F400324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 160 | 309 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300041458|Ga0451798_0428372|Ga0451798_0428372_62_439 |
| Length | 125 |
| Sequence | MTWLLVAVGGALGSLLRYGAYRLWPSSPGGWPVPTFTVNVIGSFAIGLIYMYVAARGIGPTGYARVFWMAGVLGGFTTYSAFALETALLGFNITGIAYVAATVVLCLLATLLGMKVGALLLSMVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 127 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.24 |
| Rhizosphere | 93.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10034997 | 3300002244 | Bacteria | 885 |
| 2 | Ga0065712_10622135 | 3300005290 | Unclassified | 580 |
| 3 | Ga0070676_10388656 | 3300005328 | Bacteria | 968 |
| 4 | Ga0070676_10870952 | 3300005328 | Bacteria | 669 |
| 5 | Ga0070683_100974360 | 3300005329 | Bacteria | 814 |
| 6 | Ga0070683_101440500 | 3300005329 | Unclassified | 662 |
| 7 | Ga0070690_100025508 | 3300005330 | Bacteria | 3641 |
| 8 | Ga0070670_100121807 | 3300005331 | Bacteria | 2250 |
| 9 | Ga0070670_100773219 | 3300005331 | Unclassified | 866 |
| 10 | Ga0070677_10146499 | 3300005333 | Bacteria | 1095 |
| 11 | Ga0070677_10247930 | 3300005333 | Bacteria | 882 |
| 12 | Ga0068869_100021831 | 3300005334 | Bacteria | 4405 |
| 13 | Ga0068869_100695247 | 3300005334 | Bacteria | 867 |
| 14 | Ga0068869_101137814 | 3300005334 | Unclassified | 684 |
| 15 | Ga0070682_100073012 | 3300005337 | Bacteria | 2200 |
| 16 | Ga0070682_100178004 | 3300005337 | Bacteria | 1483 |
| 17 | Ga0070682_100311122 | 3300005337 | Bacteria | 1159 |
| 18 | Ga0068868_100918340 | 3300005338 | Bacteria | 796 |
| 19 | Ga0068868_101055395 | 3300005338 | Bacteria | 746 |
| 20 | Ga0070689_100261405 | 3300005340 | Bacteria | 1431 |
| 21 | Ga0070689_100351825 | 3300005340 | Bacteria | 1236 |
| 22 | Ga0070689_100513421 | 3300005340 | Bacteria | 1028 |
| 23 | Ga0070687_100066116 | 3300005343 | Bacteria | 1925 |
| 24 | Ga0070687_100253834 | 3300005343 | Bacteria | 1094 |
| 25 | Ga0070661_100031465 | 3300005344 | Bacteria | 3838 |
| 26 | Ga0070661_100975267 | 3300005344 | Bacteria | 702 |
| 27 | Ga0070668_100119632 | 3300005347 | Bacteria | 2104 |
| 28 | Ga0070669_100053079 | 3300005353 | Bacteria | 2967 |
| 29 | Ga0070669_100104851 | 3300005353 | Bacteria | 2138 |
| 30 | Ga0070669_100819696 | 3300005353 | Bacteria | 792 |
| 31 | Ga0070675_100061506 | 3300005354 | Bacteria | 3100 |
| 32 | Ga0070675_100164805 | 3300005354 | Bacteria | 1908 |
| 33 | Ga0070675_100192998 | 3300005354 | Bacteria | 1765 |
| 34 | Ga0070675_100896209 | 3300005354 | Bacteria | 813 |
| 35 | Ga0070675_101654307 | 3300005354 | Unclassified | 591 |
| 36 | Ga0070675_102203195 | 3300005354 | Unclassified | 508 |
| 37 | Ga0070671_100572491 | 3300005355 | Bacteria | 975 |
| 38 | Ga0070671_101914625 | 3300005355 | Unclassified | 527 |
| 39 | Ga0070674_100058820 | 3300005356 | Bacteria | 2673 |
| 40 | Ga0070674_100073891 | 3300005356 | Bacteria | 2418 |
| 41 | Ga0070674_100121618 | 3300005356 | Bacteria | 1933 |
| 42 | Ga0070674_100553890 | 3300005356 | Bacteria | 965 |
| 43 | Ga0070674_100799656 | 3300005356 | Bacteria | 814 |
| 44 | Ga0070674_100979092 | 3300005356 | Bacteria | 741 |
| 45 | Ga0070674_101290982 | 3300005356 | Bacteria | 651 |
| 46 | Ga0070673_100021345 | 3300005364 | Bacteria | 4693 |
| 47 | Ga0070673_100113884 | 3300005364 | Bacteria | 2246 |
| 48 | Ga0070673_100171454 | 3300005364 | Bacteria | 1852 |
| 49 | Ga0070673_100613518 | 3300005364 | Unclassified | 993 |
| 50 | Ga0070688_100066966 | 3300005365 | Bacteria | 2287 |
| 51 | Ga0070659_100718488 | 3300005366 | Bacteria | 865 |
| 52 | Ga0070667_100498951 | 3300005367 | Bacteria | 1115 |
| 53 | Ga0070667_101285313 | 3300005367 | Unclassified | 685 |
| 54 | Ga0070701_10609019 | 3300005438 | Unclassified | 724 |
| 55 | Ga0070700_100336012 | 3300005441 | Bacteria | 1115 |
| 56 | Ga0070694_100413685 | 3300005444 | Bacteria | 1058 |
| 57 | Ga0070663_100180240 | 3300005455 | Bacteria | 1638 |
| 58 | Ga0070663_100641406 | 3300005455 | Bacteria | 897 |
| 59 | Ga0070663_101195673 | 3300005455 | Bacteria | 668 |
| 60 | Ga0070663_101257516 | 3300005455 | Bacteria | 652 |
| 61 | Ga0070678_100164829 | 3300005456 | Bacteria | 1799 |
| 62 | Ga0070678_100385482 | 3300005456 | Bacteria | 1214 |
| 63 | Ga0070662_100595751 | 3300005457 | Bacteria | 929 |
| 64 | Ga0070662_100904214 | 3300005457 | Bacteria | 753 |
| 65 | Ga0068867_100436373 | 3300005459 | Bacteria | 1113 |
| 66 | Ga0070685_10159684 | 3300005466 | Bacteria | 1436 |
| 67 | Ga0070672_100008513 | 3300005543 | Bacteria | 7023 |
| 68 | Ga0070672_100045474 | 3300005543 | Bacteria | 3396 |
| 69 | Ga0070672_100056954 | 3300005543 | Bacteria | 3067 |
| 70 | Ga0070672_100483371 | 3300005543 | Bacteria | 1069 |
| 71 | Ga0070672_100511896 | 3300005543 | Bacteria | 1039 |
| 72 | Ga0070686_100238771 | 3300005544 | Bacteria | 1322 |
| 73 | Ga0070686_100853184 | 3300005544 | Bacteria | 738 |
| 74 | Ga0070665_100096008 | 3300005548 | Bacteria | 2969 |
| 75 | Ga0070665_100397550 | 3300005548 | Bacteria | 1386 |
| 76 | Ga0070665_101299070 | 3300005548 | Unclassified | 737 |
| 77 | Ga0070704_100339906 | 3300005549 | Bacteria | 1264 |
| 78 | Ga0070704_102194325 | 3300005549 | Bacteria | 513 |
| 79 | Ga0070704_102216624 | 3300005549 | Bacteria | 511 |
| 80 | Ga0070664_100049226 | 3300005564 | Bacteria | 3563 |
| 81 | Ga0070664_100304340 | 3300005564 | Bacteria | 1441 |
| 82 | Ga0070664_100404580 | 3300005564 | Bacteria | 1248 |
| 83 | Ga0068857_100679918 | 3300005577 | Bacteria | 977 |
| 84 | Ga0068857_101852214 | 3300005577 | Bacteria | 591 |
| 85 | Ga0068854_100889512 | 3300005578 | Unclassified | 782 |
| 86 | Ga0068854_101359576 | 3300005578 | Bacteria | 641 |
| 87 | Ga0070702_100165670 | 3300005615 | Bacteria | 1433 |
| 88 | Ga0070702_100476483 | 3300005615 | Unclassified | 911 |
| 89 | Ga0068859_101093234 | 3300005617 | Bacteria | 877 |
| 90 | Ga0068859_102317610 | 3300005617 | Bacteria | 592 |
| 91 | Ga0068861_100212861 | 3300005719 | Bacteria | 1629 |
| 92 | Ga0068861_100247440 | 3300005719 | Bacteria | 1519 |
| 93 | Ga0068870_10008348 | 3300005840 | Bacteria | 4656 |
| 94 | Ga0068870_10032966 | 3300005840 | Bacteria | 2639 |
| 95 | Ga0068870_10340860 | 3300005840 | Bacteria | 959 |
| 96 | Ga0068863_100069890 | 3300005841 | Bacteria | 3320 |
| 97 | Ga0068863_100121950 | 3300005841 | Bacteria | 2486 |
| 98 | Ga0068860_101084300 | 3300005843 | Bacteria | 820 |
| 99 | Ga0068862_100265247 | 3300005844 | Bacteria | 1569 |
| 100 | Ga0097621_100361491 | 3300006237 | Bacteria | 1293 |
| 101 | Ga0097621_100404523 | 3300006237 | Bacteria | 1223 |
| 102 | Ga0068871_100432686 | 3300006358 | Bacteria | 1177 |
| 103 | Ga0068871_100557362 | 3300006358 | Bacteria | 1038 |
| 104 | Ga0068871_100670493 | 3300006358 | Bacteria | 948 |
| 105 | Ga0075430_100272850 | 3300006846 | Bacteria | 1400 |
| 106 | Ga0068865_100619486 | 3300006881 | Unclassified | 917 |
| 107 | Ga0097620_101093429 | 3300006931 | Bacteria | 877 |
| 108 | Ga0097620_102318197 | 3300006931 | Bacteria | 592 |
| 109 | Ga0111539_10135074 | 3300009094 | Bacteria | 2889 |
| 110 | Ga0111539_10495496 | 3300009094 | Bacteria | 1423 |
| 111 | Ga0111539_11249960 | 3300009094 | Bacteria | 862 |
| 112 | Ga0111539_11288693 | 3300009094 | Bacteria | 848 |
| 113 | Ga0105243_10618831 | 3300009148 | Bacteria | 1045 |
| 114 | Ga0105242_10350978 | 3300009176 | Bacteria | 1362 |
| 115 | Ga0105242_11258157 | 3300009176 | Unclassified | 762 |
| 116 | Ga0105248_10299517 | 3300009177 | Bacteria | 1811 |
| 117 | Ga0105248_11027685 | 3300009177 | Bacteria | 931 |
| 118 | Ga0105248_11402112 | 3300009177 | Bacteria | 791 |
| 119 | Ga0105249_10536766 | 3300009553 | Bacteria | 1219 |
| 120 | Ga0157374_10225734 | 3300013296 | Bacteria | 1839 |
| 121 | Ga0163162_11465799 | 3300013306 | Bacteria | 777 |
| 122 | Ga0163162_12481541 | 3300013306 | Bacteria | 596 |
| 123 | Ga0157375_12391172 | 3300013308 | Bacteria | 630 |
| 124 | Ga0163163_11140041 | 3300014325 | Bacteria | 842 |
| 125 | Ga0157380_10015516 | 3300014326 | Bacteria | 5600 |
| 126 | Ga0157380_10192208 | 3300014326 | Bacteria | 1803 |
| 127 | Ga0157380_10291280 | 3300014326 | Bacteria | 1499 |
| 128 | Ga0157380_10303006 | 3300014326 | Bacteria | 1473 |
| 129 | Ga0157380_10713999 | 3300014326 | Bacteria | 1009 |
| 130 | Ga0157380_10979466 | 3300014326 | Unclassified | 878 |
| 131 | Ga0157380_11103294 | 3300014326 | Unclassified | 833 |
| 132 | Ga0157379_10313558 | 3300014968 | Bacteria | 1431 |
| 133 | Ga0157376_10174801 | 3300014969 | Bacteria | 1958 |
| 134 | Ga0157376_10206106 | 3300014969 | Bacteria | 1812 |
| 135 | Ga0157376_10364540 | 3300014969 | Bacteria | 1387 |
| 136 | Ga0163161_10625561 | 3300017792 | Bacteria | 890 |
| 137 | Ga0163161_10875188 | 3300017792 | Bacteria | 760 |
| 138 | Ga0207697_10034472 | 3300025315 | Bacteria | 2072 |
| 139 | Ga0207682_10003364 | 3300025893 | Bacteria | 6965 |
| 140 | Ga0207682_10067834 | 3300025893 | Bacteria | 1506 |
| 141 | Ga0207682_10234889 | 3300025893 | Bacteria | 851 |
| 142 | Ga0207642_10069499 | 3300025899 | Bacteria | 1670 |
| 143 | Ga0207680_10288313 | 3300025903 | Bacteria | 1142 |
| 144 | Ga0207645_10304318 | 3300025907 | Bacteria | 1062 |
| 145 | Ga0207643_10024132 | 3300025908 | Bacteria | 3355 |
| 146 | Ga0207643_10160207 | 3300025908 | Bacteria | 1353 |
| 147 | Ga0207662_10079172 | 3300025918 | Bacteria | 2001 |
| 148 | Ga0207649_10169668 | 3300025920 | Bacteria | 1519 |
| 149 | Ga0207649_10486264 | 3300025920 | Bacteria | 937 |
| 150 | Ga0207681_10559991 | 3300025923 | Unclassified | 941 |
| 151 | Ga0207681_11720692 | 3300025923 | Bacteria | 524 |
| 152 | Ga0207650_10202320 | 3300025925 | Bacteria | 1591 |
| 153 | Ga0207650_11425917 | 3300025925 | Bacteria | 589 |
| 154 | Ga0207659_10019909 | 3300025926 | Bacteria | 4426 |
| 155 | Ga0207659_10266108 | 3300025926 | Bacteria | 1397 |
| 156 | Ga0207659_10533313 | 3300025926 | Bacteria | 996 |
| 157 | Ga0207659_10642893 | 3300025926 | Bacteria | 906 |
| 158 | Ga0207706_10295722 | 3300025933 | Bacteria | 1411 |
| 159 | Ga0207706_10573930 | 3300025933 | Bacteria | 970 |
| 160 | Ga0207686_10608386 | 3300025934 | Bacteria | 861 |
| 161 | Ga0207686_10786184 | 3300025934 | Unclassified | 762 |
| 162 | Ga0207709_10083501 | 3300025935 | Bacteria | 2065 |
| 163 | Ga0207670_10196802 | 3300025936 | Bacteria | 1528 |
| 164 | Ga0207670_10275867 | 3300025936 | Bacteria | 1309 |
| 165 | Ga0207670_10905199 | 3300025936 | Bacteria | 739 |
| 166 | Ga0207670_11112404 | 3300025936 | Unclassified | 667 |
| 167 | Ga0207669_10090110 | 3300025937 | Bacteria | 1993 |
| 168 | Ga0207669_10093449 | 3300025937 | Bacteria | 1965 |
| 169 | Ga0207669_10102982 | 3300025937 | Bacteria | 1892 |
| 170 | Ga0207669_10156455 | 3300025937 | Bacteria | 1604 |
| 171 | Ga0207669_10205633 | 3300025937 | Bacteria | 1433 |
| 172 | Ga0207669_10409618 | 3300025937 | Unclassified | 1064 |
| 173 | Ga0207669_11315537 | 3300025937 | Bacteria | 614 |
| 174 | Ga0207704_10203349 | 3300025938 | Bacteria | 1451 |
| 175 | Ga0207704_10948786 | 3300025938 | Bacteria | 725 |
| 176 | Ga0207691_10015054 | 3300025940 | Bacteria | 7362 |
| 177 | Ga0207691_10019364 | 3300025940 | Bacteria | 6440 |
| 178 | Ga0207691_10062245 | 3300025940 | Bacteria | 3387 |
| 179 | Ga0207691_10301416 | 3300025940 | Bacteria | 1377 |
| 180 | Ga0207691_11056934 | 3300025940 | Unclassified | 676 |
| 181 | Ga0207711_10369843 | 3300025941 | Bacteria | 1329 |
| 182 | Ga0207689_10058481 | 3300025942 | Bacteria | 3171 |
| 183 | Ga0207689_10375921 | 3300025942 | Bacteria | 1183 |
| 184 | Ga0207679_10114954 | 3300025945 | Bacteria | 2131 |
| 185 | Ga0207679_10227419 | 3300025945 | Bacteria | 1573 |
| 186 | Ga0207679_10318933 | 3300025945 | Bacteria | 1345 |
| 187 | Ga0207651_10014473 | 3300025960 | Bacteria | 4558 |
| 188 | Ga0207651_10032238 | 3300025960 | Bacteria | 3363 |
| 189 | Ga0207651_10041383 | 3300025960 | Bacteria | 3058 |
| 190 | Ga0207651_11053651 | 3300025960 | Bacteria | 728 |
| 191 | Ga0207712_10221270 | 3300025961 | Bacteria | 1514 |
| 192 | Ga0207668_10278466 | 3300025972 | Bacteria | 1371 |
| 193 | Ga0207640_10295485 | 3300025981 | Bacteria | 1279 |
| 194 | Ga0207658_11228363 | 3300025986 | Unclassified | 685 |
| 195 | Ga0207677_10465920 | 3300026023 | Bacteria | 1086 |
| 196 | Ga0207703_10259293 | 3300026035 | Bacteria | 1571 |
| 197 | Ga0207639_11416105 | 3300026041 | Bacteria | 652 |
| 198 | Ga0207678_10090072 | 3300026067 | Bacteria | 2622 |
| 199 | Ga0207678_11292532 | 3300026067 | Bacteria | 645 |
| 200 | Ga0207708_10290440 | 3300026075 | Bacteria | 1327 |
| 201 | Ga0207708_10822346 | 3300026075 | Bacteria | 801 |
| 202 | Ga0207641_10021150 | 3300026088 | Bacteria | 5348 |
| 203 | Ga0207641_10041586 | 3300026088 | Bacteria | 3852 |
| 204 | Ga0207648_10063637 | 3300026089 | Bacteria | 3215 |
| 205 | Ga0207648_10279899 | 3300026089 | Bacteria | 1492 |
| 206 | Ga0207676_10718524 | 3300026095 | Bacteria | 969 |
| 207 | Ga0207674_10334894 | 3300026116 | Bacteria | 1463 |
| 208 | Ga0207674_10476336 | 3300026116 | Bacteria | 1207 |
| 209 | Ga0207674_10743478 | 3300026116 | Bacteria | 947 |
| 210 | Ga0207675_100002808 | 3300026118 | Bacteria | 17117 |
| 211 | Ga0207675_100256746 | 3300026118 | Bacteria | 1693 |
| 212 | Ga0207675_100387631 | 3300026118 | Bacteria | 1375 |
| 213 | Ga0207675_100422477 | 3300026118 | Bacteria | 1317 |
| 214 | Ga0207683_10019771 | 3300026121 | Bacteria | 5753 |
| 215 | Ga0207683_10023531 | 3300026121 | Bacteria | 5299 |
| 216 | Ga0207683_11221185 | 3300026121 | Bacteria | 697 |
| 217 | Ga0207428_10483864 | 3300027907 | Bacteria | 900 |
| 218 | Ga0268266_10281883 | 3300028379 | Bacteria | 1545 |
| 219 | Ga0268266_11138867 | 3300028379 | Bacteria | 755 |
| 220 | Ga0268265_10046133 | 3300028380 | Bacteria | 3256 |
| 221 | Ga0268265_10242221 | 3300028380 | Bacteria | 1592 |
| 222 | Ga0268264_10183577 | 3300028381 | Bacteria | 1902 |
| 223 | Ga0307515_10311247 | 3300028794 | Bacteria | 1250 |
| 224 | Ga0307513_10021047 | 3300031456 | Bacteria | 7709 |
| 225 | Ga0307513_10036161 | 3300031456 | Bacteria | 5515 |
| 226 | Ga0307513_10129951 | 3300031456 | Bacteria | 2466 |
| 227 | Ga0307513_10137941 | 3300031456 | Bacteria | 2370 |
| 228 | Ga0307513_10387070 | 3300031456 | Bacteria | 1136 |
| 229 | Ga0307509_10141080 | 3300031507 | Bacteria | 2345 |
| 230 | Ga0307509_10309063 | 3300031507 | Bacteria | 1324 |
| 231 | Ga0307405_10158187 | 3300031731 | Bacteria | 1601 |
| 232 | Ga0307405_10294401 | 3300031731 | Bacteria | 1228 |
| 233 | Ga0307405_10809828 | 3300031731 | Bacteria | 785 |
| 234 | Ga0307413_10002649 | 3300031824 | Bacteria | 7330 |
| 235 | Ga0307413_10025736 | 3300031824 | Bacteria | 3231 |
| 236 | Ga0307413_10058581 | 3300031824 | Bacteria | 2362 |
| 237 | Ga0307410_10010560 | 3300031852 | Bacteria | 5238 |
| 238 | Ga0307406_10031960 | 3300031901 | Bacteria | 3209 |
| 239 | Ga0307407_10016034 | 3300031903 | Bacteria | 3721 |
| 240 | Ga0307407_10056598 | 3300031903 | Bacteria | 2271 |
| 241 | Ga0307409_100008675 | 3300031995 | Bacteria | 6187 |
| 242 | Ga0307409_100101120 | 3300031995 | Bacteria | 2391 |
| 243 | Ga0307409_100354662 | 3300031995 | Bacteria | 1385 |
| 244 | Ga0307416_100055325 | 3300032002 | Bacteria | 3195 |
| 245 | Ga0307416_100059698 | 3300032002 | Bacteria | 3101 |
| 246 | Ga0307416_100267747 | 3300032002 | Bacteria | 1675 |
| 247 | Ga0307414_10609440 | 3300032004 | Bacteria | 980 |
| 248 | Ga0307411_10034825 | 3300032005 | Bacteria | 3137 |
| 249 | Ga0307411_10064886 | 3300032005 | Bacteria | 2446 |
| 250 | Ga0307411_10872874 | 3300032005 | Unclassified | 797 |
| 251 | Ga0307415_100079325 | 3300032126 | Bacteria | 2338 |
| 252 | Ga0307415_101461588 | 3300032126 | Unclassified | 653 |
| 253 | Ga0373941_0513702 | 3300035115 | Unclassified | 511 |
| 254 | Ga0373946_0147289 | 3300035171 | Bacteria | 1096 |
| 255 | Ga0451787_324272 | 3300041441 | Bacteria | 834 |
| 256 | Ga0451791_0440455 | 3300041451 | Bacteria | 887 |
| 257 | Ga0451791_1497291 | 3300041451 | Bacteria | 512 |
| 258 | Ga0451797_0067877 | 3300041453 | Bacteria | 658 |
| 259 | Ga0451797_0694510 | 3300041453 | Bacteria | 1180 |
| 260 | Ga0451795_1139334 | 3300041456 | Bacteria | 1125 |
| 261 | Ga0451798_0110005 | 3300041458 | Unclassified | 1052 |
| 262 | Ga0451798_0428372 | 3300041458 | Unclassified | 663 |
| 263 | Ga0451800_1545234 | 3300041459 | Unclassified | 917 |
| 264 | Ga0451807_0430497 | 3300041486 | Bacteria | 549 |
| 265 | Ga0451853_0828234 | 3300041512 | Bacteria | 564 |
| 266 | Ga0495590_0024966 | 3300046457 | Bacteria | 2103 |
| 267 | Ga0495638_0009860 | 3300046460 | Bacteria | 6665 |
| 268 | Ga0495641_0397557 | 3300046461 | Unclassified | 625 |
| 269 | Ga0495620_0296344 | 3300046515 | Bacteria | 615 |
| 270 | Ga0495597_0381929 | 3300046542 | Bacteria | 537 |
| 271 | Ga0495668_0182054 | 3300046616 | Bacteria | 1151 |
| 272 | Ga0495668_0240444 | 3300046616 | Bacteria | 991 |
| 273 | Ga0495649_0004842 | 3300046694 | Bacteria | 8707 |
| 274 | Ga0495649_0058793 | 3300046694 | Bacteria | 2071 |
| 275 | Ga0495649_0250266 | 3300046694 | Bacteria | 910 |
| 276 | Ga0495589_0065679 | 3300046794 | Bacteria | 1778 |
| 277 | Ga0495672_0426361 | 3300047320 | Bacteria | 602 |
| 278 | Ga0495686_0096517 | 3300047472 | Bacteria | 1789 |
| 279 | Ga0501031_0651172 | 3300049568 | Bacteria | 677 |
| 280 | Ga0501036_0762208 | 3300049572 | Unclassified | 798 |
| 281 | Ga0501039_0083233 | 3300049575 | Bacteria | 2492 |
| 282 | Ga0501042_0405406 | 3300049578 | Bacteria | 988 |
| 283 | Ga0501048_0427138 | 3300049582 | Bacteria | 948 |
| 284 | Ga0501068_0002030 | 3300049584 | Bacteria | 10783 |
| 285 | Ga0501069_0313302 | 3300049585 | Unclassified | 921 |
| 286 | Ga0501070_0768406 | 3300049586 | Bacteria | 758 |
| 287 | Ga0501071_0019403 | 3300049587 | Bacteria | 4718 |
| 288 | Ga0501071_0637642 | 3300049587 | Bacteria | 820 |
| 289 | Ga0501072_0958398 | 3300049588 | Unclassified | 667 |
| 290 | Ga0501073_0003704 | 3300049589 | Bacteria | 11485 |
| 291 | Ga0501074_0000684 | 3300049590 | Bacteria | 21169 |
| 292 | Ga0501075_0053474 | 3300049591 | Bacteria | 3037 |
| 293 | Ga0501076_0027367 | 3300049592 | Bacteria | 4422 |
| 294 | Ga0501077_0001942 | 3300049593 | Bacteria | 12519 |
| 295 | Ga0501077_0455076 | 3300049593 | Bacteria | 820 |
| 296 | Ga0501079_0003927 | 3300049741 | Bacteria | 10983 |
| 297 | Ga0501080_0012210 | 3300049742 | Bacteria | 7871 |
| 298 | Ga0501081_0527654 | 3300049743 | Unclassified | 881 |
| 299 | Ga0501083_0009617 | 3300049744 | Bacteria | 6830 |
| 300 | Ga0501045_0300824 | 3300049824 | Bacteria | 1194 |
| 301 | Ga0501045_0718169 | 3300049824 | Unclassified | 737 |
| 302 | nmdc:mga08y16_525335_c1 | 3300050511 | Bacteria | 1200 |
| 303 | nmdc:mga08y16_695185_c1 | 3300050511 | Bacteria | 1017 |
| 304 | Ga0501084_0002232 | 3300054114 | Bacteria | 15556 |
| 305 | Ga0501084_0890312 | 3300054114 | Bacteria | 749 |
| 306 | Ga0501084_1617112 | 3300054114 | Bacteria | 542 |
| 307 | Ga0501082_0567886 | 3300060353 | Bacteria | 992 |
| 308 | Ga0530510_0307381 | 3300061734 | Bacteria | 1187 |
| 309 | Ga0530510_0312027 | 3300061734 | Bacteria | 1178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0427138 | Ga0501048_0427138_70_441 | 102 |
| 2 | 3300049585 | Ga0501069_0313302 | Ga0501069_0313302_84_455 | 102 |
| 3 | 3300049593 | Ga0501077_0455076 | Ga0501077_0455076_110_481 | 102 |
| 4 | 3300049743 | Ga0501081_0527654 | Ga0501081_0527654_24_395 | 102 |
| 5 | 3300049824 | Ga0501045_0718169 | Ga0501045_0718169_183_554 | 102 |
| 6 | 3300060353 | Ga0501082_0567886 | Ga0501082_0567886_539_910 | 102 |
| 7 | 3300061734 | Ga0530510_0312027 | Ga0530510_0312027_562_933 | 102 |
| 8 | 3300005549 | Ga0070704_102216624 | Ga0070704_1022166241 | 103 |
| 9 | 3300006237 | Ga0097621_100404523 | Ga0097621_1004045232 | 104 |
| 10 | 3300049586 | Ga0501070_0768406 | Ga0501070_0768406_199_570 | 104 |
| 11 | 3300061734 | Ga0530510_0307381 | Ga0530510_0307381_847_1176 | 107 |
| 12 | 3300031507 | Ga0307509_10309063 | Ga0307509_103090632 | 109 |
| 13 | 3300005441 | Ga0070700_100336012 | Ga0070700_1003360122 | 110 |
| 14 | 3300005578 | Ga0068854_101359576 | Ga0068854_1013595762 | 110 |
| 15 | 3300005617 | Ga0068859_101093234 | Ga0068859_1010932342 | 110 |
| 16 | 3300006931 | Ga0097620_101093429 | Ga0097620_1010934292 | 110 |
| 17 | 3300013306 | Ga0163162_12481541 | Ga0163162_124815411 | 110 |
| 18 | 3300014326 | Ga0157380_10979466 | Ga0157380_109794662 | 110 |
| 19 | 3300017792 | Ga0163161_10875188 | Ga0163161_108751881 | 110 |
| 20 | 3300026075 | Ga0207708_10822346 | Ga0207708_108223462 | 110 |
| 21 | 3300026118 | Ga0207675_100002808 | Ga0207675_1000028087 | 110 |
| 22 | 3300035115 | Ga0373941_0513702 | Ga0373941_0513702_37_405 | 110 |
| 23 | 3300049587 | Ga0501071_0637642 | Ga0501071_0637642_434_805 | 111 |
| 24 | 3300006358 | Ga0068871_100670493 | Ga0068871_1006704932 | 113 |
| 25 | 3300046694 | Ga0495649_0004842 | Ga0495649_0004842_3801_4145 | 114 |
| 26 | 3300005356 | Ga0070674_100553890 | Ga0070674_1005538902 | 115 |
| 27 | 3300025937 | Ga0207669_10409618 | Ga0207669_104096182 | 115 |
| 28 | 3300049572 | Ga0501036_0762208 | Ga0501036_0762208_332_682 | 116 |
| 29 | 3300005334 | Ga0068869_101137814 | Ga0068869_1011378142 | 119 |
| 30 | 3300005344 | Ga0070661_100975267 | Ga0070661_1009752672 | 119 |
| 31 | 3300005564 | Ga0070664_100304340 | Ga0070664_1003043402 | 119 |
| 32 | 3300005578 | Ga0068854_100889512 | Ga0068854_1008895122 | 119 |
| 33 | 3300005615 | Ga0070702_100165670 | Ga0070702_1001656702 | 119 |
| 34 | 3300014326 | Ga0157380_10713999 | Ga0157380_107139992 | 119 |
| 35 | 3300025920 | Ga0207649_10486264 | Ga0207649_104862642 | 119 |
| 36 | 3300025945 | Ga0207679_10227419 | Ga0207679_102274192 | 119 |
| 37 | 3300041451 | Ga0451791_1497291 | Ga0451791_1497291_104_463 | 119 |
| 38 | 3300002244 | JGI24742J22300_10034997 | JGI24742J22300_100349972 | 121 |
| 39 | 3300005290 | Ga0065712_10622135 | Ga0065712_106221351 | 121 |
| 40 | 3300005328 | Ga0070676_10388656 | Ga0070676_103886561 | 121 |
| 41 | 3300005328 | Ga0070676_10870952 | Ga0070676_108709521 | 121 |
| 42 | 3300005329 | Ga0070683_100974360 | Ga0070683_1009743602 | 121 |
| 43 | 3300005329 | Ga0070683_101440500 | Ga0070683_1014405001 | 121 |
| 44 | 3300005330 | Ga0070690_100025508 | Ga0070690_1000255082 | 121 |
| 45 | 3300005331 | Ga0070670_100121807 | Ga0070670_1001218072 | 121 |
| 46 | 3300005331 | Ga0070670_100773219 | Ga0070670_1007732192 | 121 |
| 47 | 3300005333 | Ga0070677_10146499 | Ga0070677_101464992 | 121 |
| 48 | 3300005333 | Ga0070677_10247930 | Ga0070677_102479301 | 121 |
| 49 | 3300005334 | Ga0068869_100021831 | Ga0068869_1000218315 | 121 |
| 50 | 3300005334 | Ga0068869_100695247 | Ga0068869_1006952472 | 121 |
| 51 | 3300005337 | Ga0070682_100073012 | Ga0070682_1000730122 | 121 |
| 52 | 3300005337 | Ga0070682_100178004 | Ga0070682_1001780042 | 121 |
| 53 | 3300005337 | Ga0070682_100311122 | Ga0070682_1003111222 | 121 |
| 54 | 3300005338 | Ga0068868_100918340 | Ga0068868_1009183402 | 121 |
| 55 | 3300005338 | Ga0068868_101055395 | Ga0068868_1010553952 | 121 |
| 56 | 3300005340 | Ga0070689_100261405 | Ga0070689_1002614052 | 121 |
| 57 | 3300005340 | Ga0070689_100351825 | Ga0070689_1003518252 | 121 |
| 58 | 3300005340 | Ga0070689_100513421 | Ga0070689_1005134212 | 121 |
| 59 | 3300005343 | Ga0070687_100066116 | Ga0070687_1000661162 | 121 |
| 60 | 3300005343 | Ga0070687_100253834 | Ga0070687_1002538342 | 121 |
| 61 | 3300005344 | Ga0070661_100031465 | Ga0070661_1000314655 | 121 |
| 62 | 3300005347 | Ga0070668_100119632 | Ga0070668_1001196322 | 121 |
| 63 | 3300005353 | Ga0070669_100053079 | Ga0070669_1000530793 | 121 |
| 64 | 3300005353 | Ga0070669_100104851 | Ga0070669_1001048512 | 121 |
| 65 | 3300005353 | Ga0070669_100819696 | Ga0070669_1008196961 | 121 |
| 66 | 3300005354 | Ga0070675_100061506 | Ga0070675_1000615064 | 121 |
| 67 | 3300005354 | Ga0070675_100164805 | Ga0070675_1001648052 | 121 |
| 68 | 3300005354 | Ga0070675_100192998 | Ga0070675_1001929982 | 121 |
| 69 | 3300005354 | Ga0070675_100896209 | Ga0070675_1008962091 | 121 |
| 70 | 3300005354 | Ga0070675_101654307 | Ga0070675_1016543071 | 121 |
| 71 | 3300005354 | Ga0070675_102203195 | Ga0070675_1022031951 | 121 |
| 72 | 3300005355 | Ga0070671_100572491 | Ga0070671_1005724912 | 121 |
| 73 | 3300005355 | Ga0070671_101914625 | Ga0070671_1019146251 | 121 |
| 74 | 3300005356 | Ga0070674_100058820 | Ga0070674_1000588202 | 121 |
| 75 | 3300005356 | Ga0070674_100073891 | Ga0070674_1000738912 | 121 |
| 76 | 3300005356 | Ga0070674_100121618 | Ga0070674_1001216182 | 121 |
| 77 | 3300005356 | Ga0070674_100799656 | Ga0070674_1007996562 | 121 |
| 78 | 3300005356 | Ga0070674_100979092 | Ga0070674_1009790922 | 121 |
| 79 | 3300005356 | Ga0070674_101290982 | Ga0070674_1012909822 | 121 |
| 80 | 3300005364 | Ga0070673_100021345 | Ga0070673_1000213452 | 121 |
| 81 | 3300005364 | Ga0070673_100113884 | Ga0070673_1001138842 | 121 |
| 82 | 3300005364 | Ga0070673_100171454 | Ga0070673_1001714542 | 121 |
| 83 | 3300005364 | Ga0070673_100613518 | Ga0070673_1006135182 | 121 |
| 84 | 3300005365 | Ga0070688_100066966 | Ga0070688_1000669662 | 121 |
| 85 | 3300005366 | Ga0070659_100718488 | Ga0070659_1007184882 | 121 |
| 86 | 3300005367 | Ga0070667_100498951 | Ga0070667_1004989512 | 121 |
| 87 | 3300005367 | Ga0070667_101285313 | Ga0070667_1012853132 | 121 |
| 88 | 3300005438 | Ga0070701_10609019 | Ga0070701_106090192 | 121 |
| 89 | 3300005444 | Ga0070694_100413685 | Ga0070694_1004136852 | 121 |
| 90 | 3300005455 | Ga0070663_100180240 | Ga0070663_1001802401 | 121 |
| 91 | 3300005455 | Ga0070663_100641406 | Ga0070663_1006414061 | 121 |
| 92 | 3300005455 | Ga0070663_101195673 | Ga0070663_1011956731 | 121 |
| 93 | 3300005455 | Ga0070663_101257516 | Ga0070663_1012575161 | 121 |
| 94 | 3300005456 | Ga0070678_100164829 | Ga0070678_1001648292 | 121 |
| 95 | 3300005456 | Ga0070678_100385482 | Ga0070678_1003854822 | 121 |
| 96 | 3300005457 | Ga0070662_100595751 | Ga0070662_1005957512 | 121 |
| 97 | 3300005457 | Ga0070662_100904214 | Ga0070662_1009042141 | 121 |
| 98 | 3300005459 | Ga0068867_100436373 | Ga0068867_1004363731 | 121 |
| 99 | 3300005466 | Ga0070685_10159684 | Ga0070685_101596842 | 121 |
| 100 | 3300005543 | Ga0070672_100008513 | Ga0070672_1000085134 | 121 |
| 101 | 3300005543 | Ga0070672_100045474 | Ga0070672_1000454743 | 121 |
| 102 | 3300005543 | Ga0070672_100056954 | Ga0070672_1000569542 | 121 |
| 103 | 3300005543 | Ga0070672_100483371 | Ga0070672_1004833712 | 121 |
| 104 | 3300005543 | Ga0070672_100511896 | Ga0070672_1005118962 | 121 |
| 105 | 3300005544 | Ga0070686_100238771 | Ga0070686_1002387712 | 121 |
| 106 | 3300005544 | Ga0070686_100853184 | Ga0070686_1008531842 | 121 |
| 107 | 3300005548 | Ga0070665_100096008 | Ga0070665_1000960082 | 121 |
| 108 | 3300005548 | Ga0070665_100397550 | Ga0070665_1003975502 | 121 |
| 109 | 3300005548 | Ga0070665_101299070 | Ga0070665_1012990702 | 121 |
| 110 | 3300005549 | Ga0070704_100339906 | Ga0070704_1003399062 | 121 |
| 111 | 3300005549 | Ga0070704_102194325 | Ga0070704_1021943251 | 121 |
| 112 | 3300005564 | Ga0070664_100049226 | Ga0070664_1000492263 | 121 |
| 113 | 3300005564 | Ga0070664_100404580 | Ga0070664_1004045802 | 121 |
| 114 | 3300005577 | Ga0068857_100679918 | Ga0068857_1006799182 | 121 |
| 115 | 3300005577 | Ga0068857_101852214 | Ga0068857_1018522141 | 121 |
| 116 | 3300005615 | Ga0070702_100476483 | Ga0070702_1004764832 | 121 |
| 117 | 3300005617 | Ga0068859_102317610 | Ga0068859_1023176102 | 121 |
| 118 | 3300005719 | Ga0068861_100212861 | Ga0068861_1002128612 | 121 |
| 119 | 3300005719 | Ga0068861_100247440 | Ga0068861_1002474402 | 121 |
| 120 | 3300005840 | Ga0068870_10008348 | Ga0068870_100083484 | 121 |
| 121 | 3300005840 | Ga0068870_10032966 | Ga0068870_100329662 | 121 |
| 122 | 3300005840 | Ga0068870_10340860 | Ga0068870_103408602 | 121 |
| 123 | 3300005841 | Ga0068863_100069890 | Ga0068863_1000698906 | 121 |
| 124 | 3300005841 | Ga0068863_100121950 | Ga0068863_1001219502 | 121 |
| 125 | 3300005843 | Ga0068860_101084300 | Ga0068860_1010843002 | 121 |
| 126 | 3300005844 | Ga0068862_100265247 | Ga0068862_1002652472 | 121 |
| 127 | 3300006237 | Ga0097621_100361491 | Ga0097621_1003614912 | 121 |
| 128 | 3300006358 | Ga0068871_100432686 | Ga0068871_1004326862 | 121 |
| 129 | 3300006358 | Ga0068871_100557362 | Ga0068871_1005573622 | 121 |
| 130 | 3300006846 | Ga0075430_100272850 | Ga0075430_1002728502 | 121 |
| 131 | 3300006881 | Ga0068865_100619486 | Ga0068865_1006194862 | 121 |
| 132 | 3300006931 | Ga0097620_102318197 | Ga0097620_1023181972 | 121 |
| 133 | 3300009094 | Ga0111539_10135074 | Ga0111539_101350744 | 121 |
| 134 | 3300009094 | Ga0111539_10495496 | Ga0111539_104954962 | 121 |
| 135 | 3300009094 | Ga0111539_11249960 | Ga0111539_112499601 | 121 |
| 136 | 3300009094 | Ga0111539_11288693 | Ga0111539_112886932 | 121 |
| 137 | 3300009148 | Ga0105243_10618831 | Ga0105243_106188312 | 121 |
| 138 | 3300009176 | Ga0105242_10350978 | Ga0105242_103509782 | 121 |
| 139 | 3300009176 | Ga0105242_11258157 | Ga0105242_112581572 | 121 |
| 140 | 3300009177 | Ga0105248_10299517 | Ga0105248_102995172 | 121 |
| 141 | 3300009177 | Ga0105248_11027685 | Ga0105248_110276852 | 121 |
| 142 | 3300009177 | Ga0105248_11402112 | Ga0105248_114021122 | 121 |
| 143 | 3300009553 | Ga0105249_10536766 | Ga0105249_105367662 | 121 |
| 144 | 3300013296 | Ga0157374_10225734 | Ga0157374_102257342 | 121 |
| 145 | 3300013306 | Ga0163162_11465799 | Ga0163162_114657992 | 121 |
| 146 | 3300013308 | Ga0157375_12391172 | Ga0157375_123911722 | 121 |
| 147 | 3300014325 | Ga0163163_11140041 | Ga0163163_111400412 | 121 |
| 148 | 3300014326 | Ga0157380_10015516 | Ga0157380_100155162 | 121 |
| 149 | 3300014326 | Ga0157380_10192208 | Ga0157380_101922082 | 121 |
| 150 | 3300014326 | Ga0157380_10291280 | Ga0157380_102912802 | 121 |
| 151 | 3300014326 | Ga0157380_10303006 | Ga0157380_103030062 | 121 |
| 152 | 3300014326 | Ga0157380_11103294 | Ga0157380_111032942 | 121 |
| 153 | 3300014968 | Ga0157379_10313558 | Ga0157379_103135582 | 121 |
| 154 | 3300014969 | Ga0157376_10174801 | Ga0157376_101748012 | 121 |
| 155 | 3300014969 | Ga0157376_10206106 | Ga0157376_102061062 | 121 |
| 156 | 3300014969 | Ga0157376_10364540 | Ga0157376_103645402 | 121 |
| 157 | 3300017792 | Ga0163161_10625561 | Ga0163161_106255612 | 121 |
| 158 | 3300025315 | Ga0207697_10034472 | Ga0207697_100344722 | 121 |
| 159 | 3300025893 | Ga0207682_10003364 | Ga0207682_100033642 | 121 |
| 160 | 3300025893 | Ga0207682_10067834 | Ga0207682_100678342 | 121 |
| 161 | 3300025893 | Ga0207682_10234889 | Ga0207682_102348892 | 121 |
| 162 | 3300025899 | Ga0207642_10069499 | Ga0207642_100694992 | 121 |
| 163 | 3300025903 | Ga0207680_10288313 | Ga0207680_102883133 | 121 |
| 164 | 3300025907 | Ga0207645_10304318 | Ga0207645_103043181 | 121 |
| 165 | 3300025908 | Ga0207643_10024132 | Ga0207643_100241322 | 121 |
| 166 | 3300025908 | Ga0207643_10160207 | Ga0207643_101602071 | 121 |
| 167 | 3300025918 | Ga0207662_10079172 | Ga0207662_100791722 | 121 |
| 168 | 3300025920 | Ga0207649_10169668 | Ga0207649_101696682 | 121 |
| 169 | 3300025923 | Ga0207681_10559991 | Ga0207681_105599912 | 121 |
| 170 | 3300025923 | Ga0207681_11720692 | Ga0207681_117206921 | 121 |
| 171 | 3300025925 | Ga0207650_10202320 | Ga0207650_102023202 | 121 |
| 172 | 3300025925 | Ga0207650_11425917 | Ga0207650_114259172 | 121 |
| 173 | 3300025926 | Ga0207659_10019909 | Ga0207659_100199092 | 121 |
| 174 | 3300025926 | Ga0207659_10266108 | Ga0207659_102661082 | 121 |
| 175 | 3300025926 | Ga0207659_10533313 | Ga0207659_105333132 | 121 |
| 176 | 3300025926 | Ga0207659_10642893 | Ga0207659_106428931 | 121 |
| 177 | 3300025933 | Ga0207706_10295722 | Ga0207706_102957222 | 121 |
| 178 | 3300025933 | Ga0207706_10573930 | Ga0207706_105739302 | 121 |
| 179 | 3300025934 | Ga0207686_10608386 | Ga0207686_106083862 | 121 |
| 180 | 3300025934 | Ga0207686_10786184 | Ga0207686_107861842 | 121 |
| 181 | 3300025935 | Ga0207709_10083501 | Ga0207709_100835012 | 121 |
| 182 | 3300025936 | Ga0207670_10196802 | Ga0207670_101968022 | 121 |
| 183 | 3300025936 | Ga0207670_10275867 | Ga0207670_102758672 | 121 |
| 184 | 3300025936 | Ga0207670_10905199 | Ga0207670_109051992 | 121 |
| 185 | 3300025936 | Ga0207670_11112404 | Ga0207670_111124042 | 121 |
| 186 | 3300025937 | Ga0207669_10090110 | Ga0207669_100901102 | 121 |
| 187 | 3300025937 | Ga0207669_10093449 | Ga0207669_100934493 | 121 |
| 188 | 3300025937 | Ga0207669_10102982 | Ga0207669_101029822 | 121 |
| 189 | 3300025937 | Ga0207669_10156455 | Ga0207669_101564552 | 121 |
| 190 | 3300025937 | Ga0207669_10205633 | Ga0207669_102056332 | 121 |
| 191 | 3300025937 | Ga0207669_11315537 | Ga0207669_113155371 | 121 |
| 192 | 3300025938 | Ga0207704_10203349 | Ga0207704_102033492 | 121 |
| 193 | 3300025938 | Ga0207704_10948786 | Ga0207704_109487862 | 121 |
| 194 | 3300025940 | Ga0207691_10015054 | Ga0207691_100150546 | 121 |
| 195 | 3300025940 | Ga0207691_10019364 | Ga0207691_100193646 | 121 |
| 196 | 3300025940 | Ga0207691_10062245 | Ga0207691_100622453 | 121 |
| 197 | 3300025940 | Ga0207691_10301416 | Ga0207691_103014162 | 121 |
| 198 | 3300025940 | Ga0207691_11056934 | Ga0207691_110569341 | 121 |
| 199 | 3300025941 | Ga0207711_10369843 | Ga0207711_103698432 | 121 |
| 200 | 3300025942 | Ga0207689_10058481 | Ga0207689_100584812 | 121 |
| 201 | 3300025942 | Ga0207689_10375921 | Ga0207689_103759212 | 121 |
| 202 | 3300025945 | Ga0207679_10114954 | Ga0207679_101149542 | 121 |
| 203 | 3300025945 | Ga0207679_10318933 | Ga0207679_103189332 | 121 |
| 204 | 3300025960 | Ga0207651_10014473 | Ga0207651_100144734 | 121 |
| 205 | 3300025960 | Ga0207651_10032238 | Ga0207651_100322382 | 121 |
| 206 | 3300025960 | Ga0207651_10041383 | Ga0207651_100413833 | 121 |
| 207 | 3300025960 | Ga0207651_11053651 | Ga0207651_110536512 | 121 |
| 208 | 3300025961 | Ga0207712_10221270 | Ga0207712_102212702 | 121 |
| 209 | 3300025972 | Ga0207668_10278466 | Ga0207668_102784662 | 121 |
| 210 | 3300025981 | Ga0207640_10295485 | Ga0207640_102954852 | 121 |
| 211 | 3300025986 | Ga0207658_11228363 | Ga0207658_112283632 | 121 |
| 212 | 3300026023 | Ga0207677_10465920 | Ga0207677_104659201 | 121 |
| 213 | 3300026035 | Ga0207703_10259293 | Ga0207703_102592932 | 121 |
| 214 | 3300026041 | Ga0207639_11416105 | Ga0207639_114161052 | 121 |
| 215 | 3300026067 | Ga0207678_10090072 | Ga0207678_100900723 | 121 |
| 216 | 3300026067 | Ga0207678_11292532 | Ga0207678_112925322 | 121 |
| 217 | 3300026075 | Ga0207708_10290440 | Ga0207708_102904401 | 121 |
| 218 | 3300026088 | Ga0207641_10021150 | Ga0207641_100211507 | 121 |
| 219 | 3300026088 | Ga0207641_10041586 | Ga0207641_100415863 | 121 |
| 220 | 3300026089 | Ga0207648_10063637 | Ga0207648_100636372 | 121 |
| 221 | 3300026089 | Ga0207648_10279899 | Ga0207648_102798992 | 121 |
| 222 | 3300026095 | Ga0207676_10718524 | Ga0207676_107185242 | 121 |
| 223 | 3300026116 | Ga0207674_10334894 | Ga0207674_103348942 | 121 |
| 224 | 3300026116 | Ga0207674_10476336 | Ga0207674_104763363 | 121 |
| 225 | 3300026116 | Ga0207674_10743478 | Ga0207674_107434782 | 121 |
| 226 | 3300026118 | Ga0207675_100256746 | Ga0207675_1002567462 | 121 |
| 227 | 3300026118 | Ga0207675_100387631 | Ga0207675_1003876312 | 121 |
| 228 | 3300026118 | Ga0207675_100422477 | Ga0207675_1004224772 | 121 |
| 229 | 3300026121 | Ga0207683_10019771 | Ga0207683_100197712 | 121 |
| 230 | 3300026121 | Ga0207683_10023531 | Ga0207683_100235312 | 121 |
| 231 | 3300026121 | Ga0207683_11221185 | Ga0207683_112211852 | 121 |
| 232 | 3300027907 | Ga0207428_10483864 | Ga0207428_104838642 | 121 |
| 233 | 3300028379 | Ga0268266_10281883 | Ga0268266_102818832 | 121 |
| 234 | 3300028379 | Ga0268266_11138867 | Ga0268266_111388672 | 121 |
| 235 | 3300028380 | Ga0268265_10046133 | Ga0268265_100461333 | 121 |
| 236 | 3300028380 | Ga0268265_10242221 | Ga0268265_102422212 | 121 |
| 237 | 3300028381 | Ga0268264_10183577 | Ga0268264_101835772 | 121 |
| 238 | 3300028794 | Ga0307515_10311247 | Ga0307515_103112472 | 121 |
| 239 | 3300031456 | Ga0307513_10021047 | Ga0307513_100210472 | 121 |
| 240 | 3300031456 | Ga0307513_10036161 | Ga0307513_100361614 | 121 |
| 241 | 3300031456 | Ga0307513_10129951 | Ga0307513_101299512 | 121 |
| 242 | 3300031456 | Ga0307513_10137941 | Ga0307513_101379412 | 121 |
| 243 | 3300031456 | Ga0307513_10387070 | Ga0307513_103870702 | 121 |
| 244 | 3300031507 | Ga0307509_10141080 | Ga0307509_101410803 | 121 |
| 245 | 3300031731 | Ga0307405_10158187 | Ga0307405_101581872 | 121 |
| 246 | 3300031731 | Ga0307405_10294401 | Ga0307405_102944012 | 121 |
| 247 | 3300031731 | Ga0307405_10809828 | Ga0307405_108098282 | 121 |
| 248 | 3300031824 | Ga0307413_10002649 | Ga0307413_100026494 | 121 |
| 249 | 3300031824 | Ga0307413_10025736 | Ga0307413_100257363 | 121 |
| 250 | 3300031824 | Ga0307413_10058581 | Ga0307413_100585812 | 121 |
| 251 | 3300031852 | Ga0307410_10010560 | Ga0307410_100105602 | 121 |
| 252 | 3300031901 | Ga0307406_10031960 | Ga0307406_100319602 | 121 |
| 253 | 3300031903 | Ga0307407_10016034 | Ga0307407_100160343 | 121 |
| 254 | 3300031903 | Ga0307407_10056598 | Ga0307407_100565983 | 121 |
| 255 | 3300031995 | Ga0307409_100008675 | Ga0307409_1000086755 | 121 |
| 256 | 3300031995 | Ga0307409_100101120 | Ga0307409_1001011202 | 121 |
| 257 | 3300031995 | Ga0307409_100354662 | Ga0307409_1003546622 | 121 |
| 258 | 3300032002 | Ga0307416_100055325 | Ga0307416_1000553254 | 121 |
| 259 | 3300032002 | Ga0307416_100059698 | Ga0307416_1000596984 | 121 |
| 260 | 3300032002 | Ga0307416_100267747 | Ga0307416_1002677472 | 121 |
| 261 | 3300032004 | Ga0307414_10609440 | Ga0307414_106094402 | 121 |
| 262 | 3300032005 | Ga0307411_10034825 | Ga0307411_100348252 | 121 |
| 263 | 3300032005 | Ga0307411_10064886 | Ga0307411_100648862 | 121 |
| 264 | 3300032005 | Ga0307411_10872874 | Ga0307411_108728741 | 121 |
| 265 | 3300032126 | Ga0307415_100079325 | Ga0307415_1000793252 | 121 |
| 266 | 3300032126 | Ga0307415_101461588 | Ga0307415_1014615882 | 121 |
| 267 | 3300035171 | Ga0373946_0147289 | Ga0373946_0147289_61_426 | 121 |
| 268 | 3300041441 | Ga0451787_324272 | Ga0451787_324272_424_789 | 121 |
| 269 | 3300041451 | Ga0451791_0440455 | Ga0451791_0440455_505_870 | 121 |
| 270 | 3300041453 | Ga0451797_0067877 | Ga0451797_0067877_179_547 | 121 |
| 271 | 3300041453 | Ga0451797_0694510 | Ga0451797_0694510_15_380 | 121 |
| 272 | 3300041456 | Ga0451795_1139334 | Ga0451795_1139334_721_1089 | 121 |
| 273 | 3300041458 | Ga0451798_0110005 | Ga0451798_0110005_246_614 | 121 |
| 274 | 3300041458 | Ga0451798_0428372 | Ga0451798_0428372_62_439 | 121 |
| 275 | 3300041459 | Ga0451800_1545234 | Ga0451800_1545234_116_484 | 121 |
| 276 | 3300041486 | Ga0451807_0430497 | Ga0451807_0430497_172_537 | 121 |
| 277 | 3300041512 | Ga0451853_0828234 | Ga0451853_0828234_102_470 | 121 |
| 278 | 3300046457 | Ga0495590_0024966 | Ga0495590_0024966_1681_2052 | 121 |
| 279 | 3300046460 | Ga0495638_0009860 | Ga0495638_0009860_2738_3103 | 121 |
| 280 | 3300046461 | Ga0495641_0397557 | Ga0495641_0397557_166_531 | 121 |
| 281 | 3300046515 | Ga0495620_0296344 | Ga0495620_0296344_168_533 | 121 |
| 282 | 3300046542 | Ga0495597_0381929 | Ga0495597_0381929_93_458 | 121 |
| 283 | 3300046616 | Ga0495668_0182054 | Ga0495668_0182054_169_540 | 121 |
| 284 | 3300046616 | Ga0495668_0240444 | Ga0495668_0240444_317_682 | 121 |
| 285 | 3300046694 | Ga0495649_0058793 | Ga0495649_0058793_515_886 | 121 |
| 286 | 3300046694 | Ga0495649_0250266 | Ga0495649_0250266_42_407 | 121 |
| 287 | 3300046794 | Ga0495589_0065679 | Ga0495589_0065679_138_503 | 121 |
| 288 | 3300047320 | Ga0495672_0426361 | Ga0495672_0426361_105_476 | 121 |
| 289 | 3300047472 | Ga0495686_0096517 | Ga0495686_0096517_950_1315 | 121 |
| 290 | 3300049568 | Ga0501031_0651172 | Ga0501031_0651172_56_427 | 121 |
| 291 | 3300049575 | Ga0501039_0083233 | Ga0501039_0083233_314_685 | 121 |
| 292 | 3300049578 | Ga0501042_0405406 | Ga0501042_0405406_269_640 | 121 |
| 293 | 3300049584 | Ga0501068_0002030 | Ga0501068_0002030_1022_1393 | 121 |
| 294 | 3300049587 | Ga0501071_0019403 | Ga0501071_0019403_2858_3229 | 121 |
| 295 | 3300049588 | Ga0501072_0958398 | Ga0501072_0958398_53_424 | 121 |
| 296 | 3300049589 | Ga0501073_0003704 | Ga0501073_0003704_2492_2863 | 121 |
| 297 | 3300049590 | Ga0501074_0000684 | Ga0501074_0000684_17927_18298 | 121 |
| 298 | 3300049591 | Ga0501075_0053474 | Ga0501075_0053474_1611_1982 | 121 |
| 299 | 3300049592 | Ga0501076_0027367 | Ga0501076_0027367_399_770 | 121 |
| 300 | 3300049593 | Ga0501077_0001942 | Ga0501077_0001942_5472_5843 | 121 |
| 301 | 3300049741 | Ga0501079_0003927 | Ga0501079_0003927_9124_9495 | 121 |
| 302 | 3300049742 | Ga0501080_0012210 | Ga0501080_0012210_7391_7762 | 121 |
| 303 | 3300049744 | Ga0501083_0009617 | Ga0501083_0009617_2310_2681 | 121 |
| 304 | 3300049824 | Ga0501045_0300824 | Ga0501045_0300824_368_739 | 121 |
| 305 | 3300050511 | nmdc:mga08y16_525335_c1 | nmdc:mga08y16_525335_c1_718_1092 | 121 |
| 306 | 3300050511 | nmdc:mga08y16_695185_c1 | nmdc:mga08y16_695185_c1_355_726 | 121 |
| 307 | 3300054114 | Ga0501084_0002232 | Ga0501084_0002232_4842_5213 | 121 |
| 308 | 3300054114 | Ga0501084_0890312 | Ga0501084_0890312_208_579 | 121 |
| 309 | 3300054114 | Ga0501084_1617112 | Ga0501084_1617112_77_442 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6x58-assembly1.cif.gz_F | mper-fluc-ec2 bound to 10e8v4 antibody | 0.7843 | 2 | 121 |
| 5a43-assembly1.cif.gz_B | crystal structure of a dual topology fluoride ion channel. | 0.7821 | 2 | 121 |
| 7kk9-assembly1.cif.gz_B | fluoride channel fluc-ec2 mutant s81a/t82a with bromide | 0.7809 | 2 | 119 |
| 7kkb-assembly1.cif.gz_B | fluoride channel fluc-ec2 mutant s81c with bromide | 0.7798 | 2 | 119 |
| 6b2d-assembly1.cif.gz_A | crystal structure of fluoride channel fluc ec2 t114s mutant | 0.7796 | 2 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37002_6_119_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7906 | 8 | 113 | 1.10.287.70 |
| af_P9WP63_10_123_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7603 | 9 | 113 | 1.10.287.70 |
| af_B6SKI7_170_306_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7508 | 10 | 119 | 1.10.287.70 |
| af_K7KUG7_304_423_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7505 | 6 | 110 | 1.10.287.70 |
| af_P37002_6_119_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7348 | 8 | 113 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3TZE2-F1-model_v4 | deleted | 0.8139 | 8 | 120 |
|
| AF-A0A2G2J6C9-F1-model_v4 | deleted | 0.8095 | 6 | 118 |
|
| AF-A0A085JMW7-F1-model_v4 | Fluoride-specific ion channel FluC | 0.8042 | 2 | 118 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-Q5GZS7-F1-model_v4 | Fluoride-specific ion channel FluC | 0.8038 | 8 | 119 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-D4GDD9-F1-model_v4 | Fluoride-specific ion channel FluC | 0.8017 | 2 | 119 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar