185 3300035117 Bacteria 572
181 Ga0373954_0281451 3300035118 Bacteria 820
182 Ga0373957_0196699 3300035120 Bacteria 839
183 Ga0373960_0011728 3300035121 Bacteria 2164
184 Ga0373943_0006998 3300035170 Bacteria 5059
185 Ga0373943_0007447 3300035170 Bacteria 4918
186 Ga0373946_0003571 3300035171 Bacteria 5518
187 Ga0373946_0032277 3300035171 Bacteria 2102
188 Ga0373961_0035127 3300035241 Bacteria 1421
189 Ga0373931_0183598 3300035691 Bacteria 1240
190 Ga0373931_0472892 3300035691 Bacteria 805
191 Ga0373935_0004026 3300035692 Bacteria 8590
192 Ga0373935_0045106 3300035692 Bacteria 2780
193 Ga0373927_0009261 3300035695 Bacteria 6604
194 Ga0373927_0105231 3300035695 Bacteria 1837
195 Ga0373933_0027517 3300035724 Bacteria 3275
196 Ga0373947_0014945 3300035725 Bacteria 4455
197 Ga0373937_0057209 3300036401 Bacteria 3582
198 Ga0316582_0596273 3300036647 Bacteria 761
199 Ga0373925_0022510 3300037068 Bacteria 4597
200 Ga0373925_0066677 3300037068 Bacteria 2713
201 Ga0395899_0001217 3300037312 Bacteria 22538
202 Ga0395899_0007491 3300037312 Bacteria 8430
203 Ga0395899_0126875 3300037312 Bacteria 1824
204 Ga0395900_0018804 3300037418 Bacteria 7046
205 Ga0395900_0023850 3300037418 Bacteria 6260
206 Ga0395900_0156114 3300037418 Bacteria 2330
207 Ga0395900_0525752 3300037418 Bacteria 1130
208 Ga0395898_0015963 3300037466 Bacteria 7694
209 Ga0395905_0036161 3300037471 Bacteria 4638
210 Ga0395901_0026817 3300038443 Bacteria 5916
211 Ga0395901_0109625 3300038443 Bacteria 2898
212 Ga0395901_0653286 3300038443 Bacteria 1055
213 Ga0451577_0006343 3300042876 Bacteria 11814
214 Ga0451577_0069927 3300042876 Bacteria 3131
215 Ga0451577_1113681 3300042876 Bacteria 706
216 Ga0451577_1621102 3300042876 Bacteria 570
217 Ga0466972_0169746 3300044658 Bacteria 1024
218 Ga0453683_0063729 3300044673 Bacteria 2304
219 Ga0466965_0311165 3300044683 Bacteria 856
220 Ga0466966_0001804 3300044684 Bacteria 13879
221 Ga0453684_0988066 3300044712 Bacteria 896
222 Ga0466957_0050588 3300044842 Bacteria 2529
223 Ga0466960_0380218 3300044901 Bacteria 810
224 Ga0451576_0025298 3300045051 Bacteria 6397
225 Ga0451576_0378130 3300045051 Bacteria 1484
226 Ga0451576_1124382 3300045051 Bacteria 822
227 Ga0466967_0017197 3300045976 Bacteria 5733
228 Ga0495603_0005065 3300046455 Bacteria 7874
229 Ga0495580_0001418 3300046472 Bacteria 21063
230 Ga0495582_0046311 3300046473 Bacteria 2395
231 Ga0495639_0003830 3300046475 Bacteria 6459
232 Ga0495594_0354700 3300046499 Bacteria 835
233 Ga0495606_0006508 3300046507 Bacteria 10748
234 Ga0495666_0016625 3300046526 Bacteria 3664
235 Ga0495642_0053809 3300046528 Bacteria 1659
236 Ga0495586_0004075 3300046535 Bacteria 7831
237 Ga0495621_0014501 3300046539 Bacteria 2495
238 Ga0495597_0001865 3300046542 Bacteria 14407
239 Ga0495588_0046550 3300046674 Bacteria 2225
240 Ga0495647_0052966 3300046681 Bacteria 1581
241 Ga0495658_0009927 3300046683 Bacteria 4750
242 Ga0495669_0008360 3300046684 Bacteria 4351
243 Ga0495581_0046097 3300047315 Bacteria 2519
244 Ga0495676_0174158 3300047321 Bacteria 1512
245 Ga0495687_000454 3300047443 Bacteria 50500
246 Ga0495626_0065588 3300048091 Bacteria 1643
247 Ga0496104_0736912 3300048907 Bacteria 893
248 Ga0496111_1078562 3300048914 Unclassified 573
249 Ga0496115_1038079 3300048918 Bacteria 625
250 Ga0501291_040906 3300049514 Bacteria 815
251 Ga0501298_049733 3300049521 Bacteria 867
252 Ga0501067_0142286 3300049583 Bacteria 1336
253 Ga0501069_0037532 3300049585 Bacteria 2674
254 Ga0501072_0207170 3300049588 Bacteria 1563
255 Ga0501073_0051910 3300049589 Bacteria 2872
256 Ga0501236_105711 3300049670 Bacteria 557
257 Ga0501083_0220409 3300049744 Bacteria 1236
258 Ga0501083_0337797 3300049744 Bacteria 979
259 Ga0501282_034901 3300049778 Bacteria 586
260 Ga0501044_0226846 3300049823 Bacteria 1817
261 nmdc:mga03683_22079_c1 3300050489 Bacteria 2463
262 nmdc:mga03683_273920_c1 3300050489 Bacteria 787
263 nmdc:mga03683_91473_c1 3300050489 Unclassified 1327
264 nmdc:mga03n38_281497_c1 3300050490 Unclassified 888
265 nmdc:mga0yw44_121256_c1 3300050492 Bacteria 1684
266 nmdc:mga0yw44_146323_c1 3300050492 Bacteria 1539
267 nmdc:mga06z11_812865_c1 3300050494 Unclassified 570
268 nmdc:mga07m45_180178_c1 3300050496 Bacteria 1229
269 nmdc:mga07m45_31944_c1 3300050496 Bacteria 2919
270 nmdc:mga05p37_402813_c1 3300050507 Bacteria 1597
271 nmdc:mga05p37_968970_c1 3300050507 Bacteria 908
272 nmdc:mga08y16_2348_c1 3300050511 Bacteria 19397
273 nmdc:mga0n895_1024931_c1 3300050512 Bacteria 806
274 nmdc:mga0n895_456_c1 3300050512 Bacteria 27409
275 nmdc:mga0n895_652010_c1 3300050512 Bacteria 1051
276 nmdc:mga0n895_960_c1 3300050512 Bacteria 20894
277 nmdc:mga0rr50_116964_c1 3300050513 Bacteria 2117
278 nmdc:mga0rr50_1253_c1 3300050513 Bacteria 13821
279 nmdc:mga0rr50_1836506_c1 3300050513 Bacteria 510
280 nmdc:mga0rr50_45654_c1 3300050513 Bacteria 3222
281 nmdc:mga0rr50_557384_c1 3300050513 Bacteria 976
282 nmdc:mga0rr50_5801_c1 3300050513 Bacteria 7417
283 nmdc:mga08x19_10314_c1 3300050514 Bacteria 5608
284 nmdc:mga08x19_103249_c1 3300050514 Bacteria 1894
285 nmdc:mga08x19_15035_c1 3300050514 Bacteria 4701
286 nmdc:mga08x19_159440_c1 3300050514 Bacteria 1532
287 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
288 nmdc:mga08x19_6608_c1 3300050514 Bacteria 6875
289 nmdc:mga0a205_12550_c1 3300050515 Bacteria 7842
290 nmdc:mga0a205_146519_c1 3300050515 Bacteria 1543
291 nmdc:mga0a205_533186_c1 3300050515 Unclassified 1030
292 Ga0500646_0009489 3300053090 Bacteria 2491
293 Ga0500583_0112291 3300053092 Bacteria 1343
294 Ga0500555_108076 3300053103 Unclassified 702
295 Ga0500568_0019574 3300053139 Bacteria 2939
296 Ga0500604_0000731 3300053151 Bacteria 9006
297 Ga0587082_008807 3300059504 Bacteria 1418
298 Ga0587082_013871 3300059504 Bacteria 1221
299 Ga0587083_0065854 3300059505 Bacteria 829
300 Ga0587067_002896 3300059640 Bacteria 2090
301 Ga0587075_026076 3300059644 Bacteria 902
302 Ga0587078_018897 3300059646 Bacteria 856
303 Ga0587079_003260 3300059647 Bacteria 2096
304 Ga0587107_016986 3300059652 Bacteria 969
305 Ga0587111_0004934 3300060346 Bacteria 2025
306 Ga0587111_0152569 3300060346 Bacteria 622
307 2548847579 2547132512 Bacteria 3416496
308 2599102082 2597490356 Bacteria 7030811
309 2846956277 2846952575 Bacteria 6587527
310 2848861913 2848858292 Bacteria 7391279
311 Ga0070706_101024248
312 JGI25406J46586_10011860
313 Ga0065704_10145223
314 Ga0065715_10339658
315 Ga0070658_11387119
316 Ga0070690_100074421
317 Ga0070690_101750073
318 Ga0070680_100452327
319 Ga0070689_100061503
320 Ga0070687_100836738
321 Ga0070668_100577511
322 Ga0070673_100254111
323 Ga0070673_100273685
324 Ga0070711_100365944
325 Ga0070711_101391471
326 Ga0070705_100001918
327 Ga0070705_101175846
328 Ga0070700_101663543
329 Ga0070694_100038233
330 Ga0070694_100102140
331 Ga0070708_101474619
332 Ga0070678_100128151
333 Ga0070681_10000399
334 Ga0068867_100312499
335 Ga0070706_101029844
336 Ga0070707_100450207
337 Ga0070707_101211736
338 Ga0070698_100380665
339 Ga0070699_100244181
340 Ga0070699_100626472
341 Ga0070679_100105969
342 Ga0070697_100000648
343 Ga0070672_100137758
344 Ga0070686_100218230
345 Ga0070695_100002348
346 Ga0070696_100004442
347 Ga0070696_100040818
348 Ga0070696_100180911
349 Ga0070696_100442521
350 Ga0070693_100463335
351 Ga0070665_100854783
352 Ga0070704_100314847
353 Ga0070704_100641062
354 Ga0068855_101054460
355 Ga0068857_100790753
356 Ga0068857_101157422
357 Ga0068856_100110478
358 Ga0068852_101837950
359 Ga0068859_100441838
360 Ga0068859_101250548
361 Ga0068864_100290007
362 Ga0068870_10376190
363 Ga0068863_100160280
364 Ga0068863_101095654
365 Ga0068858_100023585
366 Ga0068858_100357327
367 Ga0068860_100061663
368 Ga0081539_10004364
369 Ga0075365_10142888
370 Ga0075368_10034139
371 Ga0075363_100471300
372 Ga0070715_10007353
373 Ga0070716_100112121
374 Ga0070716_100115152
375 Ga0075367_10200627
376 Ga0075367_10530372
377 Ga0075369_10033627
378 Ga0075366_10067811
379 Ga0075370_10025222
380 Ga0075428_100089743
381 Ga0075433_10244712
382 Ga0075434_100000011
383 Ga0075434_100000064
384 Ga0075434_100066657
385 Ga0068865_101243400
386 Ga0075436_100000050
387 Ga0075436_100001875
388 Ga0075436_100012843
389 Ga0075436_100032347
390 Ga0075436_100036877
391 Ga0075436_100255381
392 Ga0075436_100460728
393 Ga0097620_100441858
394 Ga0097620_101250723
395 Ga0075435_100001865
396 Ga0075435_100002850
397 Ga0075435_100021245
398 Ga0075435_100041710
399 Ga0075435_100542431
400 Ga0111539_10011245
401 Ga0111539_10108906
402 Ga0114129_10365327
403 Ga0114129_10912719
404 Ga0114129_12714506
405 Ga0105242_12295193
406 Ga0105249_12042286
407 Ga0157378_13153059
408 Ga0157375_10603815
409 Ga0157375_10995759
410 Ga0207685_10051653
411 Ga0207707_10006862
412 Ga0207660_11192687
413 Ga0207662_10295786
414 Ga0207662_10381681
415 Ga0207652_10156352
416 Ga0207646_10605984
417 Ga0207650_10426133
418 Ga0207659_11337140
419 Ga0207644_10423793
420 Ga0207644_10513959
421 Ga0207706_10457721
422 Ga0207670_10109996
423 Ga0207665_10032225
424 Ga0207665_10155085
425 Ga0207665_10337047
426 Ga0207711_10270955
427 Ga0207651_10303924
428 Ga0207703_10013617
429 Ga0207703_11283574
430 Ga0207708_10329415
431 Ga0207702_10168555
432 Ga0207641_10151766
433 Ga0207641_10179562
434 Ga0207641_10739983
435 Ga0207641_11182765
436 Ga0207648_10278529
437 Ga0207648_10703673
438 Ga0207676_10026632
439 Ga0207674_10640579
440 Ga0207683_10209871
441 Ga0209813_10052513
442 Ga0207428_10003935
443 Ga0268265_10568578
444 Ga0265334_10040659
445 Ga0265318_10014542
446 Ga0265338_10000164
447 Ga0307511_10000019
448 Ga0265330_10072180
449 Ga0265330_10330236
450 Ga0265332_10000004
451 Ga0265328_10123045
452 Ga0265325_10021515
453 Ga0265339_10000441
454 Ga0265339_10050703
455 Ga0265331_10010579
456 Ga0265327_10013587
457 Ga0265316_10004534
458 Ga0307408_100150214
459 Ga0265314_10000434
460 Ga0265342_10031208
461 Ga0265342_10083646
462 Ga0316578_10519002
463 Ga0307405_10010623
464 Ga0307405_10054071
465 Ga0316577_10109195
466 Ga0307413_10088343
467 Ga0307410_10072464
468 Ga0307406_11304810
469 Ga0307406_11324388
470 Ga0307407_10037603
471 Ga0307412_10316581
472 Ga0307409_100029194
473 Ga0307409_100135769
474 Ga0307416_100909965
475 Ga0307416_101177364
476 Ga0307411_10004745
477 Ga0307411_10128812
478 Ga0307411_12241530
479 Ga0307507_10127384
480 Ga0373926_0007307
481 Ga0373926_0119501
482 Ga0373944_0032295
483 Ga0373944_0063361
484 Ga0373949_0054896
485 Ga0373936_0014294
486 Ga0373936_0022746
487 Ga0373936_0324289
488 Ga0373939_0198607
489 Ga0373945_0004362
490 Ga0373953_0445185
491 Ga0373954_0281451
492 Ga0373957_0196699
493 Ga0373960_0011728
494 Ga0373943_0006998
495 Ga0373943_0007447
496 Ga0373946_0003571
497 Ga0373946_0032277
498 Ga0373961_0035127
499 Ga0373931_0183598
500 Ga0373931_0472892
501 Ga0373935_0004026
502 Ga0373935_0045106
503 Ga0373927_0009261
504 Ga0373927_0105231
505 Ga0373933_0027517
506 Ga0373947_0014945
507 Ga0373937_0057209
508 Ga0316582_0596273
509 Ga0373925_0022510
510 Ga0373925_0066677
511 Ga0395899_0001217
512 Ga0395899_0007491
513 Ga0395899_0126875
514 Ga0395900_0018804
515 Ga0395900_0023850
516 Ga0395900_0156114
517 Ga0395900_0525752
518 Ga0395898_0015963
519 Ga0395905_0036161
520 Ga0395901_0026817
521 Ga0395901_0109625
522 Ga0395901_0653286
523 Ga0451577_0006343
524 Ga0451577_0069927
525 Ga0451577_1113681
526 Ga0451577_1621102
527 Ga0466972_0169746
528 Ga0453683_0063729
529 Ga0466965_0311165
530 Ga0466966_0001804
531 Ga0453684_0988066
532 Ga0466957_0050588
533 Ga0466960_0380218
534 Ga0451576_0025298
535 Ga0451576_0378130
536 Ga0451576_1124382
537 Ga0466967_0017197
538 Ga0495603_0005065
539 Ga0495580_0001418
540 Ga0495582_0046311
541 Ga0495639_0003830
542 Ga0495594_0354700
543 Ga0495606_0006508
544 Ga0495666_0016625
545 Ga0495642_0053809
546 Ga0495586_0004075
547 Ga0495621_0014501
548 Ga0495597_0001865
549 Ga0495588_0046550
550 Ga0495647_0052966
551 Ga0495658_0009927
552 Ga0495669_0008360
553 Ga0495581_0046097
554 Ga0495676_0174158
555 Ga0495687_000454
556 Ga0495626_0065588
557 Ga0496104_0736912
558 Ga0496111_1078562
559 Ga0496115_1038079
560 Ga0501291_040906
561 Ga0501298_049733
562 Ga0501067_0142286
563 Ga0501069_0037532
564 Ga0501072_0207170
565 Ga0501073_0051910
566 Ga0501236_105711
567 Ga0501083_0220409
568 Ga0501083_0337797
569 Ga0501282_034901
570 Ga0501044_0226846
571 nmdc:mga03683_22079_c1
572 nmdc:mga03683_273920_c1
573 nmdc:mga03683_91473_c1
574 nmdc:mga03n38_281497_c1
575 nmdc:mga0yw44_121256_c1
576 nmdc:mga0yw44_146323_c1
577 nmdc:mga06z11_812865_c1
578 nmdc:mga07m45_180178_c1
579 nmdc:mga07m45_31944_c1
580 nmdc:mga05p37_402813_c1
581 nmdc:mga05p37_968970_c1
582 nmdc:mga08y16_2348_c1
583 nmdc:mga0n895_1024931_c1
584 nmdc:mga0n895_456_c1
585 nmdc:mga0n895_652010_c1
586 nmdc:mga0n895_960_c1
587 nmdc:mga0rr50_116964_c1
588 nmdc:mga0rr50_1253_c1
589 nmdc:mga0rr50_1836506_c1
590 nmdc:mga0rr50_45654_c1
591 nmdc:mga0rr50_557384_c1
592 nmdc:mga0rr50_5801_c1
593 nmdc:mga08x19_10314_c1
594 nmdc:mga08x19_103249_c1
595 nmdc:mga08x19_15035_c1
596 nmdc:mga08x19_159440_c1
597 nmdc:mga08x19_55_c1
598 nmdc:mga08x19_6608_c1
599 nmdc:mga0a205_12550_c1
600 nmdc:mga0a205_146519_c1
601 nmdc:mga0a205_533186_c1
602 Ga0500646_0009489
603 Ga0500583_0112291
604 Ga0500555_108076
605 Ga0500568_0019574
606 Ga0500604_0000731
607 Ga0587082_008807
608 Ga0587082_013871
609 Ga0587083_0065854
610 Ga0587067_002896
611 Ga0587075_026076
612 Ga0587078_018897
613 Ga0587079_003260
614 Ga0587107_016986
615 Ga0587111_0004934
616 Ga0587111_0152569
617 2548847579
618 2599102082
619 2846956277
620 2848861913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

16

113

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

8

119

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9341 1 134
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9295 1 134
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9213 1 134
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.914 1 134
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9121 14 134
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9709 17 104 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9618 3 107 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9595 17 105 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9213 1 134 3.30.428.10
2eo4A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9075 4 135 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A838MGY5-F1-model_v4 HIT family protein 0.9743 4 105 GO:0003824
GO:0009117
AF-A0A3N5E9W3-F1-model_v4 HIT family protein 0.9727 2 105 GO:0003824
GO:0009117
AF-A0A3C1G8C5-F1-model_v4 HIT domain-containing protein 0.9721 1 105 GO:0003824
GO:0009117
AF-A0A2E5KGQ5-F1-model_v4 HIT family hydrolase 0.9719 3 111 GO:0009117
GO:0016787
AF-A0A661WLP6-F1-model_v4 HIT family protein 0.9693 1 105 GO:0003824
GO:0009117

Map