F400551

General Info

Members Datasets Scaffolds Average Seq Length
310 186 620 137

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101030339|Ga0070682_1010303391
Length 158
Sequence VSLTCTVYLYATIKNNLKTIFMAYWLVKSEPFKYSYEQLEKDKQTFWDGVRNYAARNHLKAMKKGDQVLFYHSNEGLEIVGIAKIAKEAYQDPTTDDDAWVVVDLKPYKRIKKPVSLEQVKADKRLKDMALVRLGRLSVQPVTEDEWNVIMELGGMNR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
160 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
166 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
177 2738543024 Aminobacter sp. AP02 Isolate Unclassified
178 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
179 2818991444 Filimonas endophytica 3197 Isolate Unclassified
180 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
181 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
182 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
183 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
184 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
185 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
186 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101030339 3300005337 Bacteria 685
2 JGI25154J39366_1000189 3300002738 Bacteria 45808
3 JGI25157J39369_1009186 3300002741 Bacteria 1341
4 JGI25406J46586_10020408 3300003203 Bacteria 2680
5 JGI25153J46596_10003938 3300003215 Bacteria 8133
6 JGI25153J46596_10085507 3300003215 Bacteria 775
7 rootH2_10001276 3300003320 Bacteria 51880
8 rootH2_10037878 3300003320 Bacteria 3845
9 rootL2_10090029 3300003322 Bacteria 2004
10 rootL2_10322915 3300003322 Unclassified 1240
11 rootH1_10005981 3300003323 Bacteria 3236
12 rootH1_10045320 3300003323 Bacteria 6245
13 JGI25160J50197_1000995 3300003354 Bacteria 14682
14 Ga0055526_1030271 3300003771 Bacteria 1583
15 Ga0065704_10855704 3300005289 Unclassified 501
16 Ga0065715_10242519 3300005293 Bacteria 1194
17 Ga0065707_10377416 3300005295 Bacteria 881
18 Ga0070658_10131627 3300005327 Unclassified 2085
19 Ga0070658_10508907 3300005327 Bacteria 1040
20 Ga0070683_100566727 3300005329 Bacteria 1086
21 Ga0070670_100090617 3300005331 Bacteria 2628
22 Ga0070670_100242831 3300005331 Bacteria 1568
23 Ga0070670_100514064 3300005331 Bacteria 1066
24 Ga0070670_101135249 3300005331 Bacteria 713
25 Ga0070670_101755718 3300005331 Bacteria 571
26 Ga0068869_101607138 3300005334 Bacteria 579
27 Ga0070680_100398766 3300005336 Bacteria 1173
28 Ga0068868_100091658 3300005338 Bacteria 2449
29 Ga0068868_100854876 3300005338 Bacteria 824
30 Ga0070689_100491690 3300005340 Bacteria 1050
31 Ga0070689_101377097 3300005340 Bacteria 637
32 Ga0070675_100590754 3300005354 Bacteria 1006
33 Ga0070675_101213992 3300005354 Bacteria 694
34 Ga0070671_100192831 3300005355 Bacteria 1727
35 Ga0070671_100519395 3300005355 Bacteria 1025
36 Ga0070671_101174376 3300005355 Bacteria 675
37 Ga0070673_100371542 3300005364 Bacteria 1273
38 Ga0070688_100080331 3300005365 Bacteria 2109
39 Ga0070659_100332492 3300005366 Unclassified 1272
40 Ga0070659_100932381 3300005366 Unclassified 760
41 Ga0070662_100219493 3300005457 Bacteria 1516
42 Ga0070681_10256418 3300005458 Bacteria 1661
43 Ga0070681_10625011 3300005458 Bacteria 992
44 Ga0068867_100321698 3300005459 Bacteria 1282
45 Ga0068867_100670115 3300005459 Bacteria 912
46 Ga0068867_101176917 3300005459 Bacteria 703
47 Ga0070685_11430948 3300005466 Bacteria 531
48 Ga0070698_100004775 3300005471 Bacteria 14871
49 Ga0070679_100154754 3300005530 Bacteria 2268
50 Ga0070684_100070131 3300005535 Bacteria 3083
51 Ga0070684_100149495 3300005535 Unclassified 2115
52 Ga0070684_100697465 3300005535 Bacteria 946
53 Ga0068853_100159719 3300005539 Bacteria 2033
54 Ga0068853_100664332 3300005539 Bacteria 992
55 Ga0068853_101431875 3300005539 Unclassified 669
56 Ga0070672_100195794 3300005543 Bacteria 1689
57 Ga0070672_101492023 3300005543 Bacteria 606
58 Ga0070672_101696969 3300005543 Bacteria 567
59 Ga0070693_100435574 3300005547 Unclassified 917
60 Ga0070693_101578832 3300005547 Bacteria 515
61 Ga0068855_100253742 3300005563 Bacteria 1961
62 Ga0068855_101280752 3300005563 Bacteria 759
63 Ga0070664_100070957 3300005564 Bacteria 2984
64 Ga0070664_100604571 3300005564 Bacteria 1017
65 Ga0068857_100009142 3300005577 Bacteria 8599
66 Ga0068857_100091169 3300005577 Bacteria 2728
67 Ga0068857_100326929 3300005577 Bacteria 1417
68 Ga0068857_101379125 3300005577 Bacteria 685
69 Ga0068854_100008838 3300005578 Bacteria 6483
70 Ga0068854_100692544 3300005578 Bacteria 879
71 Ga0068854_100756713 3300005578 Unclassified 843
72 Ga0068854_101060752 3300005578 Bacteria 720
73 Ga0068856_100149145 3300005614 Bacteria 2347
74 Ga0068856_100315248 3300005614 Bacteria 1581
75 Ga0068852_100001099 3300005616 Bacteria 17846
76 Ga0068852_100293471 3300005616 Bacteria 1572
77 Ga0068852_100332260 3300005616 Bacteria 1479
78 Ga0068852_102220776 3300005616 Bacteria 570
79 Ga0068852_102228689 3300005616 Bacteria 569
80 Ga0068864_100401374 3300005618 Bacteria 1303
81 Ga0068864_100673484 3300005618 Bacteria 1009
82 Ga0068864_101171498 3300005618 Bacteria 766
83 Ga0068864_102009825 3300005618 Bacteria 584
84 Ga0068861_101538151 3300005719 Bacteria 654
85 Ga0068861_101625886 3300005719 Bacteria 637
86 Ga0068861_101679991 3300005719 Unclassified 627
87 Ga0068861_102251407 3300005719 Bacteria 546
88 Ga0068851_10142343 3300005834 Bacteria 1305
89 Ga0068863_100439122 3300005841 Bacteria 1280
90 Ga0068863_100830634 3300005841 Bacteria 922
91 Ga0068863_101078920 3300005841 Bacteria 807
92 Ga0068860_100865668 3300005843 Bacteria 919
93 Ga0068862_100020053 3300005844 Bacteria 5581
94 Ga0081539_10000899 3300005985 Bacteria 56635
95 Ga0081539_10042572 3300005985 Bacteria 2643
96 Ga0075366_10006463 3300006195 Bacteria 6424
97 Ga0075366_10869379 3300006195 Bacteria 561
98 Ga0097621_100109173 3300006237 Bacteria 2337
99 Ga0097621_100142092 3300006237 Bacteria 2052
100 Ga0097621_100648700 3300006237 Bacteria 968
101 Ga0068871_100296425 3300006358 Bacteria 1418
102 Ga0068871_100968882 3300006358 Bacteria 791
103 Ga0075434_102441397 3300006871 Bacteria 524
104 Ga0068865_100827999 3300006881 Bacteria 800
105 Ga0068865_101675713 3300006881 Bacteria 573
106 Ga0111539_13389745 3300009094 Unclassified 512
107 Ga0105247_10484193 3300009101 Bacteria 898
108 Ga0105242_10811279 3300009176 Bacteria 927
109 Ga0105242_12282542 3300009176 Unclassified 587
110 Ga0105242_12471517 3300009176 Bacteria 567
111 Ga0105248_11129480 3300009177 Bacteria 886
112 Ga0105237_10029401 3300009545 Bacteria 5586
113 Ga0105237_10415269 3300009545 Bacteria 1351
114 Ga0105238_10003001 3300009551 Bacteria 16856
115 Ga0105238_10150199 3300009551 Bacteria 2305
116 Ga0105239_10007270 3300010375 Bacteria 12721
117 Ga0105239_12127028 3300010375 Bacteria 652
118 Ga0105246_10089547 3300011119 Bacteria 2214
119 Ga0105246_10963735 3300011119 Bacteria 770
120 Ga0157371_10152257 3300013102 Bacteria 1650
121 Ga0157371_10454728 3300013102 Bacteria 942
122 Ga0157371_10999246 3300013102 Bacteria 638
123 Ga0157370_10182436 3300013104 Bacteria 1950
124 Ga0157369_10025968 3300013105 Bacteria 6500
125 Ga0157369_10564726 3300013105 Bacteria 1176
126 Ga0157369_10590907 3300013105 Bacteria 1146
127 Ga0157369_11285155 3300013105 Bacteria 746
128 Ga0157374_10024029 3300013296 Bacteria 5459
129 Ga0157374_10662447 3300013296 Bacteria 1056
130 Ga0157374_10687899 3300013296 Bacteria 1035
131 Ga0157378_10116740 3300013297 Bacteria 2454
132 Ga0157378_12701993 3300013297 Bacteria 549
133 Ga0163162_10012776 3300013306 Bacteria 8202
134 Ga0163162_10030731 3300013306 Bacteria 5323
135 Ga0163162_10966353 3300013306 Bacteria 962
136 Ga0163162_12828074 3300013306 Bacteria 559
137 Ga0157372_10001946 3300013307 Bacteria 22414
138 Ga0157372_10044382 3300013307 Bacteria 4926
139 Ga0157372_10159162 3300013307 Bacteria 2609
140 Ga0157372_10257918 3300013307 Bacteria 2024
141 Ga0157372_11267208 3300013307 Bacteria 851
142 Ga0157372_11437769 3300013307 Bacteria 795
143 Ga0157372_11906250 3300013307 Bacteria 683
144 Ga0157375_10533497 3300013308 Bacteria 1336
145 Ga0157375_10553732 3300013308 Bacteria 1312
146 Ga0157375_10725278 3300013308 Bacteria 1146
147 Ga0157375_10938050 3300013308 Unclassified 1008
148 Ga0157375_12807870 3300013308 Bacteria 582
149 Ga0163163_11622165 3300014325 Bacteria 708
150 Ga0157380_13172917 3300014326 Unclassified 525
151 Ga0157377_10362702 3300014745 Bacteria 976
152 Ga0157376_11183429 3300014969 Bacteria 792
153 Ga0163161_10324748 3300017792 Bacteria 1217
154 Ga0163161_10537186 3300017792 Bacteria 957
155 Ga0209563_102664 3300025230 Bacteria 3946
156 Ga0209646_1000006 3300025246 Bacteria 694084
157 Ga0209026_1000220 3300025250 Bacteria 78595
158 Ga0209129_1026923 3300025258 Bacteria 989
159 Ga0209455_1015424 3300025272 Bacteria 1680
160 Ga0209564_1005112 3300025295 Bacteria 7631
161 Ga0209758_1000497 3300025297 Bacteria 64050
162 Ga0209758_1004437 3300025297 Bacteria 11671
163 Ga0209758_1008552 3300025297 Bacteria 6591
164 Ga0207426_1000019 3300025302 Bacteria 558579
165 Ga0207426_1001841 3300025302 Bacteria 15625
166 Ga0207656_10152772 3300025321 Bacteria 1094
167 Ga0207647_10007349 3300025904 Bacteria 7968
168 Ga0207647_10101623 3300025904 Unclassified 1705
169 Ga0207647_10491218 3300025904 Bacteria 685
170 Ga0207684_10835033 3300025910 Unclassified 777
171 Ga0207654_10428564 3300025911 Unclassified 924
172 Ga0207707_10172738 3300025912 Bacteria 1888
173 Ga0207671_10153528 3300025914 Bacteria 1780
174 Ga0207671_10266733 3300025914 Bacteria 1348
175 Ga0207660_10659941 3300025917 Bacteria 853
176 Ga0207657_10002233 3300025919 Bacteria 20999
177 Ga0207652_10362221 3300025921 Unclassified 1309
178 Ga0207694_10018611 3300025924 Bacteria 5251
179 Ga0207694_10138549 3300025924 Bacteria 1955
180 Ga0207650_11423318 3300025925 Bacteria 590
181 Ga0207659_10133424 3300025926 Bacteria 1920
182 Ga0207644_11168228 3300025931 Bacteria 647
183 Ga0207706_10110959 3300025933 Bacteria 2413
184 Ga0207686_11328168 3300025934 Unclassified 591
185 Ga0207670_11058112 3300025936 Bacteria 684
186 Ga0207704_10486319 3300025938 Bacteria 992
187 Ga0207689_11064275 3300025942 Bacteria 682
188 Ga0207689_11205370 3300025942 Bacteria 637
189 Ga0207661_10754221 3300025944 Bacteria 896
190 Ga0207679_10052349 3300025945 Bacteria 2994
191 Ga0207679_11936434 3300025945 Bacteria 537
192 Ga0207667_10004030 3300025949 Bacteria 18046
193 Ga0207640_10154576 3300025981 Bacteria 1689
194 Ga0207640_11220965 3300025981 Bacteria 669
195 Ga0207640_11685789 3300025981 Bacteria 572
196 Ga0207658_10397499 3300025986 Bacteria 1211
197 Ga0207658_11513150 3300025986 Bacteria 614
198 Ga0207639_10665481 3300026041 Bacteria 964
199 Ga0207639_10752675 3300026041 Unclassified 906
200 Ga0207708_10260252 3300026075 Bacteria 1400
201 Ga0207702_10134157 3300026078 Bacteria 2232
202 Ga0207641_10280549 3300026088 Bacteria 1567
203 Ga0207641_10764786 3300026088 Bacteria 954
204 Ga0207641_11314308 3300026088 Bacteria 724
205 Ga0207648_10471119 3300026089 Bacteria 1146
206 Ga0207648_10550638 3300026089 Bacteria 1060
207 Ga0207648_10728810 3300026089 Bacteria 920
208 Ga0207648_12295833 3300026089 Bacteria 500
209 Ga0207676_10013488 3300026095 Bacteria 5871
210 Ga0207676_10465355 3300026095 Bacteria 1195
211 Ga0207676_10867951 3300026095 Unclassified 883
212 Ga0207676_11567095 3300026095 Bacteria 656
213 Ga0207674_10000487 3300026116 Bacteria 52391
214 Ga0207674_10050208 3300026116 Bacteria 4262
215 Ga0207674_11515580 3300026116 Bacteria 639
216 Ga0207675_101558958 3300026118 Bacteria 681
217 Ga0207698_10008203 3300026142 Bacteria 6589
218 Ga0207698_10188150 3300026142 Bacteria 1836
219 Ga0207698_10235904 3300026142 Bacteria 1664
220 Ga0207698_10371572 3300026142 Bacteria 1357
221 Ga0268266_10816876 3300028379 Bacteria 901
222 Ga0268264_10003707 3300028381 Bacteria 13124
223 Ga0268264_10194057 3300028381 Bacteria 1853
224 Ga0265318_10205000 3300028577 Bacteria 721
225 Ga0265327_10049064 3300031251 Bacteria 2216
226 Ga0307513_10552374 3300031456 Bacteria 864
227 Ga0307508_10006315 3300031616 Bacteria 11159
228 Ga0307508_10218681 3300031616 Unclassified 1505
229 Ga0316576_10089623 3300031727 Bacteria 2291
230 Ga0307410_10158108 3300031852 Bacteria 1695
231 Ga0307406_10995982 3300031901 Bacteria 719
232 Ga0307407_10613994 3300031903 Bacteria 811
233 Ga0307416_101048326 3300032002 Unclassified 919
234 Ga0307415_101119119 3300032126 Unclassified 738
235 Ga0307510_10000074 3300033180 Bacteria 75194
236 Ga0373937_0884516 3300036401 Bacteria 842
237 Ga0316582_0597901 3300036647 Bacteria 759
238 Ga0237816_09467 3300039145 Bacteria 580
239 Ga0451793_0321022 3300041452 Unclassified 935
240 Ga0451807_2491637 3300041486 Bacteria 567
241 Ga0451849_0936202 3300041505 Unclassified 2295
242 Ga0451577_0572313 3300042876 Bacteria 1025
243 Ga0453684_0022531 3300044712 Bacteria 9338
244 Ga0453684_0163891 3300044712 Bacteria 2626
245 Ga0466970_0001900 3300044765 Bacteria 10090
246 Ga0466960_0218643 3300044901 Bacteria 1047
247 Ga0451576_0259345 3300045051 Bacteria 1817
248 Ga0466967_0441844 3300045976 Bacteria 1270
249 Ga0495668_0002772 3300046616 Bacteria 13985
250 Ga0495672_0014225 3300047320 Bacteria 5459
251 Ga0495680_0171255 3300047322 Bacteria 1572
252 Ga0495686_0090889 3300047472 Bacteria 1853
253 Ga0495686_0220677 3300047472 Bacteria 1078
254 Ga0501031_0000029 3300049568 Bacteria 81284
255 Ga0501031_0027698 3300049568 Bacteria 3694
256 Ga0501031_0030185 3300049568 Unclassified 3535
257 Ga0501032_0245253 3300049569 Bacteria 1163
258 Ga0501032_0268641 3300049569 Unclassified 1105
259 Ga0501032_0327431 3300049569 Bacteria 988
260 Ga0501033_0000518 3300049570 Bacteria 36156
261 Ga0501033_0077311 3300049570 Bacteria 2442
262 Ga0501034_0313848 3300049571 Bacteria 1502
263 Ga0501034_0348495 3300049571 Bacteria 1409
264 Ga0501036_0003407 3300049572 Bacteria 12704
265 Ga0501037_0026167 3300049573 Bacteria 4312
266 Ga0501038_0067232 3300049574 Unclassified 3049
267 Ga0501038_0213230 3300049574 Bacteria 1544
268 Ga0501039_0102952 3300049575 Unclassified 2228
269 Ga0501043_0165230 3300049579 Bacteria 1728
270 Ga0501046_0042074 3300049580 Bacteria 3643
271 Ga0501047_0221367 3300049581 Unclassified 1749
272 Ga0501070_0064661 3300049586 Bacteria 3029
273 Ga0501070_0070865 3300049586 Bacteria 2886
274 Ga0501072_0095014 3300049588 Unclassified 2369
275 Ga0501072_0721880 3300049588 Bacteria 783
276 Ga0501201_019325 3300049651 Unclassified 713
277 Ga0501202_011105 3300049652 Bacteria 1683
278 Ga0501202_037980 3300049652 Unclassified 1030
279 Ga0501242_033020 3300049674 Unclassified 708
280 Ga0501221_199938 3300049704 Unclassified 555
281 Ga0501225_0019993 3300049705 Bacteria 1851
282 Ga0501225_0042805 3300049705 Bacteria 1251
283 Ga0501080_0118183 3300049742 Unclassified 2458
284 Ga0501035_0000316 3300049822 Bacteria 55833
285 Ga0501035_0167364 3300049822 Bacteria 1900
286 Ga0501044_0021121 3300049823 Bacteria 6951
287 Ga0501044_0585901 3300049823 Bacteria 1009
288 Ga0501212_021871 3300049851 Unclassified 995
289 Ga0501284_00038 3300050005 Bacteria 54754
290 nmdc:mga0n895_1931222_c1 3300050512 Bacteria 549
291 nmdc:mga0n895_2247955_c1 3300050512 Bacteria 500
292 Ga0500646_0003030 3300053090 Bacteria 4312
293 Ga0500652_005125 3300053131 Bacteria 4101
294 Ga0500559_0285007 3300053136 Bacteria 776
295 Ga0500568_0086163 3300053139 Bacteria 1188
296 Ga0500588_0151510 3300053146 Bacteria 839
297 Ga0500604_0007642 3300053151 Bacteria 2866
298 Ga0500622_0132145 3300053156 Bacteria 1199
299 Ga0500645_018684 3300053730 Bacteria 2163
300 2644131544 2643221623 Bacteria 5239945
301 2739306100 2738543024 Bacteria 5603683
302 2757570273 2757320392 Bacteria 3737298
303 2819588846 2818991444 Bacteria 6968812
304 2844539707 2844533157 Bacteria 7517899
305 2896089648 2896085136 Bacteria 6129793
306 2929242894 2929239360 Bacteria 7745570
307 2929925168 2929921140 Bacteria 8649150
308 2996315277 2996310559 Bacteria 6357320
309 8002291781 8002285264 Bacteria 6717907
310 8003155139 8003151029 Bacteria 8187759
311 Ga0070682_101030339
312 JGI25154J39366_1000189
313 JGI25157J39369_1009186
314 JGI25406J46586_10020408
315 JGI25153J46596_10003938
316 JGI25153J46596_10085507
317 rootH2_10001276
318 rootH2_10037878
319 rootL2_10090029
320 rootL2_10322915
321 rootH1_10005981
322 rootH1_10045320
323 JGI25160J50197_1000995
324 Ga0055526_1030271
325 Ga0065704_10855704
326 Ga0065715_10242519
327 Ga0065707_10377416
328 Ga0070658_10131627
329 Ga0070658_10508907
330 Ga0070683_100566727
331 Ga0070670_100090617
332 Ga0070670_100242831
333 Ga0070670_100514064
334 Ga0070670_101135249
335 Ga0070670_101755718
336 Ga0068869_101607138
337 Ga0070680_100398766
338 Ga0068868_100091658
339 Ga0068868_100854876
340 Ga0070689_100491690
341 Ga0070689_101377097
342 Ga0070675_100590754
343 Ga0070675_101213992
344 Ga0070671_100192831
345 Ga0070671_100519395
346 Ga0070671_101174376
347 Ga0070673_100371542
348 Ga0070688_100080331
349 Ga0070659_100332492
350 Ga0070659_100932381
351 Ga0070662_100219493
352 Ga0070681_10256418
353 Ga0070681_10625011
354 Ga0068867_100321698
355 Ga0068867_100670115
356 Ga0068867_101176917
357 Ga0070685_11430948
358 Ga0070698_100004775
359 Ga0070679_100154754
360 Ga0070684_100070131
361 Ga0070684_100149495
362 Ga0070684_100697465
363 Ga0068853_100159719
364 Ga0068853_100664332
365 Ga0068853_101431875
366 Ga0070672_100195794
367 Ga0070672_101492023
368 Ga0070672_101696969
369 Ga0070693_100435574
370 Ga0070693_101578832
371 Ga0068855_100253742
372 Ga0068855_101280752
373 Ga0070664_100070957
374 Ga0070664_100604571
375 Ga0068857_100009142
376 Ga0068857_100091169
377 Ga0068857_100326929
378 Ga0068857_101379125
379 Ga0068854_100008838
380 Ga0068854_100692544
381 Ga0068854_100756713
382 Ga0068854_101060752
383 Ga0068856_100149145
384 Ga0068856_100315248
385 Ga0068852_100001099
386 Ga0068852_100293471
387 Ga0068852_100332260
388 Ga0068852_102220776
389 Ga0068852_102228689
390 Ga0068864_100401374
391 Ga0068864_100673484
392 Ga0068864_101171498
393 Ga0068864_102009825
394 Ga0068861_101538151
395 Ga0068861_101625886
396 Ga0068861_101679991
397 Ga0068861_102251407
398 Ga0068851_10142343
399 Ga0068863_100439122
400 Ga0068863_100830634
401 Ga0068863_101078920
402 Ga0068860_100865668
403 Ga0068862_100020053
404 Ga0081539_10000899
405 Ga0081539_10042572
406 Ga0075366_10006463
407 Ga0075366_10869379
408 Ga0097621_100109173
409 Ga0097621_100142092
410 Ga0097621_100648700
411 Ga0068871_100296425
412 Ga0068871_100968882
413 Ga0075434_102441397
414 Ga0068865_100827999
415 Ga0068865_101675713
416 Ga0111539_13389745
417 Ga0105247_10484193
418 Ga0105242_10811279
419 Ga0105242_12282542
420 Ga0105242_12471517
421 Ga0105248_11129480
422 Ga0105237_10029401
423 Ga0105237_10415269
424 Ga0105238_10003001
425 Ga0105238_10150199
426 Ga0105239_10007270
427 Ga0105239_12127028
428 Ga0105246_10089547
429 Ga0105246_10963735
430 Ga0157371_10152257
431 Ga0157371_10454728
432 Ga0157371_10999246
433 Ga0157370_10182436
434 Ga0157369_10025968
435 Ga0157369_10564726
436 Ga0157369_10590907
437 Ga0157369_11285155
438 Ga0157374_10024029
439 Ga0157374_10662447
440 Ga0157374_10687899
441 Ga0157378_10116740
442 Ga0157378_12701993
443 Ga0163162_10012776
444 Ga0163162_10030731
445 Ga0163162_10966353
446 Ga0163162_12828074
447 Ga0157372_10001946
448 Ga0157372_10044382
449 Ga0157372_10159162
450 Ga0157372_10257918
451 Ga0157372_11267208
452 Ga0157372_11437769
453 Ga0157372_11906250
454 Ga0157375_10533497
455 Ga0157375_10553732
456 Ga0157375_10725278
457 Ga0157375_10938050
458 Ga0157375_12807870
459 Ga0163163_11622165
460 Ga0157380_13172917
461 Ga0157377_10362702
462 Ga0157376_11183429
463 Ga0163161_10324748
464 Ga0163161_10537186
465 Ga0209563_102664
466 Ga0209646_1000006
467 Ga0209026_1000220
468 Ga0209129_1026923
469 Ga0209455_1015424
470 Ga0209564_1005112
471 Ga0209758_1000497
472 Ga0209758_1004437
473 Ga0209758_1008552
474 Ga0207426_1000019
475 Ga0207426_1001841
476 Ga0207656_10152772
477 Ga0207647_10007349
478 Ga0207647_10101623
479 Ga0207647_10491218
480 Ga0207684_10835033
481 Ga0207654_10428564
482 Ga0207707_10172738
483 Ga0207671_10153528
484 Ga0207671_10266733
485 Ga0207660_10659941
486 Ga0207657_10002233
487 Ga0207652_10362221
488 Ga0207694_10018611
489 Ga0207694_10138549
490 Ga0207650_11423318
491 Ga0207659_10133424
492 Ga0207644_11168228
493 Ga0207706_10110959
494 Ga0207686_11328168
495 Ga0207670_11058112
496 Ga0207704_10486319
497 Ga0207689_11064275
498 Ga0207689_11205370
499 Ga0207661_10754221
500 Ga0207679_10052349
501 Ga0207679_11936434
502 Ga0207667_10004030
503 Ga0207640_10154576
504 Ga0207640_11220965
505 Ga0207640_11685789
506 Ga0207658_10397499
507 Ga0207658_11513150
508 Ga0207639_10665481
509 Ga0207639_10752675
510 Ga0207708_10260252
511 Ga0207702_10134157
512 Ga0207641_10280549
513 Ga0207641_10764786
514 Ga0207641_11314308
515 Ga0207648_10471119
516 Ga0207648_10550638
517 Ga0207648_10728810
518 Ga0207648_12295833
519 Ga0207676_10013488
520 Ga0207676_10465355
521 Ga0207676_10867951
522 Ga0207676_11567095
523 Ga0207674_10000487
524 Ga0207674_10050208
525 Ga0207674_11515580
526 Ga0207675_101558958
527 Ga0207698_10008203
528 Ga0207698_10188150
529 Ga0207698_10235904
530 Ga0207698_10371572
531 Ga0268266_10816876
532 Ga0268264_10003707
533 Ga0268264_10194057
534 Ga0265318_10205000
535 Ga0265327_10049064
536 Ga0307513_10552374
537 Ga0307508_10006315
538 Ga0307508_10218681
539 Ga0316576_10089623
540 Ga0307410_10158108
541 Ga0307406_10995982
542 Ga0307407_10613994
543 Ga0307416_101048326
544 Ga0307415_101119119
545 Ga0307510_10000074
546 Ga0373937_0884516
547 Ga0316582_0597901
548 Ga0237816_09467
549 Ga0451793_0321022
550 Ga0451807_2491637
551 Ga0451849_0936202
552 Ga0451577_0572313
553 Ga0453684_0022531
554 Ga0453684_0163891
555 Ga0466970_0001900
556 Ga0466960_0218643
557 Ga0451576_0259345
558 Ga0466967_0441844
559 Ga0495668_0002772
560 Ga0495672_0014225
561 Ga0495680_0171255
562 Ga0495686_0090889
563 Ga0495686_0220677
564 Ga0501031_0000029
565 Ga0501031_0027698
566 Ga0501031_0030185
567 Ga0501032_0245253
568 Ga0501032_0268641
569 Ga0501032_0327431
570 Ga0501033_0000518
571 Ga0501033_0077311
572 Ga0501034_0313848
573 Ga0501034_0348495
574 Ga0501036_0003407
575 Ga0501037_0026167
576 Ga0501038_0067232
577 Ga0501038_0213230
578 Ga0501039_0102952
579 Ga0501043_0165230
580 Ga0501046_0042074
581 Ga0501047_0221367
582 Ga0501070_0064661
583 Ga0501070_0070865
584 Ga0501072_0095014
585 Ga0501072_0721880
586 Ga0501201_019325
587 Ga0501202_011105
588 Ga0501202_037980
589 Ga0501242_033020
590 Ga0501221_199938
591 Ga0501225_0019993
592 Ga0501225_0042805
593 Ga0501080_0118183
594 Ga0501035_0000316
595 Ga0501035_0167364
596 Ga0501044_0021121
597 Ga0501044_0585901
598 Ga0501212_021871
599 Ga0501284_00038
600 nmdc:mga0n895_1931222_c1
601 nmdc:mga0n895_2247955_c1
602 Ga0500646_0003030
603 Ga0500652_005125
604 Ga0500559_0285007
605 Ga0500568_0086163
606 Ga0500588_0151510
607 Ga0500604_0007642
608 Ga0500622_0132145
609 Ga0500645_018684
610 2644131544
611 2739306100
612 2757570273
613 2819588846
614 2844539707
615 2896089648
616 2929242894
617 2929925168
618 2996315277
619 8002291781
620 8003155139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

23

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9908 1 135
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9765 1 135
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9604 1 134
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9481 3 133
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9477 3 133
ID Description Score Start End Superfamily
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9505 1 134 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9463 1 71 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9461 2 135 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9406 1 135 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.93 1 134 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A561IMQ1-F1-model_v4 deleted 1.005 1 133
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 1.005 2 67
AF-A0A6N4SM96-F1-model_v4 EVE domain-containing protein 1.004 1 134
AF-A0A4Q3A2K4-F1-model_v4 EVE domain-containing protein 1.004 1 134
AF-A0A2W5F9D3-F1-model_v4 EVE domain-containing protein 1.004 1 134

Map