F400288

General Info

Members Datasets Scaffolds Average Seq Length
309 213 618 71

Family's Representative Sequence

Representative Sequence 3300035085|Ga0373929_0224867|Ga0373929_0224867_18_272
Length 84
Sequence MMRRLNRRCLMASKKQAATVYRVTEIIGTSPTSWEAAAKSAVETAAKTLRDLRVAEVSQLDMKIEDGKVVAYRARVSLSFKYEG

Samples

Sample ID Description Type Environment
1 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
170 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 2.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.91
Rhizosphere 94.5
Stem 0
Stem Tuber 0
Unclassified 21.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373929_0224867 3300035085 Unclassified 535
2 Ga0065707_10133441 3300005295 Bacteria 1881
3 Ga0065707_10267478 3300005295 Bacteria 1080
4 Ga0070676_11535645 3300005328 Unclassified 513
5 Ga0070683_100113068 3300005329 Bacteria 2562
6 Ga0070690_101196931 3300005330 Bacteria 606
7 Ga0070670_100110527 3300005331 Unclassified 2368
8 Ga0070677_10038003 3300005333 Bacteria 1881
9 Ga0070666_10748467 3300005335 Bacteria 718
10 Ga0070680_100202686 3300005336 Bacteria 1673
11 Ga0070680_101682993 3300005336 Bacteria 550
12 Ga0070682_100616205 3300005337 Bacteria 859
13 Ga0070682_101533578 3300005337 Bacteria 574
14 Ga0068868_100007037 3300005338 Bacteria 7996
15 Ga0070689_101817128 3300005340 Bacteria 556
16 Ga0070691_10060138 3300005341 Bacteria 1826
17 Ga0070668_100328995 3300005347 Bacteria 1288
18 Ga0070669_101170632 3300005353 Bacteria 664
19 Ga0070669_101920143 3300005353 Bacteria 517
20 Ga0070675_101503258 3300005354 Bacteria 621
21 Ga0070671_100226077 3300005355 Bacteria 1588
22 Ga0070671_100861999 3300005355 Bacteria 790
23 Ga0070674_100050762 3300005356 Unclassified 2856
24 Ga0070673_100010691 3300005364 Bacteria 6224
25 Ga0070673_101243647 3300005364 Bacteria 698
26 Ga0070667_100099681 3300005367 Bacteria 2508
27 Ga0070667_100555375 3300005367 Bacteria 1056
28 Ga0070703_10211250 3300005406 Bacteria 767
29 Ga0070714_100112285 3300005435 Unclassified 2415
30 Ga0070701_11242846 3300005438 Bacteria 530
31 Ga0070711_100010958 3300005439 Bacteria 5619
32 Ga0070711_100271554 3300005439 Bacteria 1338
33 Ga0070705_101865873 3300005440 Viruses 511
34 Ga0070700_100542901 3300005441 Bacteria 902
35 Ga0070708_100246976 3300005445 Bacteria 1676
36 Ga0070708_100257612 3300005445 Bacteria 1640
37 Ga0070663_100300054 3300005455 Bacteria 1286
38 Ga0070678_100412955 3300005456 Bacteria 1175
39 Ga0070662_101229548 3300005457 Unclassified 644
40 Ga0068867_100017328 3300005459 Bacteria 5116
41 Ga0068867_100125746 3300005459 Bacteria 1987
42 Ga0070706_100026525 3300005467 Bacteria 5330
43 Ga0070707_100071418 3300005468 Bacteria 3344
44 Ga0070707_100672968 3300005468 Bacteria 998
45 Ga0070707_100916674 3300005468 Bacteria 841
46 Ga0070707_101499745 3300005468 Unclassified 641
47 Ga0070698_100292438 3300005471 Bacteria 1560
48 Ga0070698_100851811 3300005471 Bacteria 856
49 Ga0070698_100977330 3300005471 Unclassified 793
50 Ga0070699_100002591 3300005518 Bacteria 16208
51 Ga0070699_101084048 3300005518 Bacteria 735
52 Ga0070699_102063046 3300005518 Unclassified 521
53 Ga0070679_100582305 3300005530 Bacteria 1063
54 Ga0070679_100726200 3300005530 Bacteria 936
55 Ga0070684_100055423 3300005535 Bacteria 3456
56 Ga0070684_101242332 3300005535 Bacteria 701
57 Ga0070697_100013100 3300005536 Bacteria 6500
58 Ga0070697_100135927 3300005536 Bacteria 2064
59 Ga0070697_100470189 3300005536 Bacteria 1097
60 Ga0068853_100216838 3300005539 Bacteria 1746
61 Ga0070686_100027045 3300005544 Bacteria 3469
62 Ga0070686_101854824 3300005544 Bacteria 514
63 Ga0070695_100143533 3300005545 Bacteria 1658
64 Ga0070695_101158161 3300005545 Bacteria 635
65 Ga0070696_100350526 3300005546 Bacteria 1143
66 Ga0070696_100399053 3300005546 Bacteria 1075
67 Ga0070696_100458603 3300005546 Bacteria 1007
68 Ga0070696_100605793 3300005546 Bacteria 884
69 Ga0070696_101585659 3300005546 Bacteria 562
70 Ga0070693_100013556 3300005547 Unclassified 4155
71 Ga0070693_100215117 3300005547 Bacteria 1256
72 Ga0070693_100675685 3300005547 Bacteria 753
73 Ga0070665_100857966 3300005548 Bacteria 921
74 Ga0070704_100015790 3300005549 Bacteria 4754
75 Ga0068857_100890260 3300005577 Unclassified 853
76 Ga0070702_100139290 3300005615 Bacteria 1543
77 Ga0070702_100143925 3300005615 Bacteria 1522
78 Ga0068859_101286293 3300005617 Unclassified 806
79 Ga0068866_10058886 3300005718 Unclassified 1985
80 Ga0068861_102560996 3300005719 Bacteria 514
81 Ga0068861_102582515 3300005719 Unclassified 512
82 Ga0068863_100067061 3300005841 Bacteria 3395
83 Ga0068863_101080998 3300005841 Bacteria 806
84 Ga0068858_101336128 3300005842 Bacteria 706
85 Ga0068858_102297868 3300005842 Unclassified 533
86 Ga0068860_100437812 3300005843 Bacteria 1298
87 Ga0068862_100247863 3300005844 Bacteria 1622
88 Ga0068862_101941002 3300005844 Bacteria 599
89 Ga0081455_10067556 3300005937 Bacteria 2978
90 Ga0081455_10161091 3300005937 Bacteria 1720
91 Ga0081455_10706643 3300005937 Bacteria 642
92 Ga0081539_10032475 3300005985 Bacteria 3197
93 Ga0070717_10285608 3300006028 Unclassified 1464
94 Ga0070717_10288980 3300006028 Bacteria 1455
95 Ga0070717_10667033 3300006028 Unclassified 944
96 Ga0070715_10108168 3300006163 Archaea 1308
97 Ga0070715_10576637 3300006163 Unclassified 656
98 Ga0070716_100587746 3300006173 Unclassified 836
99 Ga0070712_100110935 3300006175 Unclassified 2047
100 Ga0070712_101234942 3300006175 Unclassified 650
101 Ga0097621_100114570 3300006237 Bacteria 2281
102 Ga0068871_100186683 3300006358 Bacteria 1784
103 Ga0075428_100044746 3300006844 Bacteria 4864
104 Ga0075428_100726241 3300006844 Bacteria 1058
105 Ga0075431_100061327 3300006847 Bacteria 3880
106 Ga0075431_100355653 3300006847 Bacteria 1472
107 Ga0075433_10457877 3300006852 Bacteria 1124
108 Ga0075434_100184632 3300006871 Bacteria 2106
109 Ga0075436_100137405 3300006914 Bacteria 1717
110 Ga0097620_101286305 3300006931 Unclassified 806
111 Ga0075435_101574826 3300007076 Bacteria 576
112 Ga0099794_10000100 3300007265 Bacteria 31849
113 Ga0099794_10001789 3300007265 Bacteria 7672
114 Ga0099794_10161787 3300007265 Bacteria 1139
115 Ga0099795_10017779 3300007788 Bacteria 2273
116 Ga0099795_10066264 3300007788 Bacteria 1352
117 Ga0111539_12168359 3300009094 Bacteria 645
118 Ga0105245_10607759 3300009098 Bacteria 1120
119 Ga0105245_11398113 3300009098 Bacteria 750
120 Ga0105247_10468286 3300009101 Unclassified 912
121 Ga0105247_11353195 3300009101 Unclassified 574
122 Ga0114129_10482248 3300009147 Bacteria 1622
123 Ga0114129_11574761 3300009147 Bacteria 805
124 Ga0114129_11733028 3300009147 Bacteria 761
125 Ga0114129_13400315 3300009147 Bacteria 512
126 Ga0105241_11548341 3300009174 Bacteria 640
127 Ga0105242_10457093 3300009176 Bacteria 1205
128 Ga0105242_11732867 3300009176 Bacteria 662
129 Ga0105248_10435186 3300009177 Bacteria 1477
130 Ga0105248_10657366 3300009177 Bacteria 1182
131 Ga0105248_11083116 3300009177 Bacteria 906
132 Ga0099796_10039586 3300010159 Bacteria 1587
133 Ga0099796_10135378 3300010159 Bacteria 959
134 Ga0099796_10175532 3300010159 Unclassified 857
135 Ga0157373_10151808 3300013100 Bacteria 1629
136 Ga0157378_10040412 3300013297 Bacteria 4136
137 Ga0157378_10290984 3300013297 Bacteria 1578
138 Ga0163162_11315245 3300013306 Bacteria 821
139 Ga0157375_11523102 3300013308 Bacteria 790
140 Ga0157375_12563386 3300013308 Bacteria 609
141 Ga0157377_10696754 3300014745 Unclassified 737
142 Ga0157376_10125978 3300014969 Bacteria 2278
143 Ga0157376_11665394 3300014969 Bacteria 673
144 Ga0206350_11626845 3300020080 Unclassified 588
145 Ga0206354_10493068 3300020081 Bacteria 563
146 Ga0224712_10499721 3300022467 Unclassified 588
147 Ga0207653_10037542 3300025885 Bacteria 1580
148 Ga0207642_10451879 3300025899 Bacteria 779
149 Ga0207710_10534855 3300025900 Bacteria 610
150 Ga0207680_10698966 3300025903 Bacteria 727
151 Ga0207685_10084640 3300025905 Bacteria 1321
152 Ga0207645_11138148 3300025907 Bacteria 525
153 Ga0207684_10007431 3300025910 Bacteria 9863
154 Ga0207684_10178259 3300025910 Unclassified 1832
155 Ga0207684_10204876 3300025910 Bacteria 1702
156 Ga0207684_11345417 3300025910 Bacteria 586
157 Ga0207684_11645456 3300025910 Unclassified 519
158 Ga0207654_10903414 3300025911 Bacteria 640
159 Ga0207693_10194446 3300025915 Bacteria 1596
160 Ga0207663_10804877 3300025916 Unclassified 748
161 Ga0207660_10610976 3300025917 Bacteria 888
162 Ga0207662_11369612 3300025918 Bacteria 502
163 Ga0207652_10239445 3300025921 Bacteria 1636
164 Ga0207646_10230743 3300025922 Bacteria 1672
165 Ga0207646_10402452 3300025922 Bacteria 1236
166 Ga0207646_11251627 3300025922 Bacteria 649
167 Ga0207646_11280012 3300025922 Unclassified 641
168 Ga0207681_11299447 3300025923 Unclassified 611
169 Ga0207650_10070483 3300025925 Bacteria 2628
170 Ga0207687_10976042 3300025927 Bacteria 726
171 Ga0207687_11699707 3300025927 Bacteria 541
172 Ga0207700_10040571 3300025928 Bacteria 3398
173 Ga0207700_11174325 3300025928 Unclassified 685
174 Ga0207664_10144200 3300025929 Bacteria 2018
175 Ga0207664_11311322 3300025929 Unclassified 644
176 Ga0207644_10239867 3300025931 Bacteria 1443
177 Ga0207644_11240168 3300025931 Bacteria 627
178 Ga0207686_10629806 3300025934 Bacteria 847
179 Ga0207670_11238549 3300025936 Bacteria 632
180 Ga0207669_11000792 3300025937 Bacteria 702
181 Ga0207704_11463628 3300025938 Bacteria 586
182 Ga0207665_10350228 3300025939 Unclassified 1115
183 Ga0207665_10918845 3300025939 Bacteria 695
184 Ga0207711_10760662 3300025941 Bacteria 903
185 Ga0207661_10085188 3300025944 Bacteria 2619
186 Ga0207651_10163111 3300025960 Bacteria 1749
187 Ga0207651_11247102 3300025960 Bacteria 668
188 Ga0207712_11204328 3300025961 Unclassified 676
189 Ga0207668_10298328 3300025972 Bacteria 1329
190 Ga0207658_10381850 3300025986 Bacteria 1234
191 Ga0207677_10015596 3300026023 Bacteria 4476
192 Ga0207703_10468907 3300026035 Bacteria 1179
193 Ga0207708_10553028 3300026075 Bacteria 971
194 Ga0207648_10008723 3300026089 Bacteria 9776
195 Ga0207648_10105842 3300026089 Bacteria 2468
196 Ga0207675_102167904 3300026118 Unclassified 571
197 Ga0207683_10198683 3300026121 Bacteria 1822
198 Ga0209179_1002901 3300027512 Bacteria 2392
199 Ga0209179_1087420 3300027512 Unclassified 690
200 Ga0209588_1002677 3300027671 Bacteria 4860
201 Ga0209588_1029636 3300027671 Unclassified 1746
202 Ga0209588_1157787 3300027671 Bacteria 717
203 Ga0209588_1199267 3300027671 Unclassified 624
204 Ga0209588_1228589 3300027671 Bacteria 573
205 Ga0268266_11691002 3300028379 Bacteria 608
206 Ga0268265_10153390 3300028380 Bacteria 1946
207 Ga0268265_10789283 3300028380 Bacteria 925
208 Ga0268264_10833585 3300028381 Bacteria 923
209 Ga0268264_11105120 3300028381 Bacteria 801
210 Ga0265337_1007249 3300028556 Bacteria 4167
211 Ga0265318_10025819 3300028577 Bacteria 2316
212 Ga0265338_10004782 3300028800 Bacteria 18100
213 Ga0265332_10149470 3300031238 Unclassified 977
214 Ga0265320_10000403 3300031240 Bacteria 34524
215 Ga0316575_10063321 3300031665 Unclassified 1480
216 Ga0316579_10386940 3300031691 Unclassified 676
217 Ga0265314_10021583 3300031711 Unclassified 4945
218 Ga0316576_10158277 3300031727 Bacteria 1708
219 Ga0316578_10062064 3300031728 Bacteria 2203
220 Ga0316577_10316225 3300031733 Bacteria 885
221 Ga0316577_10517995 3300031733 Unclassified 678
222 Ga0316577_10729022 3300031733 Bacteria 563
223 Ga0307413_11016808 3300031824 Unclassified 711
224 Ga0307416_100429360 3300032002 Bacteria 1368
225 Ga0307416_101064804 3300032002 Unclassified 913
226 Ga0307411_10168947 3300032005 Unclassified 1647
227 Ga0307411_12190767 3300032005 Unclassified 518
228 Ga0307415_100365372 3300032126 Bacteria 1220
229 Ga0316583_10120798 3300032133 Unclassified 913
230 Ga0316592_1182010 3300033524 Unclassified 503
231 Ga0316586_1071451 3300033527 Bacteria 640
232 Ga0316588_1202911 3300033528 Unclassified 519
233 Ga0316587_1044668 3300033529 Unclassified 804
234 Ga0316587_1110474 3300033529 Bacteria 534
235 Ga0316596_1202567 3300033541 Unclassified 552
236 Ga0373926_0177622 3300035083 Bacteria 816
237 Ga0373934_0502721 3300035086 Bacteria 509
238 Ga0373923_0007921 3300035111 Bacteria 3760
239 Ga0373953_0020137 3300035117 Bacteria 2491
240 Ga0373954_0002579 3300035118 Bacteria 7612
241 Ga0373956_0026495 3300035119 Bacteria 2511
242 Ga0373957_0483589 3300035120 Bacteria 538
243 Ga0373943_0258730 3300035170 Bacteria 979
244 Ga0373955_0048328 3300035172 Bacteria 2307
245 Ga0316574_0555441 3300035398 Unclassified 712
246 Ga0373924_0269650 3300035410 Bacteria 754
247 Ga0373931_0669746 3300035691 Bacteria 683
248 Ga0373935_0147708 3300035692 Bacteria 1593
249 Ga0373935_1276555 3300035692 Unclassified 548
250 Ga0373927_0231624 3300035695 Bacteria 1214
251 Ga0373933_0020282 3300035724 Bacteria 3767
252 Ga0373937_0006226 3300036401 Bacteria 10286
253 Ga0373937_0865384 3300036401 Unclassified 852
254 Ga0373925_0646144 3300037068 Bacteria 872
255 Ga0400485_12258 3300038735 Bacteria 5567
256 Ga0400486_32878 3300038742 Bacteria 79977
257 Ga0400483_038942 3300039062 Bacteria 36270
258 Ga0400483_177182 3300039062 Bacteria 39956
259 Ga0400489_63031 3300039093 Bacteria 16147
260 Ga0436361_0733426 3300039447 Bacteria 17219
261 Ga0451800_0861818 3300041459 Bacteria 585
262 Ga0451833_0197637 3300041491 Bacteria 559
263 Ga0451845_0502081 3300041501 Bacteria 562
264 Ga0451853_2882934 3300041512 Bacteria 646
265 Ga0439456_165171 3300042013 Bacteria 519
266 Ga0466957_1016915 3300044842 Bacteria 596
267 Ga0451576_0072418 3300045051 Bacteria 3586
268 Ga0451576_1759002 3300045051 Unclassified 641
269 Ga0466967_0734690 3300045976 Bacteria 979
270 Ga0495603_0343844 3300046455 Bacteria 856
271 Ga0495641_0218814 3300046461 Bacteria 854
272 Ga0495582_0064832 3300046473 Bacteria 2018
273 Ga0495639_0234504 3300046475 Bacteria 905
274 Ga0495608_0777889 3300046511 Bacteria 566
275 Ga0495630_0243754 3300046517 Bacteria 1373
276 Ga0495665_0127326 3300046531 Bacteria 1334
277 Ga0495588_0007126 3300046674 Bacteria 5069
278 Ga0495658_0035780 3300046683 Bacteria 2735
279 Ga0495658_0167863 3300046683 Bacteria 1357
280 Ga0495613_0227570 3300046689 Bacteria 1307
281 Ga0495624_0228703 3300046690 Bacteria 1127
282 Ga0495672_0090302 3300047320 Bacteria 1684
283 Ga0495676_0805611 3300047321 Bacteria 605
284 Ga0495684_0395305 3300047471 Unclassified 972
285 Ga0496102_0103505 3300048905 Bacteria 2648
286 Ga0496102_0733030 3300048905 Bacteria 911
287 Ga0496103_0688182 3300048906 Unclassified 648
288 Ga0496104_0033209 3300048907 Bacteria 4805
289 Ga0496105_0009500 3300048908 Bacteria 7609
290 Ga0496105_0327800 3300048908 Bacteria 1226
291 Ga0496111_0979888 3300048914 Bacteria 606
292 Ga0496114_0257015 3300048917 Unclassified 1537
293 Ga0501068_1194487 3300049584 Unclassified 504
294 Ga0501076_0120063 3300049592 Bacteria 2129
295 Ga0501079_1006970 3300049741 Unclassified 656
296 Ga0501080_0060432 3300049742 Bacteria 3528
297 Ga0501081_0405422 3300049743 Bacteria 1010
298 Ga0501081_0430706 3300049743 Unclassified 979
299 Ga0501081_0476153 3300049743 Bacteria 929
300 nmdc:mga05p37_2178861_c1 3300050507 Bacteria 516
301 nmdc:mga05p37_490095_c1 3300050507 Bacteria 1413
302 nmdc:mga06r32_110570_c1 3300050510 Bacteria 2703
303 nmdc:mga06r32_1606980_c1 3300050510 Archaea 588
304 nmdc:mga0n895_225508_c1 3300050512 Bacteria 1902
305 nmdc:mga0rr50_728493_c1 3300050513 Bacteria 846
306 nmdc:mga08x19_87058_c1 3300050514 Bacteria 2057
307 nmdc:mga0a205_508545_c1 3300050515 Bacteria 1061
308 Ga0530510_0008166 3300061734 Bacteria 7301
309 Ga0530510_0116920 3300061734 Bacteria 1955
310 Ga0373929_0224867
311 Ga0065707_10133441
312 Ga0065707_10267478
313 Ga0070676_11535645
314 Ga0070683_100113068
315 Ga0070690_101196931
316 Ga0070670_100110527
317 Ga0070677_10038003
318 Ga0070666_10748467
319 Ga0070680_100202686
320 Ga0070680_101682993
321 Ga0070682_100616205
322 Ga0070682_101533578
323 Ga0068868_100007037
324 Ga0070689_101817128
325 Ga0070691_10060138
326 Ga0070668_100328995
327 Ga0070669_101170632
328 Ga0070669_101920143
329 Ga0070675_101503258
330 Ga0070671_100226077
331 Ga0070671_100861999
332 Ga0070674_100050762
333 Ga0070673_100010691
334 Ga0070673_101243647
335 Ga0070667_100099681
336 Ga0070667_100555375
337 Ga0070703_10211250
338 Ga0070714_100112285
339 Ga0070701_11242846
340 Ga0070711_100010958
341 Ga0070711_100271554
342 Ga0070705_101865873
343 Ga0070700_100542901
344 Ga0070708_100246976
345 Ga0070708_100257612
346 Ga0070663_100300054
347 Ga0070678_100412955
348 Ga0070662_101229548
349 Ga0068867_100017328
350 Ga0068867_100125746
351 Ga0070706_100026525
352 Ga0070707_100071418
353 Ga0070707_100672968
354 Ga0070707_100916674
355 Ga0070707_101499745
356 Ga0070698_100292438
357 Ga0070698_100851811
358 Ga0070698_100977330
359 Ga0070699_100002591
360 Ga0070699_101084048
361 Ga0070699_102063046
362 Ga0070679_100582305
363 Ga0070679_100726200
364 Ga0070684_100055423
365 Ga0070684_101242332
366 Ga0070697_100013100
367 Ga0070697_100135927
368 Ga0070697_100470189
369 Ga0068853_100216838
370 Ga0070686_100027045
371 Ga0070686_101854824
372 Ga0070695_100143533
373 Ga0070695_101158161
374 Ga0070696_100350526
375 Ga0070696_100399053
376 Ga0070696_100458603
377 Ga0070696_100605793
378 Ga0070696_101585659
379 Ga0070693_100013556
380 Ga0070693_100215117
381 Ga0070693_100675685
382 Ga0070665_100857966
383 Ga0070704_100015790
384 Ga0068857_100890260
385 Ga0070702_100139290
386 Ga0070702_100143925
387 Ga0068859_101286293
388 Ga0068866_10058886
389 Ga0068861_102560996
390 Ga0068861_102582515
391 Ga0068863_100067061
392 Ga0068863_101080998
393 Ga0068858_101336128
394 Ga0068858_102297868
395 Ga0068860_100437812
396 Ga0068862_100247863
397 Ga0068862_101941002
398 Ga0081455_10067556
399 Ga0081455_10161091
400 Ga0081455_10706643
401 Ga0081539_10032475
402 Ga0070717_10285608
403 Ga0070717_10288980
404 Ga0070717_10667033
405 Ga0070715_10108168
406 Ga0070715_10576637
407 Ga0070716_100587746
408 Ga0070712_100110935
409 Ga0070712_101234942
410 Ga0097621_100114570
411 Ga0068871_100186683
412 Ga0075428_100044746
413 Ga0075428_100726241
414 Ga0075431_100061327
415 Ga0075431_100355653
416 Ga0075433_10457877
417 Ga0075434_100184632
418 Ga0075436_100137405
419 Ga0097620_101286305
420 Ga0075435_101574826
421 Ga0099794_10000100
422 Ga0099794_10001789
423 Ga0099794_10161787
424 Ga0099795_10017779
425 Ga0099795_10066264
426 Ga0111539_12168359
427 Ga0105245_10607759
428 Ga0105245_11398113
429 Ga0105247_10468286
430 Ga0105247_11353195
431 Ga0114129_10482248
432 Ga0114129_11574761
433 Ga0114129_11733028
434 Ga0114129_13400315
435 Ga0105241_11548341
436 Ga0105242_10457093
437 Ga0105242_11732867
438 Ga0105248_10435186
439 Ga0105248_10657366
440 Ga0105248_11083116
441 Ga0099796_10039586
442 Ga0099796_10135378
443 Ga0099796_10175532
444 Ga0157373_10151808
445 Ga0157378_10040412
446 Ga0157378_10290984
447 Ga0163162_11315245
448 Ga0157375_11523102
449 Ga0157375_12563386
450 Ga0157377_10696754
451 Ga0157376_10125978
452 Ga0157376_11665394
453 Ga0206350_11626845
454 Ga0206354_10493068
455 Ga0224712_10499721
456 Ga0207653_10037542
457 Ga0207642_10451879
458 Ga0207710_10534855
459 Ga0207680_10698966
460 Ga0207685_10084640
461 Ga0207645_11138148
462 Ga0207684_10007431
463 Ga0207684_10178259
464 Ga0207684_10204876
465 Ga0207684_11345417
466 Ga0207684_11645456
467 Ga0207654_10903414
468 Ga0207693_10194446
469 Ga0207663_10804877
470 Ga0207660_10610976
471 Ga0207662_11369612
472 Ga0207652_10239445
473 Ga0207646_10230743
474 Ga0207646_10402452
475 Ga0207646_11251627
476 Ga0207646_11280012
477 Ga0207681_11299447
478 Ga0207650_10070483
479 Ga0207687_10976042
480 Ga0207687_11699707
481 Ga0207700_10040571
482 Ga0207700_11174325
483 Ga0207664_10144200
484 Ga0207664_11311322
485 Ga0207644_10239867
486 Ga0207644_11240168
487 Ga0207686_10629806
488 Ga0207670_11238549
489 Ga0207669_11000792
490 Ga0207704_11463628
491 Ga0207665_10350228
492 Ga0207665_10918845
493 Ga0207711_10760662
494 Ga0207661_10085188
495 Ga0207651_10163111
496 Ga0207651_11247102
497 Ga0207712_11204328
498 Ga0207668_10298328
499 Ga0207658_10381850
500 Ga0207677_10015596
501 Ga0207703_10468907
502 Ga0207708_10553028
503 Ga0207648_10008723
504 Ga0207648_10105842
505 Ga0207675_102167904
506 Ga0207683_10198683
507 Ga0209179_1002901
508 Ga0209179_1087420
509 Ga0209588_1002677
510 Ga0209588_1029636
511 Ga0209588_1157787
512 Ga0209588_1199267
513 Ga0209588_1228589
514 Ga0268266_11691002
515 Ga0268265_10153390
516 Ga0268265_10789283
517 Ga0268264_10833585
518 Ga0268264_11105120
519 Ga0265337_1007249
520 Ga0265318_10025819
521 Ga0265338_10004782
522 Ga0265332_10149470
523 Ga0265320_10000403
524 Ga0316575_10063321
525 Ga0316579_10386940
526 Ga0265314_10021583
527 Ga0316576_10158277
528 Ga0316578_10062064
529 Ga0316577_10316225
530 Ga0316577_10517995
531 Ga0316577_10729022
532 Ga0307413_11016808
533 Ga0307416_100429360
534 Ga0307416_101064804
535 Ga0307411_10168947
536 Ga0307411_12190767
537 Ga0307415_100365372
538 Ga0316583_10120798
539 Ga0316592_1182010
540 Ga0316586_1071451
541 Ga0316588_1202911
542 Ga0316587_1044668
543 Ga0316587_1110474
544 Ga0316596_1202567
545 Ga0373926_0177622
546 Ga0373934_0502721
547 Ga0373923_0007921
548 Ga0373953_0020137
549 Ga0373954_0002579
550 Ga0373956_0026495
551 Ga0373957_0483589
552 Ga0373943_0258730
553 Ga0373955_0048328
554 Ga0316574_0555441
555 Ga0373924_0269650
556 Ga0373931_0669746
557 Ga0373935_0147708
558 Ga0373935_1276555
559 Ga0373927_0231624
560 Ga0373933_0020282
561 Ga0373937_0006226
562 Ga0373937_0865384
563 Ga0373925_0646144
564 Ga0400485_12258
565 Ga0400486_32878
566 Ga0400483_038942
567 Ga0400483_177182
568 Ga0400489_63031
569 Ga0436361_0733426
570 Ga0451800_0861818
571 Ga0451833_0197637
572 Ga0451845_0502081
573 Ga0451853_2882934
574 Ga0439456_165171
575 Ga0466957_1016915
576 Ga0451576_0072418
577 Ga0451576_1759002
578 Ga0466967_0734690
579 Ga0495603_0343844
580 Ga0495641_0218814
581 Ga0495582_0064832
582 Ga0495639_0234504
583 Ga0495608_0777889
584 Ga0495630_0243754
585 Ga0495665_0127326
586 Ga0495588_0007126
587 Ga0495658_0035780
588 Ga0495658_0167863
589 Ga0495613_0227570
590 Ga0495624_0228703
591 Ga0495672_0090302
592 Ga0495676_0805611
593 Ga0495684_0395305
594 Ga0496102_0103505
595 Ga0496102_0733030
596 Ga0496103_0688182
597 Ga0496104_0033209
598 Ga0496105_0009500
599 Ga0496105_0327800
600 Ga0496111_0979888
601 Ga0496114_0257015
602 Ga0501068_1194487
603 Ga0501076_0120063
604 Ga0501079_1006970
605 Ga0501080_0060432
606 Ga0501081_0405422
607 Ga0501081_0430706
608 Ga0501081_0476153
609 nmdc:mga05p37_2178861_c1
610 nmdc:mga05p37_490095_c1
611 nmdc:mga06r32_110570_c1
612 nmdc:mga06r32_1606980_c1
613 nmdc:mga0n895_225508_c1
614 nmdc:mga0rr50_728493_c1
615 nmdc:mga08x19_87058_c1
616 nmdc:mga0a205_508545_c1
617 Ga0530510_0008166
618 Ga0530510_0116920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

20

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9324 10 75
2yj0-assembly1.cif.gz_A x-ray structure of chemically engineered mycobacterium tuberculosis dodecin 0.92 10 76
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9194 10 75
6r1e-assembly1.cif.gz_A structure of dodecin from streptomyces coelicolor 0.9156 9 76
3onr-assembly1.cif.gz_B crystal structure of the calcium chelating immunodominant antigen, calcium dodecin (rv0379),from mycobacterium tuberculosis with a novel calcium-binding site 0.9071 12 79
ID Description Score Start End Superfamily
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9127 12 79 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9058 12 75 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8926 12 75 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8869 10 76 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8758 12 79 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A2N2KFZ8-F1-model_v4 Transporter 0.9846 10 76
AF-A0A7V7CR72-F1-model_v4 Dodecin domain-containing protein 0.9777 10 76
AF-A0A847ZJQ4-F1-model_v4 deleted 0.9761 10 76
AF-A0A382JSG7-F1-model_v4 Transporter 0.9759 10 75
AF-A0A6J7AJW3-F1-model_v4 Unannotated protein 0.975 10 78

Map