F400592

General Info

Members Datasets Scaffolds Average Seq Length
310 195 620 148

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100672208|Ga0070706_1006722082
Length 173
Sequence MQKTAWAITSGDWAIATEAKGGRQMDFRLLMTLQVAVGGLQKVGAVPQGTRVTAPIASGHFEGPRLRGKVLPGGGDWTLLRGDGVLELDLRITLETDDGALIHMRSFGIRHGPPDVIAALARGASVDPATYYFRTTPRFETGRPKYAFLNRLIAVSSGDRRPEGPIYTIDEIL

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.48
Rhizosphere 91.61
Stem 0
Stem Tuber 0
Unclassified 15.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100672208 3300005467 Bacteria 961
2 Ga0065712_10051165 3300005290 Unclassified 694
3 Ga0065715_10000545 3300005293 Bacteria 10603
4 Ga0065715_10121179 3300005293 Bacteria 2237
5 Ga0070676_10077819 3300005328 Bacteria 2005
6 Ga0070690_100034165 3300005330 Bacteria 3186
7 Ga0068869_100132924 3300005334 Bacteria 1914
8 Ga0068869_100226941 3300005334 Bacteria 1482
9 Ga0070680_100865686 3300005336 Unclassified 779
10 Ga0070680_100974135 3300005336 Bacteria 732
11 Ga0070682_100855881 3300005337 Bacteria 743
12 Ga0070689_100248677 3300005340 Bacteria 1466
13 Ga0070691_10021467 3300005341 Bacteria 2988
14 Ga0070687_100091797 3300005343 Bacteria 1681
15 Ga0070692_10026814 3300005345 Bacteria 2852
16 Ga0070669_101223071 3300005353 Unclassified 649
17 Ga0070675_100034364 3300005354 Bacteria 4114
18 Ga0070675_100870606 3300005354 Unclassified 825
19 Ga0070671_100186522 3300005355 Bacteria 1757
20 Ga0070674_100301384 3300005356 Bacteria 1278
21 Ga0070674_100597320 3300005356 Unclassified 932
22 Ga0070673_100018791 3300005364 Bacteria 4949
23 Ga0070688_100109622 3300005365 Bacteria 1834
24 Ga0070659_100691796 3300005366 Bacteria 881
25 Ga0070667_101707544 3300005367 Bacteria 592
26 Ga0070709_10830225 3300005434 Unclassified 727
27 Ga0070701_10289857 3300005438 Unclassified 1002
28 Ga0070705_100117748 3300005440 Bacteria 1709
29 Ga0070705_100161944 3300005440 Bacteria 1497
30 Ga0070705_100254514 3300005440 Archaea 1234
31 Ga0070705_100395749 3300005440 Bacteria 1021
32 Ga0070700_100089202 3300005441 Bacteria 2008
33 Ga0070694_100244213 3300005444 Bacteria 1355
34 Ga0070708_100172876 3300005445 Bacteria 2018
35 Ga0070708_100313546 3300005445 Bacteria 1478
36 Ga0070708_101221484 3300005445 Unclassified 703
37 Ga0070678_102083926 3300005456 Bacteria 537
38 Ga0070662_100045613 3300005457 Bacteria 3146
39 Ga0070681_10095128 3300005458 Bacteria 2928
40 Ga0068867_100113942 3300005459 Unclassified 2081
41 Ga0070685_10379202 3300005466 Bacteria 974
42 Ga0070707_100187500 3300005468 Bacteria 2016
43 Ga0070707_100548371 3300005468 Bacteria 1118
44 Ga0070698_101544166 3300005471 Bacteria 616
45 Ga0070699_100060637 3300005518 Bacteria 3279
46 Ga0070699_100105303 3300005518 Bacteria 2474
47 Ga0070684_101527669 3300005535 Bacteria 629
48 Ga0070697_100017802 3300005536 Bacteria 5595
49 Ga0070697_100019436 3300005536 Bacteria 5368
50 Ga0070697_100128999 3300005536 Bacteria 2119
51 Ga0070697_100330195 3300005536 Bacteria 1315
52 Ga0070697_100363909 3300005536 Bacteria 1250
53 Ga0070697_100711245 3300005536 Bacteria 887
54 Ga0068853_100047898 3300005539 Bacteria 3669
55 Ga0068853_100477268 3300005539 Bacteria 1175
56 Ga0070672_100048428 3300005543 Bacteria 3303
57 Ga0070686_100045922 3300005544 Bacteria 2753
58 Ga0070695_100107101 3300005545 Bacteria 1891
59 Ga0070695_100519420 3300005545 Bacteria 924
60 Ga0070695_100624456 3300005545 Unclassified 848
61 Ga0070695_101107429 3300005545 Unclassified 648
62 Ga0070696_100211586 3300005546 Bacteria 1451
63 Ga0070696_100248525 3300005546 Bacteria 1344
64 Ga0070696_100683594 3300005546 Bacteria 835
65 Ga0070696_100748843 3300005546 Bacteria 800
66 Ga0070693_100761751 3300005547 Bacteria 714
67 Ga0070665_100023515 3300005548 Bacteria 6204
68 Ga0070665_100689616 3300005548 Bacteria 1034
69 Ga0070704_100126280 3300005549 Bacteria 1974
70 Ga0070704_100724336 3300005549 Bacteria 884
71 Ga0068855_100851522 3300005563 Bacteria 966
72 Ga0070664_100446439 3300005564 Bacteria 1187
73 Ga0068857_100022193 3300005577 Bacteria 5584
74 Ga0068854_100317260 3300005578 Bacteria 1265
75 Ga0068854_100576784 3300005578 Bacteria 957
76 Ga0068856_100673115 3300005614 Bacteria 1055
77 Ga0068852_100494039 3300005616 Bacteria 1218
78 Ga0068859_100213473 3300005617 Bacteria 2016
79 Ga0068866_10205804 3300005718 Bacteria 1178
80 Ga0068861_100140729 3300005719 Bacteria 1969
81 Ga0068851_10300003 3300005834 Unclassified 923
82 Ga0068863_100051932 3300005841 Bacteria 3885
83 Ga0068863_102204356 3300005841 Bacteria 561
84 Ga0068858_100355558 3300005842 Bacteria 1403
85 Ga0068860_100249626 3300005843 Bacteria 1728
86 Ga0068862_100649682 3300005844 Bacteria 1017
87 Ga0081540_1000218 3300005983 Bacteria 60872
88 Ga0070715_10939057 3300006163 Bacteria 535
89 Ga0097621_100003934 3300006237 Bacteria 10290
90 Ga0097621_101733043 3300006237 Bacteria 595
91 Ga0068871_100038944 3300006358 Bacteria 3801
92 Ga0068871_100186382 3300006358 Bacteria 1785
93 Ga0068871_100791096 3300006358 Bacteria 874
94 Ga0075428_101460651 3300006844 Unclassified 717
95 Ga0075433_10152102 3300006852 Bacteria 2058
96 Ga0075433_10174880 3300006852 Bacteria 1910
97 Ga0075433_10198093 3300006852 Bacteria 1786
98 Ga0075433_10398141 3300006852 Bacteria 1215
99 Ga0075433_10450361 3300006852 Unclassified 1135
100 Ga0075434_100201680 3300006871 Bacteria 2009
101 Ga0075434_100201756 3300006871 Bacteria 2009
102 Ga0075434_100459725 3300006871 Bacteria 1294
103 Ga0075434_100556918 3300006871 Unclassified 1166
104 Ga0075434_100730049 3300006871 Bacteria 1008
105 Ga0075434_100934429 3300006871 Unclassified 882
106 Ga0075436_100210983 3300006914 Bacteria 1376
107 Ga0097620_100213473 3300006931 Bacteria 2016
108 Ga0075435_100013478 3300007076 Bacteria 6083
109 Ga0075435_100081062 3300007076 Bacteria 2665
110 Ga0075435_100522668 3300007076 Bacteria 1027
111 Ga0099794_10022746 3300007265 Bacteria 2860
112 Ga0099794_10156398 3300007265 Bacteria 1158
113 Ga0099795_10241289 3300007788 Unclassified 776
114 Ga0099795_10278147 3300007788 Unclassified 730
115 Ga0105240_10423653 3300009093 Bacteria 1495
116 Ga0111539_10065505 3300009094 Bacteria 4292
117 Ga0111539_11380600 3300009094 Bacteria 817
118 Ga0105245_10183973 3300009098 Bacteria 1998
119 Ga0105245_11231594 3300009098 Bacteria 797
120 Ga0105247_10269043 3300009101 Bacteria 1171
121 Ga0114129_10059843 3300009147 Bacteria 5326
122 Ga0114129_10619216 3300009147 Bacteria 1400
123 Ga0114129_11058643 3300009147 Bacteria 1018
124 Ga0114129_11636145 3300009147 Unclassified 787
125 Ga0105243_10435399 3300009148 Bacteria 1226
126 Ga0105241_10180653 3300009174 Bacteria 1750
127 Ga0105242_10850429 3300009176 Bacteria 908
128 Ga0105248_10071830 3300009177 Bacteria 3889
129 Ga0105248_10419805 3300009177 Bacteria 1506
130 Ga0105249_10376285 3300009553 Bacteria 1445
131 Ga0105249_10420388 3300009553 Bacteria 1370
132 Ga0099796_10103674 3300010159 Bacteria 1074
133 Ga0099796_10334795 3300010159 Unclassified 649
134 Ga0105239_10156541 3300010375 Bacteria 2545
135 Ga0105239_10231687 3300010375 Bacteria 2072
136 Ga0157374_10227292 3300013296 Unclassified 1833
137 Ga0157378_10330596 3300013297 Bacteria 1483
138 Ga0157378_11902133 3300013297 Unclassified 644
139 Ga0157375_11320868 3300013308 Bacteria 848
140 Ga0157380_10385203 3300014326 Bacteria 1325
141 Ga0157377_10074327 3300014745 Bacteria 1972
142 Ga0157377_10271367 3300014745 Bacteria 1108
143 Ga0157379_10343920 3300014968 Bacteria 1365
144 Ga0157376_10543111 3300014969 Bacteria 1149
145 Ga0157376_10579672 3300014969 Unclassified 1114
146 Ga0163161_11281623 3300017792 Unclassified 636
147 Ga0207697_10261623 3300025315 Bacteria 766
148 Ga0207656_10056514 3300025321 Bacteria 1711
149 Ga0207642_10170207 3300025899 Bacteria 1178
150 Ga0207688_10081045 3300025901 Bacteria 1853
151 Ga0207680_10126853 3300025903 Bacteria 1676
152 Ga0207647_10360712 3300025904 Unclassified 822
153 Ga0207685_10092578 3300025905 Bacteria 1276
154 Ga0207684_10233431 3300025910 Bacteria 1587
155 Ga0207654_10277179 3300025911 Bacteria 1133
156 Ga0207707_10092063 3300025912 Bacteria 2649
157 Ga0207695_10313235 3300025913 Unclassified 1459
158 Ga0207662_10013384 3300025918 Bacteria 4588
159 Ga0207646_10173462 3300025922 Bacteria 1947
160 Ga0207681_10236498 3300025923 Bacteria 1420
161 Ga0207681_10312403 3300025923 Bacteria 1247
162 Ga0207659_10093277 3300025926 Bacteria 2253
163 Ga0207659_10297403 3300025926 Bacteria 1325
164 Ga0207687_11607630 3300025927 Bacteria 558
165 Ga0207644_10146658 3300025931 Bacteria 1822
166 Ga0207690_10387565 3300025932 Bacteria 1112
167 Ga0207686_10191761 3300025934 Bacteria 1457
168 Ga0207686_10884671 3300025934 Bacteria 720
169 Ga0207709_10071848 3300025935 Bacteria 2199
170 Ga0207669_10015326 3300025937 Bacteria 3864
171 Ga0207665_10043554 3300025939 Bacteria 3001
172 Ga0207665_10091586 3300025939 Bacteria 2108
173 Ga0207691_10096462 3300025940 Bacteria 2643
174 Ga0207711_10014552 3300025941 Bacteria 6539
175 Ga0207711_10081239 3300025941 Bacteria 2832
176 Ga0207689_10007881 3300025942 Bacteria 9303
177 Ga0207689_10094313 3300025942 Bacteria 2458
178 Ga0207667_10059400 3300025949 Bacteria 4005
179 Ga0207667_10980494 3300025949 Bacteria 833
180 Ga0207651_10021079 3300025960 Bacteria 3950
181 Ga0207712_10244791 3300025961 Bacteria 1446
182 Ga0207712_10796071 3300025961 Unclassified 831
183 Ga0207640_10248525 3300025981 Bacteria 1379
184 Ga0207677_10594151 3300026023 Bacteria 971
185 Ga0207703_10384029 3300026035 Bacteria 1300
186 Ga0207703_10544106 3300026035 Bacteria 1094
187 Ga0207639_10092960 3300026041 Bacteria 2418
188 Ga0207639_10652520 3300026041 Unclassified 974
189 Ga0207678_10201094 3300026067 Bacteria 1704
190 Ga0207708_10004603 3300026075 Bacteria 10148
191 Ga0207708_10801668 3300026075 Bacteria 811
192 Ga0207708_10847296 3300026075 Bacteria 789
193 Ga0207708_10956651 3300026075 Bacteria 743
194 Ga0207708_11633418 3300026075 Unclassified 566
195 Ga0207641_10393670 3300026088 Archaea 1329
196 Ga0207641_10464591 3300026088 Bacteria 1225
197 Ga0207648_10019406 3300026089 Bacteria 6136
198 Ga0207683_10467501 3300026121 Bacteria 1163
199 Ga0209179_1088348 3300027512 Unclassified 686
200 Ga0209588_1124228 3300027671 Bacteria 825
201 Ga0268266_10001376 3300028379 Bacteria 29304
202 Ga0268266_11935371 3300028379 Bacteria 563
203 Ga0268265_10364628 3300028380 Bacteria 1324
204 Ga0268264_11503793 3300028381 Bacteria 684
205 Ga0265334_10003743 3300028573 Bacteria 6876
206 Ga0265336_10011556 3300028666 Bacteria 2995
207 Ga0307515_10203118 3300028794 Bacteria 1851
208 Ga0265338_10017232 3300028800 Bacteria 7802
209 Ga0265338_10024070 3300028800 Bacteria 6232
210 Ga0265332_10176695 3300031238 Bacteria 890
211 Ga0265328_10006695 3300031239 Bacteria 4853
212 Ga0265328_10091700 3300031239 Bacteria 1123
213 Ga0265328_10108228 3300031239 Unclassified 1032
214 Ga0265320_10093659 3300031240 Bacteria 1389
215 Ga0265320_10380914 3300031240 Unclassified 623
216 Ga0265325_10023665 3300031241 Bacteria 3349
217 Ga0265340_10006978 3300031247 Bacteria 6166
218 Ga0265339_10004445 3300031249 Bacteria 9565
219 Ga0265339_10027524 3300031249 Bacteria 3245
220 Ga0265339_10033745 3300031249 Bacteria 2879
221 Ga0265339_10304532 3300031249 Bacteria 759
222 Ga0307513_10152174 3300031456 Bacteria 2220
223 Ga0307509_10033554 3300031507 Bacteria 5649
224 Ga0307509_10210717 3300031507 Bacteria 1768
225 Ga0307509_10288527 3300031507 Bacteria 1397
226 Ga0265313_10097007 3300031595 Bacteria 1314
227 Ga0265313_10444512 3300031595 Bacteria 504
228 Ga0265314_10030369 3300031711 Bacteria 4000
229 Ga0265342_10001129 3300031712 Bacteria 25534
230 Ga0265342_10001646 3300031712 Bacteria 20579
231 Ga0265342_10165238 3300031712 Bacteria 1221
232 Ga0307516_10004567 3300031730 Bacteria 17005
233 Ga0373948_0030285 3300034817 Bacteria 1087
234 Ga0373959_0152048 3300034820 Unclassified 586
235 Ga0373945_0138565 3300035116 Bacteria 979
236 Ga0373945_0380706 3300035116 Bacteria 616
237 Ga0373943_0008200 3300035170 Bacteria 4689
238 Ga0373946_0629428 3300035171 Bacteria 558
239 Ga0373962_0307111 3300035242 Unclassified 564
240 Ga0373947_0220587 3300035725 Bacteria 1246
241 Ga0373937_0098168 3300036401 Unclassified 2717
242 Ga0373937_1119110 3300036401 Bacteria 736
243 Ga0373925_0427749 3300037068 Bacteria 1082
244 Ga0451839_0884232 3300041496 Bacteria 718
245 Ga0451849_1283458 3300041505 Bacteria 10425
246 Ga0451853_1622913 3300041512 Bacteria 11665
247 Ga0453683_0218122 3300044673 Bacteria 1213
248 Ga0451576_0063441 3300045051 Unclassified 3851
249 Ga0451576_0206981 3300045051 Bacteria 2049
250 Ga0451576_2129006 3300045051 Bacteria 577
251 Ga0495638_0064412 3300046460 Bacteria 2258
252 Ga0495580_0099861 3300046472 Bacteria 2019
253 Ga0495585_0257856 3300046492 Bacteria 868
254 Ga0495618_0583926 3300046514 Unclassified 666
255 Ga0495586_0710424 3300046535 Bacteria 580
256 Ga0495621_0004695 3300046539 Bacteria 3869
257 Ga0495622_0076300 3300046557 Bacteria 1544
258 Ga0495656_0022625 3300046615 Bacteria 2464
259 Ga0495659_0086643 3300046664 Unclassified 1197
260 Ga0495659_0161850 3300046664 Bacteria 904
261 Ga0495647_0465855 3300046681 Unclassified 586
262 Ga0495669_0059581 3300046684 Bacteria 1725
263 Ga0495589_0070454 3300046794 Bacteria 1709
264 Ga0495581_0186915 3300047315 Unclassified 1212
265 Ga0495680_0098900 3300047322 Bacteria 2176
266 Ga0496100_0160069 3300048903 Bacteria 1613
267 Ga0496100_0606775 3300048903 Bacteria 850
268 Ga0496101_0007360 3300048904 Bacteria 7129
269 Ga0496102_0589931 3300048905 Bacteria 1034
270 Ga0496102_0968876 3300048905 Bacteria 771
271 Ga0496104_0016036 3300048907 Bacteria 6802
272 Ga0496104_0616633 3300048907 Unclassified 995
273 Ga0496105_0109265 3300048908 Bacteria 2283
274 Ga0496106_0251700 3300048909 Unclassified 1412
275 Ga0496106_0354318 3300048909 Bacteria 1179
276 Ga0496106_0858054 3300048909 Bacteria 718
277 Ga0496107_0099607 3300048910 Bacteria 2130
278 Ga0496107_0204979 3300048910 Bacteria 1466
279 Ga0496109_0797085 3300048912 Bacteria 883
280 Ga0496112_0316896 3300048915 Bacteria 1504
281 Ga0496113_0157782 3300048916 Bacteria 1793
282 Ga0496114_0000710 3300048917 Bacteria 24771
283 nmdc:mga05p37_214563_c1 3300050507 Bacteria 2325
284 nmdc:mga05p37_266826_c1 3300050507 Bacteria 2047
285 nmdc:mga05p37_68231_c1 3300050507 Bacteria 4374
286 nmdc:mga08y16_81393_c1 3300050511 Bacteria 3376
287 nmdc:mga0n895_104481_c1 3300050512 Bacteria 2845
288 nmdc:mga0n895_1115213_c1 3300050512 Bacteria 766
289 nmdc:mga0n895_1237538_c1 3300050512 Unclassified 719
290 nmdc:mga0n895_256467_c1 3300050512 Bacteria 1775
291 nmdc:mga0n895_327353_c1 3300050512 Unclassified 1552
292 nmdc:mga0n895_408915_c1 3300050512 Bacteria 1372
293 nmdc:mga0n895_460184_c1 3300050512 Bacteria 1284
294 nmdc:mga0n895_753373_c1 3300050512 Unclassified 967
295 nmdc:mga0n895_92686_c1 3300050512 Bacteria 3024
296 nmdc:mga0n895_996290_c1 3300050512 Unclassified 819
297 nmdc:mga0rr50_328896_c1 3300050513 Bacteria 1283
298 nmdc:mga0rr50_3499_c1 3300050513 Bacteria 9049
299 nmdc:mga0rr50_520585_c1 3300050513 Bacteria 1012
300 nmdc:mga08x19_320924_c1 3300050514 Unclassified 1078
301 nmdc:mga08x19_47380_c1 3300050514 Bacteria 2751
302 nmdc:mga0a205_100392_c1 3300050515 Bacteria 2793
303 nmdc:mga0a205_127840_c1 3300050515 Unclassified 2441
304 nmdc:mga0a205_349844_c1 3300050515 Bacteria 1345
305 nmdc:mga0a205_450590_c1 3300050515 Bacteria 1147
306 nmdc:mga0a205_4991_c1 3300050515 Bacteria 11941
307 nmdc:mga0a205_73025_c1 3300050515 Bacteria 3315
308 nmdc:mga0a205_761421_c1 3300050515 Bacteria 817
309 Ga0495601_0516231 3300053077 Bacteria 770
310 Ga0495595_0111276 3300053084 Unclassified 1328
311 Ga0070706_100672208
312 Ga0065712_10051165
313 Ga0065715_10000545
314 Ga0065715_10121179
315 Ga0070676_10077819
316 Ga0070690_100034165
317 Ga0068869_100132924
318 Ga0068869_100226941
319 Ga0070680_100865686
320 Ga0070680_100974135
321 Ga0070682_100855881
322 Ga0070689_100248677
323 Ga0070691_10021467
324 Ga0070687_100091797
325 Ga0070692_10026814
326 Ga0070669_101223071
327 Ga0070675_100034364
328 Ga0070675_100870606
329 Ga0070671_100186522
330 Ga0070674_100301384
331 Ga0070674_100597320
332 Ga0070673_100018791
333 Ga0070688_100109622
334 Ga0070659_100691796
335 Ga0070667_101707544
336 Ga0070709_10830225
337 Ga0070701_10289857
338 Ga0070705_100117748
339 Ga0070705_100161944
340 Ga0070705_100254514
341 Ga0070705_100395749
342 Ga0070700_100089202
343 Ga0070694_100244213
344 Ga0070708_100172876
345 Ga0070708_100313546
346 Ga0070708_101221484
347 Ga0070678_102083926
348 Ga0070662_100045613
349 Ga0070681_10095128
350 Ga0068867_100113942
351 Ga0070685_10379202
352 Ga0070707_100187500
353 Ga0070707_100548371
354 Ga0070698_101544166
355 Ga0070699_100060637
356 Ga0070699_100105303
357 Ga0070684_101527669
358 Ga0070697_100017802
359 Ga0070697_100019436
360 Ga0070697_100128999
361 Ga0070697_100330195
362 Ga0070697_100363909
363 Ga0070697_100711245
364 Ga0068853_100047898
365 Ga0068853_100477268
366 Ga0070672_100048428
367 Ga0070686_100045922
368 Ga0070695_100107101
369 Ga0070695_100519420
370 Ga0070695_100624456
371 Ga0070695_101107429
372 Ga0070696_100211586
373 Ga0070696_100248525
374 Ga0070696_100683594
375 Ga0070696_100748843
376 Ga0070693_100761751
377 Ga0070665_100023515
378 Ga0070665_100689616
379 Ga0070704_100126280
380 Ga0070704_100724336
381 Ga0068855_100851522
382 Ga0070664_100446439
383 Ga0068857_100022193
384 Ga0068854_100317260
385 Ga0068854_100576784
386 Ga0068856_100673115
387 Ga0068852_100494039
388 Ga0068859_100213473
389 Ga0068866_10205804
390 Ga0068861_100140729
391 Ga0068851_10300003
392 Ga0068863_100051932
393 Ga0068863_102204356
394 Ga0068858_100355558
395 Ga0068860_100249626
396 Ga0068862_100649682
397 Ga0081540_1000218
398 Ga0070715_10939057
399 Ga0097621_100003934
400 Ga0097621_101733043
401 Ga0068871_100038944
402 Ga0068871_100186382
403 Ga0068871_100791096
404 Ga0075428_101460651
405 Ga0075433_10152102
406 Ga0075433_10174880
407 Ga0075433_10198093
408 Ga0075433_10398141
409 Ga0075433_10450361
410 Ga0075434_100201680
411 Ga0075434_100201756
412 Ga0075434_100459725
413 Ga0075434_100556918
414 Ga0075434_100730049
415 Ga0075434_100934429
416 Ga0075436_100210983
417 Ga0097620_100213473
418 Ga0075435_100013478
419 Ga0075435_100081062
420 Ga0075435_100522668
421 Ga0099794_10022746
422 Ga0099794_10156398
423 Ga0099795_10241289
424 Ga0099795_10278147
425 Ga0105240_10423653
426 Ga0111539_10065505
427 Ga0111539_11380600
428 Ga0105245_10183973
429 Ga0105245_11231594
430 Ga0105247_10269043
431 Ga0114129_10059843
432 Ga0114129_10619216
433 Ga0114129_11058643
434 Ga0114129_11636145
435 Ga0105243_10435399
436 Ga0105241_10180653
437 Ga0105242_10850429
438 Ga0105248_10071830
439 Ga0105248_10419805
440 Ga0105249_10376285
441 Ga0105249_10420388
442 Ga0099796_10103674
443 Ga0099796_10334795
444 Ga0105239_10156541
445 Ga0105239_10231687
446 Ga0157374_10227292
447 Ga0157378_10330596
448 Ga0157378_11902133
449 Ga0157375_11320868
450 Ga0157380_10385203
451 Ga0157377_10074327
452 Ga0157377_10271367
453 Ga0157379_10343920
454 Ga0157376_10543111
455 Ga0157376_10579672
456 Ga0163161_11281623
457 Ga0207697_10261623
458 Ga0207656_10056514
459 Ga0207642_10170207
460 Ga0207688_10081045
461 Ga0207680_10126853
462 Ga0207647_10360712
463 Ga0207685_10092578
464 Ga0207684_10233431
465 Ga0207654_10277179
466 Ga0207707_10092063
467 Ga0207695_10313235
468 Ga0207662_10013384
469 Ga0207646_10173462
470 Ga0207681_10236498
471 Ga0207681_10312403
472 Ga0207659_10093277
473 Ga0207659_10297403
474 Ga0207687_11607630
475 Ga0207644_10146658
476 Ga0207690_10387565
477 Ga0207686_10191761
478 Ga0207686_10884671
479 Ga0207709_10071848
480 Ga0207669_10015326
481 Ga0207665_10043554
482 Ga0207665_10091586
483 Ga0207691_10096462
484 Ga0207711_10014552
485 Ga0207711_10081239
486 Ga0207689_10007881
487 Ga0207689_10094313
488 Ga0207667_10059400
489 Ga0207667_10980494
490 Ga0207651_10021079
491 Ga0207712_10244791
492 Ga0207712_10796071
493 Ga0207640_10248525
494 Ga0207677_10594151
495 Ga0207703_10384029
496 Ga0207703_10544106
497 Ga0207639_10092960
498 Ga0207639_10652520
499 Ga0207678_10201094
500 Ga0207708_10004603
501 Ga0207708_10801668
502 Ga0207708_10847296
503 Ga0207708_10956651
504 Ga0207708_11633418
505 Ga0207641_10393670
506 Ga0207641_10464591
507 Ga0207648_10019406
508 Ga0207683_10467501
509 Ga0209179_1088348
510 Ga0209588_1124228
511 Ga0268266_10001376
512 Ga0268266_11935371
513 Ga0268265_10364628
514 Ga0268264_11503793
515 Ga0265334_10003743
516 Ga0265336_10011556
517 Ga0307515_10203118
518 Ga0265338_10017232
519 Ga0265338_10024070
520 Ga0265332_10176695
521 Ga0265328_10006695
522 Ga0265328_10091700
523 Ga0265328_10108228
524 Ga0265320_10093659
525 Ga0265320_10380914
526 Ga0265325_10023665
527 Ga0265340_10006978
528 Ga0265339_10004445
529 Ga0265339_10027524
530 Ga0265339_10033745
531 Ga0265339_10304532
532 Ga0307513_10152174
533 Ga0307509_10033554
534 Ga0307509_10210717
535 Ga0307509_10288527
536 Ga0265313_10097007
537 Ga0265313_10444512
538 Ga0265314_10030369
539 Ga0265342_10001129
540 Ga0265342_10001646
541 Ga0265342_10165238
542 Ga0307516_10004567
543 Ga0373948_0030285
544 Ga0373959_0152048
545 Ga0373945_0138565
546 Ga0373945_0380706
547 Ga0373943_0008200
548 Ga0373946_0629428
549 Ga0373962_0307111
550 Ga0373947_0220587
551 Ga0373937_0098168
552 Ga0373937_1119110
553 Ga0373925_0427749
554 Ga0451839_0884232
555 Ga0451849_1283458
556 Ga0451853_1622913
557 Ga0453683_0218122
558 Ga0451576_0063441
559 Ga0451576_0206981
560 Ga0451576_2129006
561 Ga0495638_0064412
562 Ga0495580_0099861
563 Ga0495585_0257856
564 Ga0495618_0583926
565 Ga0495586_0710424
566 Ga0495621_0004695
567 Ga0495622_0076300
568 Ga0495656_0022625
569 Ga0495659_0086643
570 Ga0495659_0161850
571 Ga0495647_0465855
572 Ga0495669_0059581
573 Ga0495589_0070454
574 Ga0495581_0186915
575 Ga0495680_0098900
576 Ga0496100_0160069
577 Ga0496100_0606775
578 Ga0496101_0007360
579 Ga0496102_0589931
580 Ga0496102_0968876
581 Ga0496104_0016036
582 Ga0496104_0616633
583 Ga0496105_0109265
584 Ga0496106_0251700
585 Ga0496106_0354318
586 Ga0496106_0858054
587 Ga0496107_0099607
588 Ga0496107_0204979
589 Ga0496109_0797085
590 Ga0496112_0316896
591 Ga0496113_0157782
592 Ga0496114_0000710
593 nmdc:mga05p37_214563_c1
594 nmdc:mga05p37_266826_c1
595 nmdc:mga05p37_68231_c1
596 nmdc:mga08y16_81393_c1
597 nmdc:mga0n895_104481_c1
598 nmdc:mga0n895_1115213_c1
599 nmdc:mga0n895_1237538_c1
600 nmdc:mga0n895_256467_c1
601 nmdc:mga0n895_327353_c1
602 nmdc:mga0n895_408915_c1
603 nmdc:mga0n895_460184_c1
604 nmdc:mga0n895_753373_c1
605 nmdc:mga0n895_92686_c1
606 nmdc:mga0n895_996290_c1
607 nmdc:mga0rr50_328896_c1
608 nmdc:mga0rr50_3499_c1
609 nmdc:mga0rr50_520585_c1
610 nmdc:mga08x19_320924_c1
611 nmdc:mga08x19_47380_c1
612 nmdc:mga0a205_100392_c1
613 nmdc:mga0a205_127840_c1
614 nmdc:mga0a205_349844_c1
615 nmdc:mga0a205_450590_c1
616 nmdc:mga0a205_4991_c1
617 nmdc:mga0a205_73025_c1
618 nmdc:mga0a205_761421_c1
619 Ga0495601_0516231
620 Ga0495595_0111276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11578

DUF3237

Protein of unknown function (DUF3237)

25

172

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9335 2 148
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9273 2 148
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9241 2 148
3g7g-assembly1.cif.gz_E crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824 0.9233 2 148
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9216 2 148
ID Description Score Start End Superfamily
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9267 2 148 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9091 1 148 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9032 1 148 2.40.160.20
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.897 2 148 2.40.160.20
4puxA00 Mainly Beta;Beta Barrel;Porin; 0.8347 2 146 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A2V8ETX7-F1-model_v4 DUF3237 domain-containing protein 0.9641 4 87
AF-A0A231HG79-F1-model_v4 Uncharacterized protein 0.9638 1 85
AF-A0A534X2K0-F1-model_v4 DUF3237 domain-containing protein 0.9609 12 86
AF-A0A2V8JJY6-F1-model_v4 Bacterial Ig domain-containing protein 0.9598 2 72
AF-K2C558-F1-model_v4 Uncharacterized protein 0.9594 1 85 GO:0016020

Map