F400324

General Info

Members Datasets Scaffolds Average Seq Length
309 160 309 121

Family's Representative Sequence

Representative Sequence 3300041458|Ga0451798_0428372|Ga0451798_0428372_62_439
Length 125
Sequence MTWLLVAVGGALGSLLRYGAYRLWPSSPGGWPVPTFTVNVIGSFAIGLIYMYVAARGIGPTGYARVFWMAGVLGGFTTYSAFALETALLGFNITGIAYVAATVVLCLLATLLGMKVGALLLSMVG

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.24
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10034997 3300002244 Bacteria 885
2 Ga0065712_10622135 3300005290 Unclassified 580
3 Ga0070676_10388656 3300005328 Bacteria 968
4 Ga0070676_10870952 3300005328 Bacteria 669
5 Ga0070683_100974360 3300005329 Bacteria 814
6 Ga0070683_101440500 3300005329 Unclassified 662
7 Ga0070690_100025508 3300005330 Bacteria 3641
8 Ga0070670_100121807 3300005331 Bacteria 2250
9 Ga0070670_100773219 3300005331 Unclassified 866
10 Ga0070677_10146499 3300005333 Bacteria 1095
11 Ga0070677_10247930 3300005333 Bacteria 882
12 Ga0068869_100021831 3300005334 Bacteria 4405
13 Ga0068869_100695247 3300005334 Bacteria 867
14 Ga0068869_101137814 3300005334 Unclassified 684
15 Ga0070682_100073012 3300005337 Bacteria 2200
16 Ga0070682_100178004 3300005337 Bacteria 1483
17 Ga0070682_100311122 3300005337 Bacteria 1159
18 Ga0068868_100918340 3300005338 Bacteria 796
19 Ga0068868_101055395 3300005338 Bacteria 746
20 Ga0070689_100261405 3300005340 Bacteria 1431
21 Ga0070689_100351825 3300005340 Bacteria 1236
22 Ga0070689_100513421 3300005340 Bacteria 1028
23 Ga0070687_100066116 3300005343 Bacteria 1925
24 Ga0070687_100253834 3300005343 Bacteria 1094
25 Ga0070661_100031465 3300005344 Bacteria 3838
26 Ga0070661_100975267 3300005344 Bacteria 702
27 Ga0070668_100119632 3300005347 Bacteria 2104
28 Ga0070669_100053079 3300005353 Bacteria 2967
29 Ga0070669_100104851 3300005353 Bacteria 2138
30 Ga0070669_100819696 3300005353 Bacteria 792
31 Ga0070675_100061506 3300005354 Bacteria 3100
32 Ga0070675_100164805 3300005354 Bacteria 1908
33 Ga0070675_100192998 3300005354 Bacteria 1765
34 Ga0070675_100896209 3300005354 Bacteria 813
35 Ga0070675_101654307 3300005354 Unclassified 591
36 Ga0070675_102203195 3300005354 Unclassified 508
37 Ga0070671_100572491 3300005355 Bacteria 975
38 Ga0070671_101914625 3300005355 Unclassified 527
39 Ga0070674_100058820 3300005356 Bacteria 2673
40 Ga0070674_100073891 3300005356 Bacteria 2418
41 Ga0070674_100121618 3300005356 Bacteria 1933
42 Ga0070674_100553890 3300005356 Bacteria 965
43 Ga0070674_100799656 3300005356 Bacteria 814
44 Ga0070674_100979092 3300005356 Bacteria 741
45 Ga0070674_101290982 3300005356 Bacteria 651
46 Ga0070673_100021345 3300005364 Bacteria 4693
47 Ga0070673_100113884 3300005364 Bacteria 2246
48 Ga0070673_100171454 3300005364 Bacteria 1852
49 Ga0070673_100613518 3300005364 Unclassified 993
50 Ga0070688_100066966 3300005365 Bacteria 2287
51 Ga0070659_100718488 3300005366 Bacteria 865
52 Ga0070667_100498951 3300005367 Bacteria 1115
53 Ga0070667_101285313 3300005367 Unclassified 685
54 Ga0070701_10609019 3300005438 Unclassified 724
55 Ga0070700_100336012 3300005441 Bacteria 1115
56 Ga0070694_100413685 3300005444 Bacteria 1058
57 Ga0070663_100180240 3300005455 Bacteria 1638
58 Ga0070663_100641406 3300005455 Bacteria 897
59 Ga0070663_101195673 3300005455 Bacteria 668
60 Ga0070663_101257516 3300005455 Bacteria 652
61 Ga0070678_100164829 3300005456 Bacteria 1799
62 Ga0070678_100385482 3300005456 Bacteria 1214
63 Ga0070662_100595751 3300005457 Bacteria 929
64 Ga0070662_100904214 3300005457 Bacteria 753
65 Ga0068867_100436373 3300005459 Bacteria 1113
66 Ga0070685_10159684 3300005466 Bacteria 1436
67 Ga0070672_100008513 3300005543 Bacteria 7023
68 Ga0070672_100045474 3300005543 Bacteria 3396
69 Ga0070672_100056954 3300005543 Bacteria 3067
70 Ga0070672_100483371 3300005543 Bacteria 1069
71 Ga0070672_100511896 3300005543 Bacteria 1039
72 Ga0070686_100238771 3300005544 Bacteria 1322
73 Ga0070686_100853184 3300005544 Bacteria 738
74 Ga0070665_100096008 3300005548 Bacteria 2969
75 Ga0070665_100397550 3300005548 Bacteria 1386
76 Ga0070665_101299070 3300005548 Unclassified 737
77 Ga0070704_100339906 3300005549 Bacteria 1264
78 Ga0070704_102194325 3300005549 Bacteria 513
79 Ga0070704_102216624 3300005549 Bacteria 511
80 Ga0070664_100049226 3300005564 Bacteria 3563
81 Ga0070664_100304340 3300005564 Bacteria 1441
82 Ga0070664_100404580 3300005564 Bacteria 1248
83 Ga0068857_100679918 3300005577 Bacteria 977
84 Ga0068857_101852214 3300005577 Bacteria 591
85 Ga0068854_100889512 3300005578 Unclassified 782
86 Ga0068854_101359576 3300005578 Bacteria 641
87 Ga0070702_100165670 3300005615 Bacteria 1433
88 Ga0070702_100476483 3300005615 Unclassified 911
89 Ga0068859_101093234 3300005617 Bacteria 877
90 Ga0068859_102317610 3300005617 Bacteria 592
91 Ga0068861_100212861 3300005719 Bacteria 1629
92 Ga0068861_100247440 3300005719 Bacteria 1519
93 Ga0068870_10008348 3300005840 Bacteria 4656
94 Ga0068870_10032966 3300005840 Bacteria 2639
95 Ga0068870_10340860 3300005840 Bacteria 959
96 Ga0068863_100069890 3300005841 Bacteria 3320
97 Ga0068863_100121950 3300005841 Bacteria 2486
98 Ga0068860_101084300 3300005843 Bacteria 820
99 Ga0068862_100265247 3300005844 Bacteria 1569
100 Ga0097621_100361491 3300006237 Bacteria 1293
101 Ga0097621_100404523 3300006237 Bacteria 1223
102 Ga0068871_100432686 3300006358 Bacteria 1177
103 Ga0068871_100557362 3300006358 Bacteria 1038
104 Ga0068871_100670493 3300006358 Bacteria 948
105 Ga0075430_100272850 3300006846 Bacteria 1400
106 Ga0068865_100619486 3300006881 Unclassified 917
107 Ga0097620_101093429 3300006931 Bacteria 877
108 Ga0097620_102318197 3300006931 Bacteria 592
109 Ga0111539_10135074 3300009094 Bacteria 2889
110 Ga0111539_10495496 3300009094 Bacteria 1423
111 Ga0111539_11249960 3300009094 Bacteria 862
112 Ga0111539_11288693 3300009094 Bacteria 848
113 Ga0105243_10618831 3300009148 Bacteria 1045
114 Ga0105242_10350978 3300009176 Bacteria 1362
115 Ga0105242_11258157 3300009176 Unclassified 762
116 Ga0105248_10299517 3300009177 Bacteria 1811
117 Ga0105248_11027685 3300009177 Bacteria 931
118 Ga0105248_11402112 3300009177 Bacteria 791
119 Ga0105249_10536766 3300009553 Bacteria 1219
120 Ga0157374_10225734 3300013296 Bacteria 1839
121 Ga0163162_11465799 3300013306 Bacteria 777
122 Ga0163162_12481541 3300013306 Bacteria 596
123 Ga0157375_12391172 3300013308 Bacteria 630
124 Ga0163163_11140041 3300014325 Bacteria 842
125 Ga0157380_10015516 3300014326 Bacteria 5600
126 Ga0157380_10192208 3300014326 Bacteria 1803
127 Ga0157380_10291280 3300014326 Bacteria 1499
128 Ga0157380_10303006 3300014326 Bacteria 1473
129 Ga0157380_10713999 3300014326 Bacteria 1009
130 Ga0157380_10979466 3300014326 Unclassified 878
131 Ga0157380_11103294 3300014326 Unclassified 833
132 Ga0157379_10313558 3300014968 Bacteria 1431
133 Ga0157376_10174801 3300014969 Bacteria 1958
134 Ga0157376_10206106 3300014969 Bacteria 1812
135 Ga0157376_10364540 3300014969 Bacteria 1387
136 Ga0163161_10625561 3300017792 Bacteria 890
137 Ga0163161_10875188 3300017792 Bacteria 760
138 Ga0207697_10034472 3300025315 Bacteria 2072
139 Ga0207682_10003364 3300025893 Bacteria 6965
140 Ga0207682_10067834 3300025893 Bacteria 1506
141 Ga0207682_10234889 3300025893 Bacteria 851
142 Ga0207642_10069499 3300025899 Bacteria 1670
143 Ga0207680_10288313 3300025903 Bacteria 1142
144 Ga0207645_10304318 3300025907 Bacteria 1062
145 Ga0207643_10024132 3300025908 Bacteria 3355
146 Ga0207643_10160207 3300025908 Bacteria 1353
147 Ga0207662_10079172 3300025918 Bacteria 2001
148 Ga0207649_10169668 3300025920 Bacteria 1519
149 Ga0207649_10486264 3300025920 Bacteria 937
150 Ga0207681_10559991 3300025923 Unclassified 941
151 Ga0207681_11720692 3300025923 Bacteria 524
152 Ga0207650_10202320 3300025925 Bacteria 1591
153 Ga0207650_11425917 3300025925 Bacteria 589
154 Ga0207659_10019909 3300025926 Bacteria 4426
155 Ga0207659_10266108 3300025926 Bacteria 1397
156 Ga0207659_10533313 3300025926 Bacteria 996
157 Ga0207659_10642893 3300025926 Bacteria 906
158 Ga0207706_10295722 3300025933 Bacteria 1411
159 Ga0207706_10573930 3300025933 Bacteria 970
160 Ga0207686_10608386 3300025934 Bacteria 861
161 Ga0207686_10786184 3300025934 Unclassified 762
162 Ga0207709_10083501 3300025935 Bacteria 2065
163 Ga0207670_10196802 3300025936 Bacteria 1528
164 Ga0207670_10275867 3300025936 Bacteria 1309
165 Ga0207670_10905199 3300025936 Bacteria 739
166 Ga0207670_11112404 3300025936 Unclassified 667
167 Ga0207669_10090110 3300025937 Bacteria 1993
168 Ga0207669_10093449 3300025937 Bacteria 1965
169 Ga0207669_10102982 3300025937 Bacteria 1892
170 Ga0207669_10156455 3300025937 Bacteria 1604
171 Ga0207669_10205633 3300025937 Bacteria 1433
172 Ga0207669_10409618 3300025937 Unclassified 1064
173 Ga0207669_11315537 3300025937 Bacteria 614
174 Ga0207704_10203349 3300025938 Bacteria 1451
175 Ga0207704_10948786 3300025938 Bacteria 725
176 Ga0207691_10015054 3300025940 Bacteria 7362
177 Ga0207691_10019364 3300025940 Bacteria 6440
178 Ga0207691_10062245 3300025940 Bacteria 3387
179 Ga0207691_10301416 3300025940 Bacteria 1377
180 Ga0207691_11056934 3300025940 Unclassified 676
181 Ga0207711_10369843 3300025941 Bacteria 1329
182 Ga0207689_10058481 3300025942 Bacteria 3171
183 Ga0207689_10375921 3300025942 Bacteria 1183
184 Ga0207679_10114954 3300025945 Bacteria 2131
185 Ga0207679_10227419 3300025945 Bacteria 1573
186 Ga0207679_10318933 3300025945 Bacteria 1345
187 Ga0207651_10014473 3300025960 Bacteria 4558
188 Ga0207651_10032238 3300025960 Bacteria 3363
189 Ga0207651_10041383 3300025960 Bacteria 3058
190 Ga0207651_11053651 3300025960 Bacteria 728
191 Ga0207712_10221270 3300025961 Bacteria 1514
192 Ga0207668_10278466 3300025972 Bacteria 1371
193 Ga0207640_10295485 3300025981 Bacteria 1279
194 Ga0207658_11228363 3300025986 Unclassified 685
195 Ga0207677_10465920 3300026023 Bacteria 1086
196 Ga0207703_10259293 3300026035 Bacteria 1571
197 Ga0207639_11416105 3300026041 Bacteria 652
198 Ga0207678_10090072 3300026067 Bacteria 2622
199 Ga0207678_11292532 3300026067 Bacteria 645
200 Ga0207708_10290440 3300026075 Bacteria 1327
201 Ga0207708_10822346 3300026075 Bacteria 801
202 Ga0207641_10021150 3300026088 Bacteria 5348
203 Ga0207641_10041586 3300026088 Bacteria 3852
204 Ga0207648_10063637 3300026089 Bacteria 3215
205 Ga0207648_10279899 3300026089 Bacteria 1492
206 Ga0207676_10718524 3300026095 Bacteria 969
207 Ga0207674_10334894 3300026116 Bacteria 1463
208 Ga0207674_10476336 3300026116 Bacteria 1207
209 Ga0207674_10743478 3300026116 Bacteria 947
210 Ga0207675_100002808 3300026118 Bacteria 17117
211 Ga0207675_100256746 3300026118 Bacteria 1693
212 Ga0207675_100387631 3300026118 Bacteria 1375
213 Ga0207675_100422477 3300026118 Bacteria 1317
214 Ga0207683_10019771 3300026121 Bacteria 5753
215 Ga0207683_10023531 3300026121 Bacteria 5299
216 Ga0207683_11221185 3300026121 Bacteria 697
217 Ga0207428_10483864 3300027907 Bacteria 900
218 Ga0268266_10281883 3300028379 Bacteria 1545
219 Ga0268266_11138867 3300028379 Bacteria 755
220 Ga0268265_10046133 3300028380 Bacteria 3256
221 Ga0268265_10242221 3300028380 Bacteria 1592
222 Ga0268264_10183577 3300028381 Bacteria 1902
223 Ga0307515_10311247 3300028794 Bacteria 1250
224 Ga0307513_10021047 3300031456 Bacteria 7709
225 Ga0307513_10036161 3300031456 Bacteria 5515
226 Ga0307513_10129951 3300031456 Bacteria 2466
227 Ga0307513_10137941 3300031456 Bacteria 2370
228 Ga0307513_10387070 3300031456 Bacteria 1136
229 Ga0307509_10141080 3300031507 Bacteria 2345
230 Ga0307509_10309063 3300031507 Bacteria 1324
231 Ga0307405_10158187 3300031731 Bacteria 1601
232 Ga0307405_10294401 3300031731 Bacteria 1228
233 Ga0307405_10809828 3300031731 Bacteria 785
234 Ga0307413_10002649 3300031824 Bacteria 7330
235 Ga0307413_10025736 3300031824 Bacteria 3231
236 Ga0307413_10058581 3300031824 Bacteria 2362
237 Ga0307410_10010560 3300031852 Bacteria 5238
238 Ga0307406_10031960 3300031901 Bacteria 3209
239 Ga0307407_10016034 3300031903 Bacteria 3721
240 Ga0307407_10056598 3300031903 Bacteria 2271
241 Ga0307409_100008675 3300031995 Bacteria 6187
242 Ga0307409_100101120 3300031995 Bacteria 2391
243 Ga0307409_100354662 3300031995 Bacteria 1385
244 Ga0307416_100055325 3300032002 Bacteria 3195
245 Ga0307416_100059698 3300032002 Bacteria 3101
246 Ga0307416_100267747 3300032002 Bacteria 1675
247 Ga0307414_10609440 3300032004 Bacteria 980
248 Ga0307411_10034825 3300032005 Bacteria 3137
249 Ga0307411_10064886 3300032005 Bacteria 2446
250 Ga0307411_10872874 3300032005 Unclassified 797
251 Ga0307415_100079325 3300032126 Bacteria 2338
252 Ga0307415_101461588 3300032126 Unclassified 653
253 Ga0373941_0513702 3300035115 Unclassified 511
254 Ga0373946_0147289 3300035171 Bacteria 1096
255 Ga0451787_324272 3300041441 Bacteria 834
256 Ga0451791_0440455 3300041451 Bacteria 887
257 Ga0451791_1497291 3300041451 Bacteria 512
258 Ga0451797_0067877 3300041453 Bacteria 658
259 Ga0451797_0694510 3300041453 Bacteria 1180
260 Ga0451795_1139334 3300041456 Bacteria 1125
261 Ga0451798_0110005 3300041458 Unclassified 1052
262 Ga0451798_0428372 3300041458 Unclassified 663
263 Ga0451800_1545234 3300041459 Unclassified 917
264 Ga0451807_0430497 3300041486 Bacteria 549
265 Ga0451853_0828234 3300041512 Bacteria 564
266 Ga0495590_0024966 3300046457 Bacteria 2103
267 Ga0495638_0009860 3300046460 Bacteria 6665
268 Ga0495641_0397557 3300046461 Unclassified 625
269 Ga0495620_0296344 3300046515 Bacteria 615
270 Ga0495597_0381929 3300046542 Bacteria 537
271 Ga0495668_0182054 3300046616 Bacteria 1151
272 Ga0495668_0240444 3300046616 Bacteria 991
273 Ga0495649_0004842 3300046694 Bacteria 8707
274 Ga0495649_0058793 3300046694 Bacteria 2071
275 Ga0495649_0250266 3300046694 Bacteria 910
276 Ga0495589_0065679 3300046794 Bacteria 1778
277 Ga0495672_0426361 3300047320 Bacteria 602
278 Ga0495686_0096517 3300047472 Bacteria 1789
279 Ga0501031_0651172 3300049568 Bacteria 677
280 Ga0501036_0762208 3300049572 Unclassified 798
281 Ga0501039_0083233 3300049575 Bacteria 2492
282 Ga0501042_0405406 3300049578 Bacteria 988
283 Ga0501048_0427138 3300049582 Bacteria 948
284 Ga0501068_0002030 3300049584 Bacteria 10783
285 Ga0501069_0313302 3300049585 Unclassified 921
286 Ga0501070_0768406 3300049586 Bacteria 758
287 Ga0501071_0019403 3300049587 Bacteria 4718
288 Ga0501071_0637642 3300049587 Bacteria 820
289 Ga0501072_0958398 3300049588 Unclassified 667
290 Ga0501073_0003704 3300049589 Bacteria 11485
291 Ga0501074_0000684 3300049590 Bacteria 21169
292 Ga0501075_0053474 3300049591 Bacteria 3037
293 Ga0501076_0027367 3300049592 Bacteria 4422
294 Ga0501077_0001942 3300049593 Bacteria 12519
295 Ga0501077_0455076 3300049593 Bacteria 820
296 Ga0501079_0003927 3300049741 Bacteria 10983
297 Ga0501080_0012210 3300049742 Bacteria 7871
298 Ga0501081_0527654 3300049743 Unclassified 881
299 Ga0501083_0009617 3300049744 Bacteria 6830
300 Ga0501045_0300824 3300049824 Bacteria 1194
301 Ga0501045_0718169 3300049824 Unclassified 737
302 nmdc:mga08y16_525335_c1 3300050511 Bacteria 1200
303 nmdc:mga08y16_695185_c1 3300050511 Bacteria 1017
304 Ga0501084_0002232 3300054114 Bacteria 15556
305 Ga0501084_0890312 3300054114 Bacteria 749
306 Ga0501084_1617112 3300054114 Bacteria 542
307 Ga0501082_0567886 3300060353 Bacteria 992
308 Ga0530510_0307381 3300061734 Bacteria 1187
309 Ga0530510_0312027 3300061734 Bacteria 1178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0427138 Ga0501048_0427138_70_441 102
2 3300049585 Ga0501069_0313302 Ga0501069_0313302_84_455 102
3 3300049593 Ga0501077_0455076 Ga0501077_0455076_110_481 102
4 3300049743 Ga0501081_0527654 Ga0501081_0527654_24_395 102
5 3300049824 Ga0501045_0718169 Ga0501045_0718169_183_554 102
6 3300060353 Ga0501082_0567886 Ga0501082_0567886_539_910 102
7 3300061734 Ga0530510_0312027 Ga0530510_0312027_562_933 102
8 3300005549 Ga0070704_102216624 Ga0070704_1022166241 103
9 3300006237 Ga0097621_100404523 Ga0097621_1004045232 104
10 3300049586 Ga0501070_0768406 Ga0501070_0768406_199_570 104
11 3300061734 Ga0530510_0307381 Ga0530510_0307381_847_1176 107
12 3300031507 Ga0307509_10309063 Ga0307509_103090632 109
13 3300005441 Ga0070700_100336012 Ga0070700_1003360122 110
14 3300005578 Ga0068854_101359576 Ga0068854_1013595762 110
15 3300005617 Ga0068859_101093234 Ga0068859_1010932342 110
16 3300006931 Ga0097620_101093429 Ga0097620_1010934292 110
17 3300013306 Ga0163162_12481541 Ga0163162_124815411 110
18 3300014326 Ga0157380_10979466 Ga0157380_109794662 110
19 3300017792 Ga0163161_10875188 Ga0163161_108751881 110
20 3300026075 Ga0207708_10822346 Ga0207708_108223462 110
21 3300026118 Ga0207675_100002808 Ga0207675_1000028087 110
22 3300035115 Ga0373941_0513702 Ga0373941_0513702_37_405 110
23 3300049587 Ga0501071_0637642 Ga0501071_0637642_434_805 111
24 3300006358 Ga0068871_100670493 Ga0068871_1006704932 113
25 3300046694 Ga0495649_0004842 Ga0495649_0004842_3801_4145 114
26 3300005356 Ga0070674_100553890 Ga0070674_1005538902 115
27 3300025937 Ga0207669_10409618 Ga0207669_104096182 115
28 3300049572 Ga0501036_0762208 Ga0501036_0762208_332_682 116
29 3300005334 Ga0068869_101137814 Ga0068869_1011378142 119
30 3300005344 Ga0070661_100975267 Ga0070661_1009752672 119
31 3300005564 Ga0070664_100304340 Ga0070664_1003043402 119
32 3300005578 Ga0068854_100889512 Ga0068854_1008895122 119
33 3300005615 Ga0070702_100165670 Ga0070702_1001656702 119
34 3300014326 Ga0157380_10713999 Ga0157380_107139992 119
35 3300025920 Ga0207649_10486264 Ga0207649_104862642 119
36 3300025945 Ga0207679_10227419 Ga0207679_102274192 119
37 3300041451 Ga0451791_1497291 Ga0451791_1497291_104_463 119
38 3300002244 JGI24742J22300_10034997 JGI24742J22300_100349972 121
39 3300005290 Ga0065712_10622135 Ga0065712_106221351 121
40 3300005328 Ga0070676_10388656 Ga0070676_103886561 121
41 3300005328 Ga0070676_10870952 Ga0070676_108709521 121
42 3300005329 Ga0070683_100974360 Ga0070683_1009743602 121
43 3300005329 Ga0070683_101440500 Ga0070683_1014405001 121
44 3300005330 Ga0070690_100025508 Ga0070690_1000255082 121
45 3300005331 Ga0070670_100121807 Ga0070670_1001218072 121
46 3300005331 Ga0070670_100773219 Ga0070670_1007732192 121
47 3300005333 Ga0070677_10146499 Ga0070677_101464992 121
48 3300005333 Ga0070677_10247930 Ga0070677_102479301 121
49 3300005334 Ga0068869_100021831 Ga0068869_1000218315 121
50 3300005334 Ga0068869_100695247 Ga0068869_1006952472 121
51 3300005337 Ga0070682_100073012 Ga0070682_1000730122 121
52 3300005337 Ga0070682_100178004 Ga0070682_1001780042 121
53 3300005337 Ga0070682_100311122 Ga0070682_1003111222 121
54 3300005338 Ga0068868_100918340 Ga0068868_1009183402 121
55 3300005338 Ga0068868_101055395 Ga0068868_1010553952 121
56 3300005340 Ga0070689_100261405 Ga0070689_1002614052 121
57 3300005340 Ga0070689_100351825 Ga0070689_1003518252 121
58 3300005340 Ga0070689_100513421 Ga0070689_1005134212 121
59 3300005343 Ga0070687_100066116 Ga0070687_1000661162 121
60 3300005343 Ga0070687_100253834 Ga0070687_1002538342 121
61 3300005344 Ga0070661_100031465 Ga0070661_1000314655 121
62 3300005347 Ga0070668_100119632 Ga0070668_1001196322 121
63 3300005353 Ga0070669_100053079 Ga0070669_1000530793 121
64 3300005353 Ga0070669_100104851 Ga0070669_1001048512 121
65 3300005353 Ga0070669_100819696 Ga0070669_1008196961 121
66 3300005354 Ga0070675_100061506 Ga0070675_1000615064 121
67 3300005354 Ga0070675_100164805 Ga0070675_1001648052 121
68 3300005354 Ga0070675_100192998 Ga0070675_1001929982 121
69 3300005354 Ga0070675_100896209 Ga0070675_1008962091 121
70 3300005354 Ga0070675_101654307 Ga0070675_1016543071 121
71 3300005354 Ga0070675_102203195 Ga0070675_1022031951 121
72 3300005355 Ga0070671_100572491 Ga0070671_1005724912 121
73 3300005355 Ga0070671_101914625 Ga0070671_1019146251 121
74 3300005356 Ga0070674_100058820 Ga0070674_1000588202 121
75 3300005356 Ga0070674_100073891 Ga0070674_1000738912 121
76 3300005356 Ga0070674_100121618 Ga0070674_1001216182 121
77 3300005356 Ga0070674_100799656 Ga0070674_1007996562 121
78 3300005356 Ga0070674_100979092 Ga0070674_1009790922 121
79 3300005356 Ga0070674_101290982 Ga0070674_1012909822 121
80 3300005364 Ga0070673_100021345 Ga0070673_1000213452 121
81 3300005364 Ga0070673_100113884 Ga0070673_1001138842 121
82 3300005364 Ga0070673_100171454 Ga0070673_1001714542 121
83 3300005364 Ga0070673_100613518 Ga0070673_1006135182 121
84 3300005365 Ga0070688_100066966 Ga0070688_1000669662 121
85 3300005366 Ga0070659_100718488 Ga0070659_1007184882 121
86 3300005367 Ga0070667_100498951 Ga0070667_1004989512 121
87 3300005367 Ga0070667_101285313 Ga0070667_1012853132 121
88 3300005438 Ga0070701_10609019 Ga0070701_106090192 121
89 3300005444 Ga0070694_100413685 Ga0070694_1004136852 121
90 3300005455 Ga0070663_100180240 Ga0070663_1001802401 121
91 3300005455 Ga0070663_100641406 Ga0070663_1006414061 121
92 3300005455 Ga0070663_101195673 Ga0070663_1011956731 121
93 3300005455 Ga0070663_101257516 Ga0070663_1012575161 121
94 3300005456 Ga0070678_100164829 Ga0070678_1001648292 121
95 3300005456 Ga0070678_100385482 Ga0070678_1003854822 121
96 3300005457 Ga0070662_100595751 Ga0070662_1005957512 121
97 3300005457 Ga0070662_100904214 Ga0070662_1009042141 121
98 3300005459 Ga0068867_100436373 Ga0068867_1004363731 121
99 3300005466 Ga0070685_10159684 Ga0070685_101596842 121
100 3300005543 Ga0070672_100008513 Ga0070672_1000085134 121
101 3300005543 Ga0070672_100045474 Ga0070672_1000454743 121
102 3300005543 Ga0070672_100056954 Ga0070672_1000569542 121
103 3300005543 Ga0070672_100483371 Ga0070672_1004833712 121
104 3300005543 Ga0070672_100511896 Ga0070672_1005118962 121
105 3300005544 Ga0070686_100238771 Ga0070686_1002387712 121
106 3300005544 Ga0070686_100853184 Ga0070686_1008531842 121
107 3300005548 Ga0070665_100096008 Ga0070665_1000960082 121
108 3300005548 Ga0070665_100397550 Ga0070665_1003975502 121
109 3300005548 Ga0070665_101299070 Ga0070665_1012990702 121
110 3300005549 Ga0070704_100339906 Ga0070704_1003399062 121
111 3300005549 Ga0070704_102194325 Ga0070704_1021943251 121
112 3300005564 Ga0070664_100049226 Ga0070664_1000492263 121
113 3300005564 Ga0070664_100404580 Ga0070664_1004045802 121
114 3300005577 Ga0068857_100679918 Ga0068857_1006799182 121
115 3300005577 Ga0068857_101852214 Ga0068857_1018522141 121
116 3300005615 Ga0070702_100476483 Ga0070702_1004764832 121
117 3300005617 Ga0068859_102317610 Ga0068859_1023176102 121
118 3300005719 Ga0068861_100212861 Ga0068861_1002128612 121
119 3300005719 Ga0068861_100247440 Ga0068861_1002474402 121
120 3300005840 Ga0068870_10008348 Ga0068870_100083484 121
121 3300005840 Ga0068870_10032966 Ga0068870_100329662 121
122 3300005840 Ga0068870_10340860 Ga0068870_103408602 121
123 3300005841 Ga0068863_100069890 Ga0068863_1000698906 121
124 3300005841 Ga0068863_100121950 Ga0068863_1001219502 121
125 3300005843 Ga0068860_101084300 Ga0068860_1010843002 121
126 3300005844 Ga0068862_100265247 Ga0068862_1002652472 121
127 3300006237 Ga0097621_100361491 Ga0097621_1003614912 121
128 3300006358 Ga0068871_100432686 Ga0068871_1004326862 121
129 3300006358 Ga0068871_100557362 Ga0068871_1005573622 121
130 3300006846 Ga0075430_100272850 Ga0075430_1002728502 121
131 3300006881 Ga0068865_100619486 Ga0068865_1006194862 121
132 3300006931 Ga0097620_102318197 Ga0097620_1023181972 121
133 3300009094 Ga0111539_10135074 Ga0111539_101350744 121
134 3300009094 Ga0111539_10495496 Ga0111539_104954962 121
135 3300009094 Ga0111539_11249960 Ga0111539_112499601 121
136 3300009094 Ga0111539_11288693 Ga0111539_112886932 121
137 3300009148 Ga0105243_10618831 Ga0105243_106188312 121
138 3300009176 Ga0105242_10350978 Ga0105242_103509782 121
139 3300009176 Ga0105242_11258157 Ga0105242_112581572 121
140 3300009177 Ga0105248_10299517 Ga0105248_102995172 121
141 3300009177 Ga0105248_11027685 Ga0105248_110276852 121
142 3300009177 Ga0105248_11402112 Ga0105248_114021122 121
143 3300009553 Ga0105249_10536766 Ga0105249_105367662 121
144 3300013296 Ga0157374_10225734 Ga0157374_102257342 121
145 3300013306 Ga0163162_11465799 Ga0163162_114657992 121
146 3300013308 Ga0157375_12391172 Ga0157375_123911722 121
147 3300014325 Ga0163163_11140041 Ga0163163_111400412 121
148 3300014326 Ga0157380_10015516 Ga0157380_100155162 121
149 3300014326 Ga0157380_10192208 Ga0157380_101922082 121
150 3300014326 Ga0157380_10291280 Ga0157380_102912802 121
151 3300014326 Ga0157380_10303006 Ga0157380_103030062 121
152 3300014326 Ga0157380_11103294 Ga0157380_111032942 121
153 3300014968 Ga0157379_10313558 Ga0157379_103135582 121
154 3300014969 Ga0157376_10174801 Ga0157376_101748012 121
155 3300014969 Ga0157376_10206106 Ga0157376_102061062 121
156 3300014969 Ga0157376_10364540 Ga0157376_103645402 121
157 3300017792 Ga0163161_10625561 Ga0163161_106255612 121
158 3300025315 Ga0207697_10034472 Ga0207697_100344722 121
159 3300025893 Ga0207682_10003364 Ga0207682_100033642 121
160 3300025893 Ga0207682_10067834 Ga0207682_100678342 121
161 3300025893 Ga0207682_10234889 Ga0207682_102348892 121
162 3300025899 Ga0207642_10069499 Ga0207642_100694992 121
163 3300025903 Ga0207680_10288313 Ga0207680_102883133 121
164 3300025907 Ga0207645_10304318 Ga0207645_103043181 121
165 3300025908 Ga0207643_10024132 Ga0207643_100241322 121
166 3300025908 Ga0207643_10160207 Ga0207643_101602071 121
167 3300025918 Ga0207662_10079172 Ga0207662_100791722 121
168 3300025920 Ga0207649_10169668 Ga0207649_101696682 121
169 3300025923 Ga0207681_10559991 Ga0207681_105599912 121
170 3300025923 Ga0207681_11720692 Ga0207681_117206921 121
171 3300025925 Ga0207650_10202320 Ga0207650_102023202 121
172 3300025925 Ga0207650_11425917 Ga0207650_114259172 121
173 3300025926 Ga0207659_10019909 Ga0207659_100199092 121
174 3300025926 Ga0207659_10266108 Ga0207659_102661082 121
175 3300025926 Ga0207659_10533313 Ga0207659_105333132 121
176 3300025926 Ga0207659_10642893 Ga0207659_106428931 121
177 3300025933 Ga0207706_10295722 Ga0207706_102957222 121
178 3300025933 Ga0207706_10573930 Ga0207706_105739302 121
179 3300025934 Ga0207686_10608386 Ga0207686_106083862 121
180 3300025934 Ga0207686_10786184 Ga0207686_107861842 121
181 3300025935 Ga0207709_10083501 Ga0207709_100835012 121
182 3300025936 Ga0207670_10196802 Ga0207670_101968022 121
183 3300025936 Ga0207670_10275867 Ga0207670_102758672 121
184 3300025936 Ga0207670_10905199 Ga0207670_109051992 121
185 3300025936 Ga0207670_11112404 Ga0207670_111124042 121
186 3300025937 Ga0207669_10090110 Ga0207669_100901102 121
187 3300025937 Ga0207669_10093449 Ga0207669_100934493 121
188 3300025937 Ga0207669_10102982 Ga0207669_101029822 121
189 3300025937 Ga0207669_10156455 Ga0207669_101564552 121
190 3300025937 Ga0207669_10205633 Ga0207669_102056332 121
191 3300025937 Ga0207669_11315537 Ga0207669_113155371 121
192 3300025938 Ga0207704_10203349 Ga0207704_102033492 121
193 3300025938 Ga0207704_10948786 Ga0207704_109487862 121
194 3300025940 Ga0207691_10015054 Ga0207691_100150546 121
195 3300025940 Ga0207691_10019364 Ga0207691_100193646 121
196 3300025940 Ga0207691_10062245 Ga0207691_100622453 121
197 3300025940 Ga0207691_10301416 Ga0207691_103014162 121
198 3300025940 Ga0207691_11056934 Ga0207691_110569341 121
199 3300025941 Ga0207711_10369843 Ga0207711_103698432 121
200 3300025942 Ga0207689_10058481 Ga0207689_100584812 121
201 3300025942 Ga0207689_10375921 Ga0207689_103759212 121
202 3300025945 Ga0207679_10114954 Ga0207679_101149542 121
203 3300025945 Ga0207679_10318933 Ga0207679_103189332 121
204 3300025960 Ga0207651_10014473 Ga0207651_100144734 121
205 3300025960 Ga0207651_10032238 Ga0207651_100322382 121
206 3300025960 Ga0207651_10041383 Ga0207651_100413833 121
207 3300025960 Ga0207651_11053651 Ga0207651_110536512 121
208 3300025961 Ga0207712_10221270 Ga0207712_102212702 121
209 3300025972 Ga0207668_10278466 Ga0207668_102784662 121
210 3300025981 Ga0207640_10295485 Ga0207640_102954852 121
211 3300025986 Ga0207658_11228363 Ga0207658_112283632 121
212 3300026023 Ga0207677_10465920 Ga0207677_104659201 121
213 3300026035 Ga0207703_10259293 Ga0207703_102592932 121
214 3300026041 Ga0207639_11416105 Ga0207639_114161052 121
215 3300026067 Ga0207678_10090072 Ga0207678_100900723 121
216 3300026067 Ga0207678_11292532 Ga0207678_112925322 121
217 3300026075 Ga0207708_10290440 Ga0207708_102904401 121
218 3300026088 Ga0207641_10021150 Ga0207641_100211507 121
219 3300026088 Ga0207641_10041586 Ga0207641_100415863 121
220 3300026089 Ga0207648_10063637 Ga0207648_100636372 121
221 3300026089 Ga0207648_10279899 Ga0207648_102798992 121
222 3300026095 Ga0207676_10718524 Ga0207676_107185242 121
223 3300026116 Ga0207674_10334894 Ga0207674_103348942 121
224 3300026116 Ga0207674_10476336 Ga0207674_104763363 121
225 3300026116 Ga0207674_10743478 Ga0207674_107434782 121
226 3300026118 Ga0207675_100256746 Ga0207675_1002567462 121
227 3300026118 Ga0207675_100387631 Ga0207675_1003876312 121
228 3300026118 Ga0207675_100422477 Ga0207675_1004224772 121
229 3300026121 Ga0207683_10019771 Ga0207683_100197712 121
230 3300026121 Ga0207683_10023531 Ga0207683_100235312 121
231 3300026121 Ga0207683_11221185 Ga0207683_112211852 121
232 3300027907 Ga0207428_10483864 Ga0207428_104838642 121
233 3300028379 Ga0268266_10281883 Ga0268266_102818832 121
234 3300028379 Ga0268266_11138867 Ga0268266_111388672 121
235 3300028380 Ga0268265_10046133 Ga0268265_100461333 121
236 3300028380 Ga0268265_10242221 Ga0268265_102422212 121
237 3300028381 Ga0268264_10183577 Ga0268264_101835772 121
238 3300028794 Ga0307515_10311247 Ga0307515_103112472 121
239 3300031456 Ga0307513_10021047 Ga0307513_100210472 121
240 3300031456 Ga0307513_10036161 Ga0307513_100361614 121
241 3300031456 Ga0307513_10129951 Ga0307513_101299512 121
242 3300031456 Ga0307513_10137941 Ga0307513_101379412 121
243 3300031456 Ga0307513_10387070 Ga0307513_103870702 121
244 3300031507 Ga0307509_10141080 Ga0307509_101410803 121
245 3300031731 Ga0307405_10158187 Ga0307405_101581872 121
246 3300031731 Ga0307405_10294401 Ga0307405_102944012 121
247 3300031731 Ga0307405_10809828 Ga0307405_108098282 121
248 3300031824 Ga0307413_10002649 Ga0307413_100026494 121
249 3300031824 Ga0307413_10025736 Ga0307413_100257363 121
250 3300031824 Ga0307413_10058581 Ga0307413_100585812 121
251 3300031852 Ga0307410_10010560 Ga0307410_100105602 121
252 3300031901 Ga0307406_10031960 Ga0307406_100319602 121
253 3300031903 Ga0307407_10016034 Ga0307407_100160343 121
254 3300031903 Ga0307407_10056598 Ga0307407_100565983 121
255 3300031995 Ga0307409_100008675 Ga0307409_1000086755 121
256 3300031995 Ga0307409_100101120 Ga0307409_1001011202 121
257 3300031995 Ga0307409_100354662 Ga0307409_1003546622 121
258 3300032002 Ga0307416_100055325 Ga0307416_1000553254 121
259 3300032002 Ga0307416_100059698 Ga0307416_1000596984 121
260 3300032002 Ga0307416_100267747 Ga0307416_1002677472 121
261 3300032004 Ga0307414_10609440 Ga0307414_106094402 121
262 3300032005 Ga0307411_10034825 Ga0307411_100348252 121
263 3300032005 Ga0307411_10064886 Ga0307411_100648862 121
264 3300032005 Ga0307411_10872874 Ga0307411_108728741 121
265 3300032126 Ga0307415_100079325 Ga0307415_1000793252 121
266 3300032126 Ga0307415_101461588 Ga0307415_1014615882 121
267 3300035171 Ga0373946_0147289 Ga0373946_0147289_61_426 121
268 3300041441 Ga0451787_324272 Ga0451787_324272_424_789 121
269 3300041451 Ga0451791_0440455 Ga0451791_0440455_505_870 121
270 3300041453 Ga0451797_0067877 Ga0451797_0067877_179_547 121
271 3300041453 Ga0451797_0694510 Ga0451797_0694510_15_380 121
272 3300041456 Ga0451795_1139334 Ga0451795_1139334_721_1089 121
273 3300041458 Ga0451798_0110005 Ga0451798_0110005_246_614 121
274 3300041458 Ga0451798_0428372 Ga0451798_0428372_62_439 121
275 3300041459 Ga0451800_1545234 Ga0451800_1545234_116_484 121
276 3300041486 Ga0451807_0430497 Ga0451807_0430497_172_537 121
277 3300041512 Ga0451853_0828234 Ga0451853_0828234_102_470 121
278 3300046457 Ga0495590_0024966 Ga0495590_0024966_1681_2052 121
279 3300046460 Ga0495638_0009860 Ga0495638_0009860_2738_3103 121
280 3300046461 Ga0495641_0397557 Ga0495641_0397557_166_531 121
281 3300046515 Ga0495620_0296344 Ga0495620_0296344_168_533 121
282 3300046542 Ga0495597_0381929 Ga0495597_0381929_93_458 121
283 3300046616 Ga0495668_0182054 Ga0495668_0182054_169_540 121
284 3300046616 Ga0495668_0240444 Ga0495668_0240444_317_682 121
285 3300046694 Ga0495649_0058793 Ga0495649_0058793_515_886 121
286 3300046694 Ga0495649_0250266 Ga0495649_0250266_42_407 121
287 3300046794 Ga0495589_0065679 Ga0495589_0065679_138_503 121
288 3300047320 Ga0495672_0426361 Ga0495672_0426361_105_476 121
289 3300047472 Ga0495686_0096517 Ga0495686_0096517_950_1315 121
290 3300049568 Ga0501031_0651172 Ga0501031_0651172_56_427 121
291 3300049575 Ga0501039_0083233 Ga0501039_0083233_314_685 121
292 3300049578 Ga0501042_0405406 Ga0501042_0405406_269_640 121
293 3300049584 Ga0501068_0002030 Ga0501068_0002030_1022_1393 121
294 3300049587 Ga0501071_0019403 Ga0501071_0019403_2858_3229 121
295 3300049588 Ga0501072_0958398 Ga0501072_0958398_53_424 121
296 3300049589 Ga0501073_0003704 Ga0501073_0003704_2492_2863 121
297 3300049590 Ga0501074_0000684 Ga0501074_0000684_17927_18298 121
298 3300049591 Ga0501075_0053474 Ga0501075_0053474_1611_1982 121
299 3300049592 Ga0501076_0027367 Ga0501076_0027367_399_770 121
300 3300049593 Ga0501077_0001942 Ga0501077_0001942_5472_5843 121
301 3300049741 Ga0501079_0003927 Ga0501079_0003927_9124_9495 121
302 3300049742 Ga0501080_0012210 Ga0501080_0012210_7391_7762 121
303 3300049744 Ga0501083_0009617 Ga0501083_0009617_2310_2681 121
304 3300049824 Ga0501045_0300824 Ga0501045_0300824_368_739 121
305 3300050511 nmdc:mga08y16_525335_c1 nmdc:mga08y16_525335_c1_718_1092 121
306 3300050511 nmdc:mga08y16_695185_c1 nmdc:mga08y16_695185_c1_355_726 121
307 3300054114 Ga0501084_0002232 Ga0501084_0002232_4842_5213 121
308 3300054114 Ga0501084_0890312 Ga0501084_0890312_208_579 121
309 3300054114 Ga0501084_1617112 Ga0501084_1617112_77_442 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

4

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x58-assembly1.cif.gz_F mper-fluc-ec2 bound to 10e8v4 antibody 0.7843 2 121
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.7821 2 121
7kk9-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.7809 2 119
7kkb-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81c with bromide 0.7798 2 119
6b2d-assembly1.cif.gz_A crystal structure of fluoride channel fluc ec2 t114s mutant 0.7796 2 119
ID Description Score Start End Superfamily
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7906 8 113 1.10.287.70
af_P9WP63_10_123_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7603 9 113 1.10.287.70
af_B6SKI7_170_306_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7508 10 119 1.10.287.70
af_K7KUG7_304_423_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7505 6 110 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7348 8 113 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A3D3TZE2-F1-model_v4 deleted 0.8139 8 120
AF-A0A2G2J6C9-F1-model_v4 deleted 0.8095 6 118
AF-A0A085JMW7-F1-model_v4 Fluoride-specific ion channel FluC 0.8042 2 118 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-Q5GZS7-F1-model_v4 Fluoride-specific ion channel FluC 0.8038 8 119 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-D4GDD9-F1-model_v4 Fluoride-specific ion channel FluC 0.8017 2 119 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Feature Viewer

pLDDT pTM Quality
76.44 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map