F400199

General Info

Members Datasets Scaffolds Average Seq Length
309 197 309 160

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000172|Ga0105238_1000017265
Length 178
Sequence MFAAAPGPARVWRTVGEDANRELIERFYEAFGRCDGVAMSACYAPGAHFRDPAFGDLEGEEIGAMWRMLTGRATDLKIELHEHEANGDSGSAHWIARYTFSTGRPVVNDIQARFRFADGLIADHVDEFDFRRWAGQALGPMGHLVAILPPLRSKARAKARGQLDEFIAAERGGPSAQE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 11.65
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10384590 3300005327 Bacteria 1204
2 Ga0070683_100002552 3300005329 Bacteria 14543
3 Ga0070683_100085257 3300005329 Bacteria 2961
4 Ga0070666_10013293 3300005335 Bacteria 5219
5 Ga0070682_100000077 3300005337 Bacteria 89055
6 Ga0070682_100063296 3300005337 Bacteria 2345
7 Ga0070691_10000052 3300005341 Bacteria 32264
8 Ga0070691_10003786 3300005341 Bacteria 6836
9 Ga0070668_100278242 3300005347 Bacteria 1397
10 Ga0070668_100501794 3300005347 Bacteria 1050
11 Ga0070714_100185656 3300005435 Bacteria 1894
12 Ga0070710_10462809 3300005437 Bacteria 862
13 Ga0070711_101065634 3300005439 Bacteria 695
14 Ga0070663_100461990 3300005455 Bacteria 1048
15 Ga0070707_100811235 3300005468 Bacteria 900
16 Ga0070684_100010378 3300005535 Bacteria 7376
17 Ga0070684_100618271 3300005535 Bacteria 1008
18 Ga0070695_100101553 3300005545 Bacteria 1938
19 Ga0070665_100000341 3300005548 Bacteria 70565
20 Ga0070665_100119217 3300005548 Bacteria 2641
21 Ga0070704_100529493 3300005549 Bacteria 1027
22 Ga0068855_101820243 3300005563 Bacteria 618
23 Ga0070664_100125000 3300005564 Bacteria 2255
24 Ga0068854_100108538 3300005578 Bacteria 2090
25 Ga0070702_100206807 3300005615 Unclassified 1303
26 Ga0068852_101282165 3300005616 Bacteria 754
27 Ga0068864_100931246 3300005618 Bacteria 859
28 Ga0068866_10022625 3300005718 Bacteria 2911
29 Ga0068861_100142011 3300005719 Bacteria 1961
30 Ga0068861_100430838 3300005719 Bacteria 1177
31 Ga0068851_10334908 3300005834 Unclassified 877
32 Ga0068870_10771797 3300005840 Bacteria 669
33 Ga0068870_10815908 3300005840 Unclassified 653
34 Ga0068863_100004151 3300005841 Bacteria 14307
35 Ga0068858_100000251 3300005842 Bacteria 57269
36 Ga0081540_1000503 3300005983 Bacteria 38494
37 Ga0070717_10016367 3300006028 Bacteria 5749
38 Ga0075364_10471275 3300006051 Bacteria 858
39 Ga0097621_100053658 3300006237 Bacteria 3286
40 Ga0075428_100951272 3300006844 Bacteria 910
41 Ga0075430_100691100 3300006846 Bacteria 841
42 Ga0075435_101790650 3300007076 Bacteria 539
43 Ga0105240_10273259 3300009093 Bacteria 1945
44 Ga0105240_10779896 3300009093 Bacteria 1037
45 Ga0111539_10568945 3300009094 Bacteria 1320
46 Ga0111539_11494170 3300009094 Bacteria 783
47 Ga0111539_11589338 3300009094 Unclassified 758
48 Ga0105245_10000743 3300009098 Bacteria 29457
49 Ga0105245_10156499 3300009098 Unclassified 2158
50 Ga0105245_11209975 3300009098 Bacteria 803
51 Ga0114129_10676069 3300009147 Bacteria 1330
52 Ga0114129_11096951 3300009147 Bacteria 997
53 Ga0105243_10243536 3300009148 Bacteria 1601
54 Ga0105243_10477561 3300009148 Bacteria 1176
55 Ga0105242_10000708 3300009176 Bacteria 26091
56 Ga0105242_10025876 3300009176 Bacteria 4648
57 Ga0105237_10674216 3300009545 Bacteria 1041
58 Ga0105238_10000172 3300009551 Bacteria 70799
59 Ga0105249_10000371 3300009553 Bacteria 44499
60 Ga0105249_10099498 3300009553 Bacteria 2733
61 Ga0105249_11155685 3300009553 Bacteria 845
62 Ga0105239_11136209 3300010375 Bacteria 900
63 Ga0157370_10029351 3300013104 Bacteria 5399
64 Ga0157369_12349574 3300013105 Unclassified 540
65 Ga0157374_10004202 3300013296 Bacteria 12101
66 Ga0157374_10035348 3300013296 Bacteria 4572
67 Ga0157378_10013512 3300013297 Bacteria 7141
68 Ga0157375_10227244 3300013308 Bacteria 2025
69 Ga0157375_10482998 3300013308 Bacteria 1404
70 Ga0157375_10596394 3300013308 Bacteria 1264
71 Ga0163163_10321440 3300014325 Unclassified 1601
72 Ga0157380_10754015 3300014326 Bacteria 985
73 Ga0157380_11254385 3300014326 Bacteria 787
74 Ga0207680_10017569 3300025903 Bacteria 3782
75 Ga0207695_10382033 3300025913 Bacteria 1294
76 Ga0207662_10418312 3300025918 Bacteria 912
77 Ga0207649_10616203 3300025920 Unclassified 836
78 Ga0207694_10000004 3300025924 Bacteria 967075
79 Ga0207687_10000399 3300025927 Bacteria 29473
80 Ga0207687_10212501 3300025927 Unclassified 1518
81 Ga0207664_10177857 3300025929 Bacteria 1825
82 Ga0207706_10176440 3300025933 Bacteria 1877
83 Ga0207706_10432179 3300025933 Bacteria 1140
84 Ga0207706_11130885 3300025933 Bacteria 653
85 Ga0207686_10000680 3300025934 Bacteria 21047
86 Ga0207709_10209305 3300025935 Bacteria 1398
87 Ga0207709_10283625 3300025935 Bacteria 1224
88 Ga0207669_10396222 3300025937 Bacteria 1080
89 Ga0207661_10062239 3300025944 Bacteria 3019
90 Ga0207661_10913157 3300025944 Bacteria 809
91 Ga0207712_10000037 3300025961 Bacteria 195906
92 Ga0207668_10025021 3300025972 Bacteria 3859
93 Ga0207668_10464407 3300025972 Bacteria 1083
94 Ga0207668_10622274 3300025972 Bacteria 942
95 Ga0207640_10439362 3300025981 Bacteria 1072
96 Ga0207677_12147581 3300026023 Bacteria 519
97 Ga0207703_10000128 3300026035 Bacteria 91359
98 Ga0207703_10000725 3300026035 Bacteria 32432
99 Ga0207639_10066936 3300026041 Bacteria 2794
100 Ga0207678_10365750 3300026067 Bacteria 1245
101 Ga0207678_10806347 3300026067 Bacteria 829
102 Ga0207708_10060895 3300026075 Bacteria 2882
103 Ga0207641_10003183 3300026088 Bacteria 14696
104 Ga0207641_10003801 3300026088 Bacteria 13246
105 Ga0207641_10297789 3300026088 Bacteria 1523
106 Ga0207648_10036334 3300026089 Bacteria 4339
107 Ga0207676_11697182 3300026095 Unclassified 630
108 Ga0207675_100906616 3300026118 Bacteria 898
109 Ga0207683_10152658 3300026121 Bacteria 2085
110 Ga0207698_10137007 3300026142 Bacteria 2102
111 Ga0207698_10816834 3300026142 Bacteria 935
112 Ga0268266_10000020 3300028379 Bacteria 527065
113 Ga0268266_10001882 3300028379 Bacteria 23710
114 Ga0268265_10728141 3300028380 Unclassified 961
115 Ga0268264_12140918 3300028381 Bacteria 568
116 Ga0265337_1000346 3300028556 Bacteria 24820
117 Ga0265326_10000035 3300028558 Bacteria 89561
118 Ga0265319_1007033 3300028563 Bacteria 5117
119 Ga0265319_1042653 3300028563 Unclassified 1526
120 Ga0265319_1118533 3300028563 Archaea 825
121 Ga0265322_10000009 3300028654 Bacteria 170768
122 Ga0265322_10007278 3300028654 Bacteria 3237
123 Ga0265336_10010890 3300028666 Bacteria 3103
124 Ga0265338_10024037 3300028800 Bacteria 6238
125 Ga0265338_10199952 3300028800 Unclassified 1508
126 Ga0265338_10486375 3300028800 Bacteria 870
127 Ga0265324_10000389 3300029957 Bacteria 31898
128 Ga0307511_10179312 3300030521 Bacteria 1145
129 Ga0265328_10003256 3300031239 Bacteria 7197
130 Ga0265328_10218276 3300031239 Bacteria 726
131 Ga0265320_10000024 3300031240 Bacteria 170768
132 Ga0265320_10087752 3300031240 Bacteria 1444
133 Ga0265325_10056631 3300031241 Bacteria 2001
134 Ga0265325_10095702 3300031241 Unclassified 1459
135 Ga0265329_10008896 3300031242 Bacteria 3781
136 Ga0265339_10014412 3300031249 Bacteria 4764
137 Ga0265331_10009863 3300031250 Bacteria 5323
138 Ga0265331_10020998 3300031250 Bacteria 3345
139 Ga0265327_10000227 3300031251 Bacteria 114777
140 Ga0265316_10062439 3300031344 Bacteria 2891
141 Ga0307509_10015175 3300031507 Bacteria 9008
142 Ga0265313_10272562 3300031595 Unclassified 685
143 Ga0265314_10005187 3300031711 Bacteria 11830
144 Ga0265314_10112925 3300031711 Bacteria 1724
145 Ga0265342_10055707 3300031712 Bacteria 2346
146 Ga0265342_10194931 3300031712 Bacteria 1104
147 Ga0307406_10559638 3300031901 Bacteria 937
148 Ga0307409_100295064 3300031995 Bacteria 1505
149 Ga0307416_100245640 3300032002 Bacteria 1738
150 Ga0307411_10210806 3300032005 Bacteria 1500
151 Ga0307415_100486037 3300032126 Bacteria 1076
152 Ga0307415_102207532 3300032126 Bacteria 539
153 Ga0373943_0516462 3300035170 Bacteria 699
154 Ga0373955_0706848 3300035172 Bacteria 619
155 Ga0373933_0142259 3300035724 Bacteria 1515
156 Ga0373937_0016394 3300036401 Bacteria 6581
157 Ga0373925_0202004 3300037068 Bacteria 1581
158 Ga0451807_2748185 3300041486 Bacteria 2026
159 Ga0451853_1749601 3300041512 Bacteria 1532
160 Ga0439462_0114780 3300042015 Unclassified 747
161 Ga0466972_0110537 3300044658 Bacteria 1299
162 Ga0466963_0021184 3300044694 Bacteria 4097
163 Ga0466963_0048824 3300044694 Bacteria 2798
164 Ga0466967_0032046 3300045976 Bacteria 4433
165 Ga0466967_0059977 3300045976 Bacteria 3370
166 Ga0466967_0626581 3300045976 Bacteria 1062
167 Ga0495592_0138037 3300046454 Bacteria 1698
168 Ga0495603_0000271 3300046455 Bacteria 27496
169 Ga0495629_0041375 3300046459 Bacteria 3243
170 Ga0495629_0255491 3300046459 Bacteria 1205
171 Ga0495638_0017587 3300046460 Bacteria 4764
172 Ga0495641_0000001 3300046461 Bacteria 485224
173 Ga0495641_0005533 3300046461 Bacteria 8485
174 Ga0495641_0046771 3300046461 Bacteria 1989
175 Ga0495641_0130606 3300046461 Bacteria 1121
176 Ga0495653_0054472 3300046463 Bacteria 3056
177 Ga0495582_0518344 3300046473 Bacteria 689
178 Ga0495639_0009494 3300046475 Bacteria 4174
179 Ga0495606_0000057 3300046507 Bacteria 197956
180 Ga0495608_0071428 3300046511 Bacteria 2265
181 Ga0495608_0193064 3300046511 Bacteria 1285
182 Ga0495608_0274531 3300046511 Bacteria 1047
183 Ga0495618_0169868 3300046514 Bacteria 1388
184 Ga0495628_0072415 3300046516 Bacteria 2685
185 Ga0495628_0357643 3300046516 Bacteria 1072
186 Ga0495630_0000011 3300046517 Bacteria 232063
187 Ga0495630_0168045 3300046517 Bacteria 1670
188 Ga0495630_0316056 3300046517 Bacteria 1194
189 Ga0495643_0275399 3300046522 Bacteria 776
190 Ga0495652_0000003 3300046529 Bacteria 597094
191 Ga0495652_0214401 3300046529 Bacteria 1451
192 Ga0495652_0233943 3300046529 Unclassified 1372
193 Ga0495640_0018177 3300046533 Bacteria 5223
194 Ga0495586_0002960 3300046535 Bacteria 9154
195 Ga0495587_0006377 3300046536 Bacteria 7695
196 Ga0495587_0267700 3300046536 Bacteria 959
197 Ga0495645_0019363 3300046543 Bacteria 4900
198 Ga0495645_0237727 3300046543 Unclassified 1217
199 Ga0495667_0000421 3300046559 Bacteria 27190
200 Ga0495656_0002065 3300046615 Bacteria 6623
201 Ga0495634_0000214 3300046642 Bacteria 53816
202 Ga0495634_0003560 3300046642 Bacteria 12465
203 Ga0495625_0000538 3300046660 Bacteria 55712
204 Ga0495588_0000278 3300046674 Bacteria 38709
205 Ga0495657_0782040 3300046675 Bacteria 546
206 Ga0495599_0333547 3300046678 Unclassified 911
207 Ga0495647_0000046 3300046681 Bacteria 35269
208 Ga0495647_0000351 3300046681 Bacteria 12999
209 Ga0495647_0223044 3300046681 Bacteria 833
210 Ga0495647_0640107 3300046681 Bacteria 500
211 Ga0495669_0000083 3300046684 Bacteria 62876
212 Ga0495669_0200390 3300046684 Unclassified 954
213 Ga0495613_0135966 3300046689 Bacteria 1758
214 Ga0495613_0232168 3300046689 Bacteria 1292
215 Ga0495624_0000258 3300046690 Bacteria 41999
216 Ga0495624_0000307 3300046690 Bacteria 38620
217 Ga0495671_0338363 3300046692 Bacteria 722
218 Ga0495649_0463471 3300046694 Unclassified 632
219 Ga0495600_0414826 3300046809 Bacteria 836
220 Ga0495660_0267339 3300046810 Unclassified 787
221 Ga0495581_0282779 3300047315 Bacteria 970
222 Ga0495674_0001786 3300047319 Bacteria 21206
223 Ga0495672_0133656 3300047320 Bacteria 1302
224 Ga0495676_0000329 3300047321 Bacteria 38429
225 Ga0495676_0262931 3300047321 Bacteria 1173
226 Ga0495680_0000599 3300047322 Bacteria 40585
227 Ga0495680_0023375 3300047322 Bacteria 5140
228 Ga0495683_0251849 3300047323 Bacteria 775
229 Ga0495679_033096 3300047446 Bacteria 1653
230 Ga0495684_0211101 3300047471 Bacteria 1427
231 Ga0495686_0069062 3300047472 Bacteria 2179
232 Ga0495593_0307831 3300047673 Bacteria 792
233 Ga0495602_0256148 3300048088 Bacteria 1301
234 Ga0495602_0596196 3300048088 Unclassified 760
235 Ga0495602_0641643 3300048088 Unclassified 726
236 Ga0496100_0000007 3300048903 Bacteria 261266
237 Ga0496100_0877809 3300048903 Bacteria 704
238 Ga0496101_0000013 3300048904 Bacteria 261266
239 Ga0496101_1575223 3300048904 Bacteria 511
240 Ga0496102_0000045 3300048905 Bacteria 186726
241 Ga0496102_0026043 3300048905 Bacteria 5212
242 Ga0496103_0000050 3300048906 Bacteria 152034
243 Ga0496104_0000002 3300048907 Bacteria 686017
244 Ga0496104_0000013 3300048907 Bacteria 397163
245 Ga0496104_0003112 3300048907 Bacteria 14308
246 Ga0496104_0075948 3300048907 Bacteria 3200
247 Ga0496104_0676107 3300048907 Bacteria 941
248 Ga0496105_0000001 3300048908 Bacteria 1328178
249 Ga0496105_0000006 3300048908 Bacteria 393578
250 Ga0496105_0000351 3300048908 Bacteria 30325
251 Ga0496105_0053786 3300048908 Bacteria 3325
252 Ga0496105_0435780 3300048908 Bacteria 1036
253 Ga0496106_0000006 3300048909 Bacteria 251855
254 Ga0496106_0120134 3300048909 Bacteria 2053
255 Ga0496107_0000007 3300048910 Bacteria 257113
256 Ga0496107_0141803 3300048910 Bacteria 1776
257 Ga0496107_0167660 3300048910 Bacteria 1629
258 Ga0496107_0688829 3300048910 Bacteria 752
259 Ga0496108_0000001 3300048911 Bacteria 919044
260 Ga0496108_0000395 3300048911 Bacteria 36064
261 Ga0496108_0097259 3300048911 Bacteria 2508
262 Ga0496109_0000006 3300048912 Bacteria 325513
263 Ga0496109_0000131 3300048912 Bacteria 76860
264 Ga0496109_0408097 3300048912 Bacteria 1284
265 Ga0496111_0177059 3300048914 Bacteria 1585
266 Ga0496113_0070791 3300048916 Bacteria 2652
267 Ga0496113_0087503 3300048916 Bacteria 2396
268 Ga0496114_0029984 3300048917 Bacteria 4473
269 Ga0496115_0002603 3300048918 Bacteria 12948
270 Ga0496115_0094785 3300048918 Bacteria 2442
271 Ga0496118_0080426 3300048921 Bacteria 2294
272 Ga0496118_0134945 3300048921 Bacteria 1577
273 Ga0496119_0008767 3300048922 Bacteria 8815
274 Ga0496119_0296808 3300048922 Bacteria 798
275 Ga0496120_0063208 3300048923 Bacteria 2060
276 Ga0496120_0066904 3300048923 Bacteria 1986
277 Ga0496121_0010365 3300048924 Bacteria 10526
278 Ga0496121_0099493 3300048924 Bacteria 2247
279 Ga0496121_0192480 3300048924 Bacteria 1461
280 Ga0496125_0010613 3300048928 Bacteria 9304
281 Ga0496125_0042850 3300048928 Bacteria 3849
282 Ga0501042_0285350 3300049578 Bacteria 1192
283 Ga0501042_0393842 3300049578 Bacteria 1003
284 Ga0501042_0898269 3300049578 Bacteria 645
285 Ga0501079_0390200 3300049741 Bacteria 1092
286 Ga0501080_0354645 3300049742 Bacteria 1324
287 nmdc:mga00v17_843334_c1 3300050491 Bacteria 582
288 nmdc:mga05p37_1672019_c1 3300050507 Bacteria 622
289 nmdc:mga05p37_887550_c1 3300050507 Unclassified 963
290 nmdc:mga0qj67_83474_c1 3300050509 Bacteria 2561
291 nmdc:mga0n895_895395_c1 3300050512 Bacteria 873
292 Ga0495601_0001909 3300053077 Bacteria 11654
293 Ga0495601_0029714 3300053077 Bacteria 3392
294 Ga0495601_0042288 3300053077 Bacteria 2858
295 Ga0495601_0152199 3300053077 Bacteria 1510
296 Ga0495601_0234600 3300053077 Bacteria 1198
297 Ga0495601_0954451 3300053077 Bacteria 540
298 Ga0495612_0007999 3300053078 Bacteria 4305
299 Ga0495612_0120706 3300053078 Bacteria 1127
300 Ga0495612_0181030 3300053078 Bacteria 925
301 Ga0495655_0000004 3300053083 Bacteria 293683
302 Ga0495595_0382975 3300053084 Bacteria 712
303 Ga0495619_0000042 3300053085 Bacteria 112453
304 Ga0495619_0264693 3300053085 Bacteria 1191
305 Ga0500566_0012144 3300053094 Bacteria 5070
306 Ga0500595_049030 3300053119 Unclassified 1317
307 Ga0500614_000782 3300053123 Bacteria 8063
308 Ga0500628_000004 3300053129 Bacteria 202098
309 Ga0530510_1109445 3300061734 Bacteria 606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_1575223 Ga0496101_1575223_94_495 128
2 3300046517 Ga0495630_0316056 Ga0495630_0316056_19_420 129
3 3300053077 Ga0495601_0954451 Ga0495601_0954451_129_530 129
4 3300005347 Ga0070668_100501794 Ga0070668_1005017942 133
5 3300028800 Ga0265338_10486375 Ga0265338_104863752 134
6 3300005437 Ga0070710_10462809 Ga0070710_104628092 145
7 3300013105 Ga0157369_12349574 Ga0157369_123495742 145
8 3300025933 Ga0207706_10176440 Ga0207706_101764403 145
9 3300026088 Ga0207641_10297789 Ga0207641_102977892 145
10 3300048903 Ga0496100_0877809 Ga0496100_0877809_94_552 145
11 3300048907 Ga0496104_0075948 Ga0496104_0075948_517_975 145
12 3300048908 Ga0496105_0053786 Ga0496105_0053786_2844_3302 145
13 3300048910 Ga0496107_0167660 Ga0496107_0167660_268_726 145
14 3300048911 Ga0496108_0097259 Ga0496108_0097259_518_976 145
15 3300048914 Ga0496111_0177059 Ga0496111_0177059_1038_1496 145
16 3300048916 Ga0496113_0070791 Ga0496113_0070791_160_618 145
17 3300005468 Ga0070707_100811235 Ga0070707_1008112352 147
18 3300005563 Ga0068855_101820243 Ga0068855_1018202431 147
19 3300032126 Ga0307415_102207532 Ga0307415_1022075321 147
20 3300005439 Ga0070711_101065634 Ga0070711_1010656341 148
21 3300005549 Ga0070704_100529493 Ga0070704_1005294931 148
22 3300028381 Ga0268264_12140918 Ga0268264_121409181 148
23 3300037068 Ga0373925_0202004 Ga0373925_0202004_799_1266 148
24 3300046681 Ga0495647_0223044 Ga0495647_0223044_132_599 148
25 3300046681 Ga0495647_0640107 Ga0495647_0640107_15_485 148
26 3300046692 Ga0495671_0338363 Ga0495671_0338363_202_669 148
27 3300047315 Ga0495581_0282779 Ga0495581_0282779_491_958 148
28 3300047323 Ga0495683_0251849 Ga0495683_0251849_14_481 148
29 3300048910 Ga0496107_0688829 Ga0496107_0688829_162_629 148
30 3300048911 Ga0496108_0000395 Ga0496108_0000395_27017_27505 148
31 3300048912 Ga0496109_0000131 Ga0496109_0000131_3926_4414 148
32 3300005840 Ga0068870_10771797 Ga0068870_107717972 149
33 3300006051 Ga0075364_10471275 Ga0075364_104712752 149
34 3300035170 Ga0373943_0516462 Ga0373943_0516462_169_636 149
35 3300045976 Ga0466967_0059977 Ga0466967_0059977_1771_2232 149
36 3300046511 Ga0495608_0193064 Ga0495608_0193064_555_1022 149
37 3300046675 Ga0495657_0782040 Ga0495657_0782040_54_521 149
38 3300049578 Ga0501042_0898269 Ga0501042_0898269_91_543 149
39 3300049741 Ga0501079_0390200 Ga0501079_0390200_530_1009 149
40 3300050491 nmdc:mga00v17_843334_c1 nmdc:mga00v17_843334_c1_25_504 149
41 3300053084 Ga0495595_0382975 Ga0495595_0382975_167_634 149
42 3300005455 Ga0070663_100461990 Ga0070663_1004619902 150
43 3300009147 Ga0114129_11096951 Ga0114129_110969512 150
44 3300026067 Ga0207678_10806347 Ga0207678_108063471 150
45 3300026095 Ga0207676_11697182 Ga0207676_116971822 150
46 3300026118 Ga0207675_100906616 Ga0207675_1009066162 150
47 3300028380 Ga0268265_10728141 Ga0268265_107281412 150
48 3300042015 Ga0439462_0114780 Ga0439462_0114780_265_735 150
49 3300044694 Ga0466963_0021184 Ga0466963_0021184_3477_3941 150
50 3300044694 Ga0466963_0048824 Ga0466963_0048824_719_1183 150
51 3300045976 Ga0466967_0032046 Ga0466967_0032046_3761_4225 150
52 3300045976 Ga0466967_0626581 Ga0466967_0626581_390_854 150
53 3300046461 Ga0495641_0046771 Ga0495641_0046771_1070_1546 150
54 3300047673 Ga0495593_0307831 Ga0495593_0307831_185_661 150
55 3300050507 nmdc:mga05p37_887550_c1 nmdc:mga05p37_887550_c1_134_604 150
56 3300009553 Ga0105249_11155685 Ga0105249_111556852 151
57 3300025933 Ga0207706_11130885 Ga0207706_111308852 151
58 3300005329 Ga0070683_100002552 Ga0070683_10000255212 152
59 3300005337 Ga0070682_100000077 Ga0070682_1000000777 152
60 3300005435 Ga0070714_100185656 Ga0070714_1001856562 152
61 3300005535 Ga0070684_100010378 Ga0070684_1000103788 152
62 3300005535 Ga0070684_100618271 Ga0070684_1006182711 152
63 3300005548 Ga0070665_100000341 Ga0070665_10000034123 152
64 3300005718 Ga0068866_10022625 Ga0068866_100226252 152
65 3300005719 Ga0068861_100142011 Ga0068861_1001420112 152
66 3300005840 Ga0068870_10815908 Ga0068870_108159082 152
67 3300005842 Ga0068858_100000251 Ga0068858_10000025134 152
68 3300006028 Ga0070717_10016367 Ga0070717_100163674 152
69 3300006844 Ga0075428_100951272 Ga0075428_1009512721 152
70 3300006846 Ga0075430_100691100 Ga0075430_1006911002 152
71 3300007076 Ga0075435_101790650 Ga0075435_1017906501 152
72 3300009094 Ga0111539_10568945 Ga0111539_105689452 152
73 3300009094 Ga0111539_11589338 Ga0111539_115893382 152
74 3300009098 Ga0105245_10000743 Ga0105245_1000074330 152
75 3300009148 Ga0105243_10477561 Ga0105243_104775612 152
76 3300009551 Ga0105238_10000172 Ga0105238_1000017265 152
77 3300009553 Ga0105249_10000371 Ga0105249_1000037137 152
78 3300013296 Ga0157374_10004202 Ga0157374_100042029 152
79 3300013296 Ga0157374_10035348 Ga0157374_100353484 152
80 3300013308 Ga0157375_10227244 Ga0157375_102272443 152
81 3300025918 Ga0207662_10418312 Ga0207662_104183122 152
82 3300025920 Ga0207649_10616203 Ga0207649_106162032 152
83 3300025924 Ga0207694_10000004 Ga0207694_10000004949 152
84 3300025927 Ga0207687_10000399 Ga0207687_1000039930 152
85 3300025929 Ga0207664_10177857 Ga0207664_101778572 152
86 3300025933 Ga0207706_10432179 Ga0207706_104321791 152
87 3300025935 Ga0207709_10209305 Ga0207709_102093052 152
88 3300025937 Ga0207669_10396222 Ga0207669_103962222 152
89 3300025944 Ga0207661_10913157 Ga0207661_109131571 152
90 3300025961 Ga0207712_10000037 Ga0207712_10000037181 152
91 3300025972 Ga0207668_10025021 Ga0207668_100250214 152
92 3300026035 Ga0207703_10000128 Ga0207703_1000012819 152
93 3300026041 Ga0207639_10066936 Ga0207639_100669362 152
94 3300026075 Ga0207708_10060895 Ga0207708_100608954 152
95 3300026088 Ga0207641_10003801 Ga0207641_100038017 152
96 3300026089 Ga0207648_10036334 Ga0207648_100363346 152
97 3300028379 Ga0268266_10000020 Ga0268266_10000020441 152
98 3300028556 Ga0265337_1000346 Ga0265337_100034617 152
99 3300028558 Ga0265326_10000035 Ga0265326_1000003516 152
100 3300028654 Ga0265322_10000009 Ga0265322_1000000997 152
101 3300029957 Ga0265324_10000389 Ga0265324_1000038931 152
102 3300030521 Ga0307511_10179312 Ga0307511_101793122 152
103 3300031239 Ga0265328_10003256 Ga0265328_100032568 152
104 3300031240 Ga0265320_10000024 Ga0265320_1000002478 152
105 3300031242 Ga0265329_10008896 Ga0265329_100088965 152
106 3300031249 Ga0265339_10014412 Ga0265339_100144126 152
107 3300031250 Ga0265331_10020998 Ga0265331_100209985 152
108 3300031251 Ga0265327_10000227 Ga0265327_1000022779 152
109 3300031344 Ga0265316_10062439 Ga0265316_100624393 152
110 3300031507 Ga0307509_10015175 Ga0307509_100151752 152
111 3300031595 Ga0265313_10272562 Ga0265313_102725621 152
112 3300031711 Ga0265314_10005187 Ga0265314_100051879 152
113 3300031712 Ga0265342_10055707 Ga0265342_100557076 152
114 3300031995 Ga0307409_100295064 Ga0307409_1002950642 152
115 3300032002 Ga0307416_100245640 Ga0307416_1002456404 152
116 3300032005 Ga0307411_10210806 Ga0307411_102108063 152
117 3300032126 Ga0307415_100486037 Ga0307415_1004860372 152
118 3300035172 Ga0373955_0706848 Ga0373955_0706848_28_513 152
119 3300035724 Ga0373933_0142259 Ga0373933_0142259_460_948 152
120 3300036401 Ga0373937_0016394 Ga0373937_0016394_5817_6305 152
121 3300046454 Ga0495592_0138037 Ga0495592_0138037_1022_1507 152
122 3300046455 Ga0495603_0000271 Ga0495603_0000271_22770_23255 152
123 3300046459 Ga0495629_0255491 Ga0495629_0255491_105_590 152
124 3300046461 Ga0495641_0000001 Ga0495641_0000001_460710_461198 152
125 3300046461 Ga0495641_0130606 Ga0495641_0130606_392_877 152
126 3300046473 Ga0495582_0518344 Ga0495582_0518344_23_508 152
127 3300046475 Ga0495639_0009494 Ga0495639_0009494_2668_3156 152
128 3300046511 Ga0495608_0071428 Ga0495608_0071428_1655_2143 152
129 3300046516 Ga0495628_0072415 Ga0495628_0072415_1755_2240 152
130 3300046517 Ga0495630_0168045 Ga0495630_0168045_429_917 152
131 3300046522 Ga0495643_0275399 Ga0495643_0275399_11_499 152
132 3300046535 Ga0495586_0002960 Ga0495586_0002960_739_1227 152
133 3300046543 Ga0495645_0019363 Ga0495645_0019363_3866_4351 152
134 3300046543 Ga0495645_0237727 Ga0495645_0237727_82_570 152
135 3300046559 Ga0495667_0000421 Ga0495667_0000421_10327_10812 152
136 3300046615 Ga0495656_0002065 Ga0495656_0002065_33_518 152
137 3300046642 Ga0495634_0000214 Ga0495634_0000214_33319_33795 152
138 3300046642 Ga0495634_0003560 Ga0495634_0003560_6360_6845 152
139 3300046681 Ga0495647_0000046 Ga0495647_0000046_32187_32675 152
140 3300046684 Ga0495669_0000083 Ga0495669_0000083_59673_60161 152
141 3300046684 Ga0495669_0200390 Ga0495669_0200390_312_800 152
142 3300046689 Ga0495613_0232168 Ga0495613_0232168_582_1070 152
143 3300046690 Ga0495624_0000307 Ga0495624_0000307_33941_34429 152
144 3300046694 Ga0495649_0463471 Ga0495649_0463471_96_584 152
145 3300046809 Ga0495600_0414826 Ga0495600_0414826_259_747 152
146 3300047320 Ga0495672_0133656 Ga0495672_0133656_20_508 152
147 3300047321 Ga0495676_0000329 Ga0495676_0000329_35181_35669 152
148 3300047322 Ga0495680_0000599 Ga0495680_0000599_2562_3050 152
149 3300047322 Ga0495680_0023375 Ga0495680_0023375_2669_3154 152
150 3300047446 Ga0495679_033096 Ga0495679_033096_806_1294 152
151 3300047471 Ga0495684_0211101 Ga0495684_0211101_741_1226 152
152 3300048088 Ga0495602_0256148 Ga0495602_0256148_48_533 152
153 3300048088 Ga0495602_0596196 Ga0495602_0596196_15_503 152
154 3300048088 Ga0495602_0641643 Ga0495602_0641643_154_639 152
155 3300048903 Ga0496100_0000007 Ga0496100_0000007_254478_254966 152
156 3300048904 Ga0496101_0000013 Ga0496101_0000013_254478_254966 152
157 3300048907 Ga0496104_0000013 Ga0496104_0000013_6377_6865 152
158 3300048907 Ga0496104_0676107 Ga0496104_0676107_418_903 152
159 3300048908 Ga0496105_0000006 Ga0496105_0000006_390299_390787 152
160 3300048908 Ga0496105_0435780 Ga0496105_0435780_299_784 152
161 3300048909 Ga0496106_0000006 Ga0496106_0000006_248617_249105 152
162 3300048909 Ga0496106_0120134 Ga0496106_0120134_531_1025 152
163 3300048910 Ga0496107_0000007 Ga0496107_0000007_248619_249107 152
164 3300048910 Ga0496107_0141803 Ga0496107_0141803_1019_1513 152
165 3300048911 Ga0496108_0000001 Ga0496108_0000001_18618_19106 152
166 3300048912 Ga0496109_0000006 Ga0496109_0000006_18618_19106 152
167 3300048912 Ga0496109_0408097 Ga0496109_0408097_105_590 152
168 3300048916 Ga0496113_0087503 Ga0496113_0087503_1649_2134 152
169 3300048917 Ga0496114_0029984 Ga0496114_0029984_1075_1563 152
170 3300048918 Ga0496115_0094785 Ga0496115_0094785_1599_2090 152
171 3300048928 Ga0496125_0042850 Ga0496125_0042850_2897_3385 152
172 3300053077 Ga0495601_0001909 Ga0495601_0001909_2082_2570 152
173 3300053077 Ga0495601_0234600 Ga0495601_0234600_693_1178 152
174 3300053078 Ga0495612_0007999 Ga0495612_0007999_511_996 152
175 3300053078 Ga0495612_0120706 Ga0495612_0120706_255_740 152
176 3300053078 Ga0495612_0181030 Ga0495612_0181030_315_800 152
177 3300053085 Ga0495619_0264693 Ga0495619_0264693_180_656 152
178 3300053123 Ga0500614_000782 Ga0500614_000782_6611_7099 152
179 3300061734 Ga0530510_1109445 Ga0530510_1109445_42_527 152
180 3300005335 Ga0070666_10013293 Ga0070666_100132935 153
181 3300005341 Ga0070691_10000052 Ga0070691_1000005222 153
182 3300005341 Ga0070691_10003786 Ga0070691_100037867 153
183 3300005347 Ga0070668_100278242 Ga0070668_1002782422 153
184 3300005545 Ga0070695_100101553 Ga0070695_1001015533 153
185 3300005548 Ga0070665_100119217 Ga0070665_1001192173 153
186 3300005615 Ga0070702_100206807 Ga0070702_1002068072 153
187 3300005719 Ga0068861_100430838 Ga0068861_1004308382 153
188 3300005834 Ga0068851_10334908 Ga0068851_103349081 153
189 3300005841 Ga0068863_100004151 Ga0068863_1000041513 153
190 3300005983 Ga0081540_1000503 Ga0081540_100050322 153
191 3300006237 Ga0097621_100053658 Ga0097621_1000536582 153
192 3300009093 Ga0105240_10273259 Ga0105240_102732593 153
193 3300009093 Ga0105240_10779896 Ga0105240_107798962 153
194 3300009094 Ga0111539_11494170 Ga0111539_114941702 153
195 3300009098 Ga0105245_10156499 Ga0105245_101564992 153
196 3300009147 Ga0114129_10676069 Ga0114129_106760691 153
197 3300009176 Ga0105242_10000708 Ga0105242_1000070816 153
198 3300009176 Ga0105242_10025876 Ga0105242_100258763 153
199 3300009545 Ga0105237_10674216 Ga0105237_106742162 153
200 3300009553 Ga0105249_10099498 Ga0105249_100994982 153
201 3300013104 Ga0157370_10029351 Ga0157370_100293515 153
202 3300013297 Ga0157378_10013512 Ga0157378_100135123 153
203 3300013308 Ga0157375_10482998 Ga0157375_104829982 153
204 3300013308 Ga0157375_10596394 Ga0157375_105963941 153
205 3300014325 Ga0163163_10321440 Ga0163163_103214401 153
206 3300014326 Ga0157380_10754015 Ga0157380_107540151 153
207 3300025903 Ga0207680_10017569 Ga0207680_100175693 153
208 3300025913 Ga0207695_10382033 Ga0207695_103820332 153
209 3300025927 Ga0207687_10212501 Ga0207687_102125012 153
210 3300025934 Ga0207686_10000680 Ga0207686_1000068018 153
211 3300025972 Ga0207668_10464407 Ga0207668_104644072 153
212 3300025972 Ga0207668_10622274 Ga0207668_106222742 153
213 3300026023 Ga0207677_12147581 Ga0207677_121475811 153
214 3300026035 Ga0207703_10000725 Ga0207703_1000072529 153
215 3300026067 Ga0207678_10365750 Ga0207678_103657502 153
216 3300026088 Ga0207641_10003183 Ga0207641_100031835 153
217 3300026121 Ga0207683_10152658 Ga0207683_101526583 153
218 3300026142 Ga0207698_10137007 Ga0207698_101370072 153
219 3300028379 Ga0268266_10001882 Ga0268266_100018824 153
220 3300028563 Ga0265319_1007033 Ga0265319_10070335 153
221 3300028563 Ga0265319_1042653 Ga0265319_10426531 153
222 3300028563 Ga0265319_1118533 Ga0265319_11185331 153
223 3300028654 Ga0265322_10007278 Ga0265322_100072782 153
224 3300028666 Ga0265336_10010890 Ga0265336_100108903 153
225 3300028800 Ga0265338_10024037 Ga0265338_100240373 153
226 3300028800 Ga0265338_10199952 Ga0265338_101999522 153
227 3300031239 Ga0265328_10218276 Ga0265328_102182762 153
228 3300031240 Ga0265320_10087752 Ga0265320_100877522 153
229 3300031241 Ga0265325_10056631 Ga0265325_100566312 153
230 3300031241 Ga0265325_10095702 Ga0265325_100957021 153
231 3300031250 Ga0265331_10009863 Ga0265331_100098635 153
232 3300031711 Ga0265314_10112925 Ga0265314_101129253 153
233 3300031712 Ga0265342_10194931 Ga0265342_101949312 153
234 3300031901 Ga0307406_10559638 Ga0307406_105596382 153
235 3300041486 Ga0451807_2748185 Ga0451807_2748185_1406_1894 153
236 3300041512 Ga0451853_1749601 Ga0451853_1749601_540_1028 153
237 3300044658 Ga0466972_0110537 Ga0466972_0110537_71_571 153
238 3300046459 Ga0495629_0041375 Ga0495629_0041375_596_1084 153
239 3300046460 Ga0495638_0017587 Ga0495638_0017587_2784_3275 153
240 3300046461 Ga0495641_0005533 Ga0495641_0005533_6910_7398 153
241 3300046463 Ga0495653_0054472 Ga0495653_0054472_1484_1972 153
242 3300046507 Ga0495606_0000057 Ga0495606_0000057_177939_178427 153
243 3300046511 Ga0495608_0274531 Ga0495608_0274531_41_529 153
244 3300046514 Ga0495618_0169868 Ga0495618_0169868_539_1027 153
245 3300046516 Ga0495628_0357643 Ga0495628_0357643_290_778 153
246 3300046517 Ga0495630_0000011 Ga0495630_0000011_65816_66304 153
247 3300046529 Ga0495652_0000003 Ga0495652_0000003_267332_267820 153
248 3300046529 Ga0495652_0214401 Ga0495652_0214401_569_1057 153
249 3300046529 Ga0495652_0233943 Ga0495652_0233943_221_700 153
250 3300046533 Ga0495640_0018177 Ga0495640_0018177_1039_1527 153
251 3300046536 Ga0495587_0006377 Ga0495587_0006377_1319_1807 153
252 3300046536 Ga0495587_0267700 Ga0495587_0267700_227_715 153
253 3300046660 Ga0495625_0000538 Ga0495625_0000538_2614_3102 153
254 3300046674 Ga0495588_0000278 Ga0495588_0000278_19555_20043 153
255 3300046678 Ga0495599_0333547 Ga0495599_0333547_39_518 153
256 3300046681 Ga0495647_0000351 Ga0495647_0000351_1016_1504 153
257 3300046689 Ga0495613_0135966 Ga0495613_0135966_947_1435 153
258 3300046690 Ga0495624_0000258 Ga0495624_0000258_38195_38683 153
259 3300046810 Ga0495660_0267339 Ga0495660_0267339_69_557 153
260 3300047319 Ga0495674_0001786 Ga0495674_0001786_11018_11506 153
261 3300047321 Ga0495676_0262931 Ga0495676_0262931_172_660 153
262 3300047472 Ga0495686_0069062 Ga0495686_0069062_379_867 153
263 3300048905 Ga0496102_0000045 Ga0496102_0000045_13667_14155 153
264 3300048905 Ga0496102_0026043 Ga0496102_0026043_110_598 153
265 3300048906 Ga0496103_0000050 Ga0496103_0000050_137878_138366 153
266 3300048907 Ga0496104_0000002 Ga0496104_0000002_406382_406870 153
267 3300048907 Ga0496104_0003112 Ga0496104_0003112_6139_6627 153
268 3300048908 Ga0496105_0000001 Ga0496105_0000001_921309_921797 153
269 3300048908 Ga0496105_0000351 Ga0496105_0000351_18864_19352 153
270 3300048918 Ga0496115_0002603 Ga0496115_0002603_12337_12825 153
271 3300048921 Ga0496118_0080426 Ga0496118_0080426_1562_2050 153
272 3300048921 Ga0496118_0134945 Ga0496118_0134945_881_1369 153
273 3300048922 Ga0496119_0008767 Ga0496119_0008767_341_829 153
274 3300048922 Ga0496119_0296808 Ga0496119_0296808_216_704 153
275 3300048923 Ga0496120_0063208 Ga0496120_0063208_958_1446 153
276 3300048923 Ga0496120_0066904 Ga0496120_0066904_1083_1571 153
277 3300048924 Ga0496121_0010365 Ga0496121_0010365_3426_3914 153
278 3300048924 Ga0496121_0099493 Ga0496121_0099493_471_959 153
279 3300048924 Ga0496121_0192480 Ga0496121_0192480_700_1188 153
280 3300048928 Ga0496125_0010613 Ga0496125_0010613_2241_2729 153
281 3300049578 Ga0501042_0285350 Ga0501042_0285350_72_560 153
282 3300049578 Ga0501042_0393842 Ga0501042_0393842_245_733 153
283 3300049742 Ga0501080_0354645 Ga0501080_0354645_521_1009 153
284 3300050507 nmdc:mga05p37_1672019_c1 nmdc:mga05p37_1672019_c1_31_540 153
285 3300050509 nmdc:mga0qj67_83474_c1 nmdc:mga0qj67_83474_c1_1916_2404 153
286 3300050512 nmdc:mga0n895_895395_c1 nmdc:mga0n895_895395_c1_88_576 153
287 3300053077 Ga0495601_0029714 Ga0495601_0029714_1064_1552 153
288 3300053077 Ga0495601_0042288 Ga0495601_0042288_530_1018 153
289 3300053077 Ga0495601_0152199 Ga0495601_0152199_966_1454 153
290 3300053083 Ga0495655_0000004 Ga0495655_0000004_211147_211635 153
291 3300053085 Ga0495619_0000042 Ga0495619_0000042_76584_77072 153
292 3300053094 Ga0500566_0012144 Ga0500566_0012144_2141_2629 153
293 3300053119 Ga0500595_049030 Ga0500595_049030_582_1070 153
294 3300053129 Ga0500628_000004 Ga0500628_000004_119562_120050 153
295 3300005327 Ga0070658_10384590 Ga0070658_103845902 154
296 3300005329 Ga0070683_100085257 Ga0070683_1000852575 154
297 3300005337 Ga0070682_100063296 Ga0070682_1000632964 154
298 3300005564 Ga0070664_100125000 Ga0070664_1001250002 154
299 3300005578 Ga0068854_100108538 Ga0068854_1001085382 154
300 3300005616 Ga0068852_101282165 Ga0068852_1012821652 154
301 3300005618 Ga0068864_100931246 Ga0068864_1009312462 154
302 3300009098 Ga0105245_11209975 Ga0105245_112099752 154
303 3300009148 Ga0105243_10243536 Ga0105243_102435362 154
304 3300010375 Ga0105239_11136209 Ga0105239_111362092 154
305 3300014326 Ga0157380_11254385 Ga0157380_112543851 154
306 3300025935 Ga0207709_10283625 Ga0207709_102836252 154
307 3300025944 Ga0207661_10062239 Ga0207661_100622393 154
308 3300025981 Ga0207640_10439362 Ga0207640_104393622 154
309 3300026142 Ga0207698_10816834 Ga0207698_108168342 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

24

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fzw-assembly1.cif.gz_B crystal structure of ketosteroid isomerase d40n-d103n from pseudomonas putida (pksi) with bound equilenin 0.85 2 109
7rxf-assembly1.cif.gz_B multi-conformer model of apo ketosteroid isomerase y57f mutant from pseudomonas putida (pksi) at 250 k 0.8487 2 109
4pej-assembly2.cif.gz_B crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8479 4 109
5g2g-assembly1.cif.gz_B crystal structure of ketosteroid isomerase containing m116k mutation in the equilenin-bound form 0.8464 2 109
6f54-assembly2.cif.gz_B crystal structure of ketosteroid isomerase triple variant v88i/l99vd103s 0.8445 2 110
ID Description Score Start End Superfamily
4rzmB02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8318 4 109 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8119 4 110 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8061 2 119 3.10.450.50
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7999 5 116 3.10.450.50
5aiiN00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7997 4 118 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A660L3I9-F1-model_v4 Ketosteroid isomerase-like protein 0.9897 5 148 GO:0016853
AF-A0A2Z4FIP5-F1-model_v4 Uncharacterized protein 0.9744 2 154
AF-A0A1M6M4B5-F1-model_v4 Ketosteroid isomerase-related protein 0.9725 3 150 GO:0016853
AF-A0A4R6F516-F1-model_v4 Ketosteroid isomerase-like protein 0.9689 3 151 GO:0016853
AF-A0A2M7G4A1-F1-model_v4 SnoaL-like domain-containing protein 0.9684 2 149

Feature Viewer

pLDDT pTM Quality
91.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map