F400179

General Info

Members Datasets Scaffolds Average Seq Length
309 160 618 317

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10307565|Ga0114129_103075652
Length 327
Sequence MLTDPNLIIVASFVGVLVFVLGAYWAFVVMPEQRGQGAVRRRLKWESNDGSDSGAIQLLKKQQVLSTIGSLNDILKRSEGVSRPLTELIEQAGINLTVGTFMLITLTAFLGGLVLMQAYSGIWWLSFIAAAIAGVAPIVVVRIIRKNRILKFEEQFPEAIQLIARALRAGHAFSTGLKMAAEELPEPCGLEFKGLFDQQNYGAPLPDALRAFANRIPSLDARFFVTAVLTQREAGGNLAEVLDRLAAVMRERFRIKREVRVKSAHGRITAFVLAGMPPVLAFLMLSTNPEAVKLLTTDPLGLKMIALGVTLQVVGTLIVRKIADIKY

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 1.94
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 7.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10307565 3300009147 Unclassified 2111
2 SwRhRL2b_contig_1842440 2162886007 Bacteria 2131
3 JGI24751J29686_10006837 3300002459 Unclassified 2326
4 rootH1_10088998 3300003323 Bacteria 1268
5 Ga0065704_10076763 3300005289 Bacteria 4986
6 Ga0065712_10001441 3300005290 Bacteria 7553
7 Ga0065712_10088972 3300005290 Bacteria 2493
8 Ga0065715_10000419 3300005293 Bacteria 16898
9 Ga0065715_10210594 3300005293 Bacteria 1316
10 Ga0065707_10001984 3300005295 Bacteria 7803
11 Ga0065707_10022036 3300005295 Bacteria 1286
12 Ga0065707_10087488 3300005295 Bacteria 5005
13 Ga0070676_10096580 3300005328 Bacteria 1819
14 Ga0070670_100026171 3300005331 Bacteria 5022
15 Ga0070670_100037278 3300005331 Bacteria 4184
16 Ga0070670_100115530 3300005331 Bacteria 2314
17 Ga0068869_100381480 3300005334 Bacteria 1155
18 Ga0070680_100042489 3300005336 Unclassified 3689
19 Ga0068868_100311584 3300005338 Bacteria 1339
20 Ga0070689_100192136 3300005340 Bacteria 1663
21 Ga0070692_10033548 3300005345 Bacteria 2587
22 Ga0070668_100060788 3300005347 Unclassified 2927
23 Ga0070669_100005894 3300005353 Bacteria 8841
24 Ga0070669_100444176 3300005353 Bacteria 1068
25 Ga0070675_100002286 3300005354 Bacteria 14212
26 Ga0070675_100119837 3300005354 Unclassified 2235
27 Ga0070688_100036513 3300005365 Bacteria 2989
28 Ga0070688_100050961 3300005365 Bacteria 2581
29 Ga0070688_100064030 3300005365 Bacteria 2332
30 Ga0070700_100010439 3300005441 Bacteria 5129
31 Ga0070700_100021099 3300005441 Bacteria 3783
32 Ga0070694_100012137 3300005444 Bacteria 5351
33 Ga0070708_100067039 3300005445 Bacteria 3222
34 Ga0070662_100099321 3300005457 Bacteria 2200
35 Ga0070681_10521805 3300005458 Unclassified 1101
36 Ga0068867_100006092 3300005459 Bacteria 8539
37 Ga0068867_100038576 3300005459 Bacteria 3478
38 Ga0068867_100221793 3300005459 Unclassified 1524
39 Ga0070685_10097006 3300005466 Bacteria 1794
40 Ga0070698_100010102 3300005471 Bacteria 10081
41 Ga0070698_100065494 3300005471 Bacteria 3659
42 Ga0070699_100001936 3300005518 Bacteria 18690
43 Ga0070699_100013705 3300005518 Bacteria 6975
44 Ga0070684_100178878 3300005535 Bacteria 1928
45 Ga0070672_100029915 3300005543 Bacteria 4088
46 Ga0070695_100348929 3300005545 Bacteria 1108
47 Ga0070696_100020353 3300005546 Bacteria 4498
48 Ga0070665_100203542 3300005548 Bacteria 1980
49 Ga0070704_100002927 3300005549 Bacteria 9698
50 Ga0070664_100028510 3300005564 Bacteria 4645
51 Ga0070664_100031187 3300005564 Unclassified 4451
52 Ga0068857_100008371 3300005577 Bacteria 8937
53 Ga0068859_100006507 3300005617 Bacteria 11859
54 Ga0068859_100008487 3300005617 Bacteria 10395
55 Ga0068859_100014717 3300005617 Bacteria 7862
56 Ga0068859_100038375 3300005617 Bacteria 4806
57 Ga0068864_100254268 3300005618 Bacteria 1632
58 Ga0068861_100006147 3300005719 Bacteria 8166
59 Ga0068861_100130928 3300005719 Bacteria 2036
60 Ga0068870_10002625 3300005840 Bacteria 7523
61 Ga0068870_10043131 3300005840 Bacteria 2352
62 Ga0068863_100256577 3300005841 Bacteria 1690
63 Ga0068858_100007429 3300005842 Bacteria 10598
64 Ga0068858_100059535 3300005842 Bacteria 3530
65 Ga0068858_100212021 3300005842 Bacteria 1833
66 Ga0068860_100004839 3300005843 Bacteria 13720
67 Ga0068860_100126302 3300005843 Bacteria 2451
68 Ga0068860_100401401 3300005843 Unclassified 1356
69 Ga0068862_100001948 3300005844 Bacteria 18711
70 Ga0068862_100115143 3300005844 Bacteria 2364
71 Ga0068862_100262527 3300005844 Bacteria 1577
72 Ga0075368_10068411 3300006042 Bacteria 1431
73 Ga0075363_100177446 3300006048 Bacteria 1211
74 Ga0075367_10015537 3300006178 Bacteria 4142
75 Ga0097621_100110024 3300006237 Bacteria 2328
76 Ga0075428_100000004 3300006844 Bacteria 326694
77 Ga0075428_100001106 3300006844 Bacteria 28707
78 Ga0075428_100006767 3300006844 Bacteria 12753
79 Ga0075428_100007999 3300006844 Bacteria 11727
80 Ga0075428_100042444 3300006844 Bacteria 5001
81 Ga0075428_100444834 3300006844 Unclassified 1388
82 Ga0075428_100620440 3300006844 Bacteria 1154
83 Ga0075431_100016206 3300006847 Bacteria 7560
84 Ga0075431_100035059 3300006847 Bacteria 5169
85 Ga0075431_100045930 3300006847 Bacteria 4503
86 Ga0075431_100068892 3300006847 Bacteria 3651
87 Ga0075431_100267055 3300006847 Bacteria 1735
88 Ga0075433_10006978 3300006852 Bacteria 8955
89 Ga0075433_10021339 3300006852 Bacteria 5431
90 Ga0075433_10032642 3300006852 Bacteria 4460
91 Ga0075433_10039950 3300006852 Bacteria 4059
92 Ga0075434_100000142 3300006871 Bacteria 43872
93 Ga0075434_100014380 3300006871 Bacteria 7564
94 Ga0075434_100030819 3300006871 Bacteria 5284
95 Ga0075434_100043142 3300006871 Bacteria 4472
96 Ga0075434_100045420 3300006871 Bacteria 4358
97 Ga0075429_100087761 3300006880 Bacteria 2711
98 Ga0075429_100102982 3300006880 Bacteria 2493
99 Ga0075429_100124924 3300006880 Bacteria 2250
100 Ga0075429_100328592 3300006880 Bacteria 1338
101 Ga0075436_100404433 3300006914 Unclassified 989
102 Ga0097620_100006507 3300006931 Bacteria 11859
103 Ga0097620_100008487 3300006931 Bacteria 10395
104 Ga0097620_100014717 3300006931 Bacteria 7862
105 Ga0097620_100038376 3300006931 Bacteria 4806
106 Ga0075435_100049180 3300007076 Bacteria 3390
107 Ga0075435_100072740 3300007076 Bacteria 2809
108 Ga0075435_100096528 3300007076 Bacteria 2445
109 Ga0111539_10000005 3300009094 Bacteria 467342
110 Ga0111539_10003390 3300009094 Bacteria 20996
111 Ga0111539_10013007 3300009094 Bacteria 10413
112 Ga0111539_10015041 3300009094 Bacteria 9643
113 Ga0111539_10047310 3300009094 Bacteria 5140
114 Ga0111539_10244880 3300009094 Bacteria 2087
115 Ga0111539_10421511 3300009094 Bacteria 1554
116 Ga0111539_10509124 3300009094 Unclassified 1402
117 Ga0105247_10037240 3300009101 Bacteria 2968
118 Ga0105247_10073478 3300009101 Bacteria 2143
119 Ga0114129_10001006 3300009147 Bacteria 36715
120 Ga0114129_10024560 3300009147 Bacteria 8539
121 Ga0114129_10025489 3300009147 Bacteria 8380
122 Ga0114129_10040024 3300009147 Bacteria 6611
123 Ga0114129_10061409 3300009147 Bacteria 5252
124 Ga0114129_10570155 3300009147 Bacteria 1470
125 Ga0105243_10019342 3300009148 Bacteria 5162
126 Ga0105243_10204281 3300009148 Bacteria 1735
127 Ga0105242_10068374 3300009176 Unclassified 2939
128 Ga0105242_10144790 3300009176 Bacteria 2066
129 Ga0105242_10298648 3300009176 Bacteria 1469
130 Ga0105248_10086089 3300009177 Bacteria 3536
131 Ga0105248_10333509 3300009177 Bacteria 1708
132 Ga0105237_10026701 3300009545 Bacteria 5902
133 Ga0105249_10001862 3300009553 Bacteria 18318
134 Ga0105249_10113392 3300009553 Unclassified 2565
135 Ga0105249_10244542 3300009553 Unclassified 1775
136 Ga0157378_10107128 3300013297 Bacteria 2557
137 Ga0163162_10086461 3300013306 Unclassified 3213
138 Ga0163162_10168330 3300013306 Bacteria 2315
139 Ga0157375_10004691 3300013308 Bacteria 11891
140 Ga0157375_10018730 3300013308 Bacteria 6283
141 Ga0163163_10048426 3300014325 Bacteria 4179
142 Ga0163163_10057384 3300014325 Bacteria 3850
143 Ga0163163_10368246 3300014325 Bacteria 1494
144 Ga0157380_10005902 3300014326 Bacteria 8567
145 Ga0157380_10016463 3300014326 Bacteria 5454
146 Ga0157380_10041584 3300014326 Bacteria 3588
147 Ga0157380_10293628 3300014326 Unclassified 1494
148 Ga0157380_10301167 3300014326 Bacteria 1477
149 Ga0157380_10348219 3300014326 Bacteria 1385
150 Ga0157377_10188275 3300014745 Bacteria 1303
151 Ga0157379_10021829 3300014968 Bacteria 5672
152 Ga0207710_10041880 3300025900 Bacteria 2032
153 Ga0207643_10005867 3300025908 Bacteria 6560
154 Ga0207671_10164570 3300025914 Bacteria 1719
155 Ga0207681_10001736 3300025923 Bacteria 13992
156 Ga0207681_10007609 3300025923 Bacteria 6639
157 Ga0207650_10020970 3300025925 Bacteria 4616
158 Ga0207650_10033548 3300025925 Bacteria 3719
159 Ga0207650_10098782 3300025925 Bacteria 2244
160 Ga0207650_10222155 3300025925 Bacteria 1521
161 Ga0207644_10105419 3300025931 Bacteria 2124
162 Ga0207686_10076719 3300025934 Bacteria 2168
163 Ga0207709_10047741 3300025935 Bacteria 2604
164 Ga0207670_10059566 3300025936 Bacteria 2598
165 Ga0207670_10222184 3300025936 Bacteria 1446
166 Ga0207704_10068551 3300025938 Bacteria 2237
167 Ga0207691_10072155 3300025940 Bacteria 3114
168 Ga0207711_10052918 3300025941 Bacteria 3481
169 Ga0207661_10058508 3300025944 Bacteria 3102
170 Ga0207679_10024664 3300025945 Unclassified 4125
171 Ga0207679_10030811 3300025945 Bacteria 3749
172 Ga0207651_10313646 3300025960 Bacteria 1309
173 Ga0207712_10010716 3300025961 Bacteria 5823
174 Ga0207712_10370449 3300025961 Bacteria 1196
175 Ga0207668_10035280 3300025972 Bacteria 3328
176 Ga0207703_10005115 3300026035 Bacteria 10612
177 Ga0207703_10011465 3300026035 Bacteria 6894
178 Ga0207708_10027938 3300026075 Bacteria 4271
179 Ga0207708_10067510 3300026075 Bacteria 2735
180 Ga0207708_10140230 3300026075 Bacteria 1896
181 Ga0207708_10391909 3300026075 Bacteria 1147
182 Ga0207648_10004094 3300026089 Bacteria 15099
183 Ga0207648_10108385 3300026089 Bacteria 2438
184 Ga0207648_10357091 3300026089 Bacteria 1318
185 Ga0207676_10046996 3300026095 Bacteria 3343
186 Ga0207676_10144235 3300026095 Bacteria 2043
187 Ga0207676_10411643 3300026095 Bacteria 1266
188 Ga0207674_10010409 3300026116 Bacteria 10538
189 Ga0207675_100003283 3300026118 Bacteria 15841
190 Ga0207683_10124114 3300026121 Unclassified 2320
191 Ga0207428_10000024 3300027907 Bacteria 265587
192 Ga0207428_10008250 3300027907 Bacteria 9420
193 Ga0207428_10008766 3300027907 Bacteria 9122
194 Ga0207428_10031881 3300027907 Bacteria 4341
195 Ga0207428_10034654 3300027907 Bacteria 4134
196 Ga0268266_10078732 3300028379 Bacteria 2869
197 Ga0268266_10126246 3300028379 Bacteria 2284
198 Ga0268265_10003224 3300028380 Bacteria 11848
199 Ga0268265_10093485 3300028380 Bacteria 2409
200 Ga0307408_100139938 3300031548 Bacteria 1899
201 Ga0307408_100158876 3300031548 Bacteria 1793
202 Ga0307405_10024798 3300031731 Bacteria 3433
203 Ga0307405_10100196 3300031731 Bacteria 1941
204 Ga0307405_10138298 3300031731 Bacteria 1694
205 Ga0307413_10023584 3300031824 Bacteria 3337
206 Ga0307413_10097570 3300031824 Bacteria 1933
207 Ga0307410_10087246 3300031852 Bacteria 2206
208 Ga0307407_10011275 3300031903 Bacteria 4249
209 Ga0307412_10330095 3300031911 Bacteria 1217
210 Ga0307409_100024209 3300031995 Bacteria 4229
211 Ga0307409_100440422 3300031995 Bacteria 1255
212 Ga0307416_100005413 3300032002 Bacteria 7836
213 Ga0307416_100042463 3300032002 Bacteria 3550
214 Ga0307416_100123332 3300032002 Bacteria 2315
215 Ga0307414_10303331 3300032004 Unclassified 1352
216 Ga0307411_10087770 3300032005 Bacteria 2161
217 Ga0307415_100088558 3300032126 Bacteria 2234
218 Ga0307415_100274091 3300032126 Bacteria 1384
219 Ga0373961_0017578 3300035241 Bacteria 1858
220 Ga0373947_0060898 3300035725 Bacteria 2293
221 Ga0373937_0120006 3300036401 Bacteria 2450
222 Ga0439433_0013593 3300041999 Bacteria 1788
223 Ga0439433_0029758 3300041999 Bacteria 1247
224 Ga0439462_0013642 3300042015 Bacteria 2084
225 Ga0439446_0004819 3300042156 Bacteria 3440
226 Ga0439435_0019839 3300042436 Bacteria 1728
227 Ga0439464_0017035 3300042439 Bacteria 1968
228 Ga0439460_0045068 3300042461 Bacteria 1307
229 Ga0453683_0088162 3300044673 Bacteria 1945
230 Ga0451576_0017361 3300045051 Bacteria 7914
231 Ga0451576_0025794 3300045051 Bacteria 6331
232 Ga0451576_0031439 3300045051 Bacteria 5659
233 Ga0451576_0284333 3300045051 Unclassified 1729
234 Ga0495594_0131093 3300046499 Unclassified 1420
235 Ga0495659_0005042 3300046664 Bacteria 4149
236 Ga0495659_0042876 3300046664 Bacteria 1621
237 Ga0495647_0085814 3300046681 Bacteria 1283
238 Ga0495669_0008795 3300046684 Bacteria 4253
239 Ga0496106_0043990 3300048909 Bacteria 3352
240 Ga0496108_0058203 3300048911 Bacteria 3248
241 Ga0496110_0014712 3300048913 Bacteria 6503
242 Ga0496110_0131660 3300048913 Bacteria 2259
243 Ga0496114_0106976 3300048917 Bacteria 2393
244 Ga0496115_0153073 3300048918 Bacteria 1905
245 Ga0501031_0311649 3300049568 Bacteria 1020
246 Ga0501033_0246972 3300049570 Bacteria 1266
247 Ga0501034_0139155 3300049571 Bacteria 2408
248 Ga0501038_0239580 3300049574 Bacteria 1441
249 Ga0501040_0032461 3300049576 Bacteria 3533
250 Ga0501042_0153410 3300049578 Bacteria 1661
251 Ga0501048_0395101 3300049582 Bacteria 988
252 Ga0501067_0054053 3300049583 Bacteria 2225
253 Ga0501068_0123933 3300049584 Bacteria 1613
254 Ga0501071_0007188 3300049587 Bacteria 7283
255 Ga0501071_0027976 3300049587 Bacteria 3969
256 Ga0501072_0022859 3300049588 Bacteria 4852
257 Ga0501075_0011179 3300049591 Bacteria 6345
258 Ga0501075_0200282 3300049591 Bacteria 1523
259 Ga0501076_0016750 3300049592 Bacteria 5561
260 Ga0501076_0028627 3300049592 Bacteria 4327
261 Ga0501079_0137603 3300049741 Bacteria 1902
262 Ga0501081_0052276 3300049743 Bacteria 2819
263 Ga0501081_0100838 3300049743 Bacteria 2041
264 Ga0501083_0181362 3300049744 Unclassified 1375
265 Ga0501045_0067410 3300049824 Bacteria 2628
266 Ga0501045_0254092 3300049824 Bacteria 1308
267 nmdc:mga04h51_25005_c1 3300050495 Bacteria 1834
268 nmdc:mga05p37_1077_c1 3300050507 Bacteria 31291
269 nmdc:mga05p37_210788_c1 3300050507 Bacteria 2349
270 nmdc:mga05p37_33782_c1 3300050507 Bacteria 6265
271 nmdc:mga05p37_67884_c1 3300050507 Bacteria 4386
272 nmdc:mga05p37_77792_c1 3300050507 Bacteria 4084
273 nmdc:mga09592_137559_c1 3300050508 Bacteria 2104
274 nmdc:mga09592_141512_c1 3300050508 Bacteria 2074
275 nmdc:mga09592_22281_c1 3300050508 Bacteria 4635
276 nmdc:mga09592_352211_c1 3300050508 Bacteria 1274
277 nmdc:mga09592_39613_c1 3300050508 Bacteria 3958
278 nmdc:mga09592_44892_c1 3300050508 Bacteria 3721
279 nmdc:mga06r32_15992_c1 3300050510 Bacteria 4503
280 nmdc:mga06r32_202648_c1 3300050510 Bacteria 1972
281 nmdc:mga06r32_281673_c1 3300050510 Bacteria 1649
282 nmdc:mga06r32_29003_c1 3300050510 Bacteria 5182
283 nmdc:mga06r32_4731_c1 3300050510 Bacteria 12241
284 nmdc:mga06r32_500239_c1 3300050510 Bacteria 1192
285 nmdc:mga08y16_13334_c1 3300050511 Bacteria 8647
286 nmdc:mga08y16_200585_c1 3300050511 Bacteria 2068
287 nmdc:mga08y16_2700_c1 3300050511 Bacteria 18215
288 nmdc:mga08y16_37594_c1 3300050511 Bacteria 5082
289 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
290 nmdc:mga0n895_155866_c1 3300050512 Bacteria 2314
291 nmdc:mga0n895_29775_c1 3300050512 Bacteria 5210
292 nmdc:mga0n895_3342_c1 3300050512 Bacteria 12897
293 nmdc:mga0n895_6977_c1 3300050512 Bacteria 9644
294 nmdc:mga0rr50_33420_c1 3300050513 Bacteria 3674
295 nmdc:mga0rr50_56205_c1 3300050513 Bacteria 2939
296 nmdc:mga0rr50_70042_c1 3300050513 Bacteria 2671
297 nmdc:mga0a205_217260_c1 3300050515 Bacteria 1798
298 nmdc:mga0a205_257110_c1 3300050515 Bacteria 1625
299 nmdc:mga0a205_34076_c2 3300050515 Bacteria 3521
300 nmdc:mga0a205_39951_c1 3300050515 Bacteria 4229
301 nmdc:mga0a205_8111_c1 3300050515 Unclassified 2958
302 Ga0500555_000124 3300053103 Bacteria 36790
303 Ga0500568_0014344 3300053139 Bacteria 3581
304 Ga0500616_0000395 3300053153 Bacteria 59933
305 Ga0500645_000097 3300053730 Bacteria 69232
306 Ga0501084_0028643 3300054114 Bacteria 4657
307 Ga0501082_0047672 3300060353 Bacteria 3693
308 Ga0530510_0057985 3300061734 Bacteria 2799
309 Ga0530510_0256402 3300061734 Bacteria 1304
310 Ga0114129_10307565
311 SwRhRL2b_contig_1842440
312 JGI24751J29686_10006837
313 rootH1_10088998
314 Ga0065704_10076763
315 Ga0065712_10001441
316 Ga0065712_10088972
317 Ga0065715_10000419
318 Ga0065715_10210594
319 Ga0065707_10001984
320 Ga0065707_10022036
321 Ga0065707_10087488
322 Ga0070676_10096580
323 Ga0070670_100026171
324 Ga0070670_100037278
325 Ga0070670_100115530
326 Ga0068869_100381480
327 Ga0070680_100042489
328 Ga0068868_100311584
329 Ga0070689_100192136
330 Ga0070692_10033548
331 Ga0070668_100060788
332 Ga0070669_100005894
333 Ga0070669_100444176
334 Ga0070675_100002286
335 Ga0070675_100119837
336 Ga0070688_100036513
337 Ga0070688_100050961
338 Ga0070688_100064030
339 Ga0070700_100010439
340 Ga0070700_100021099
341 Ga0070694_100012137
342 Ga0070708_100067039
343 Ga0070662_100099321
344 Ga0070681_10521805
345 Ga0068867_100006092
346 Ga0068867_100038576
347 Ga0068867_100221793
348 Ga0070685_10097006
349 Ga0070698_100010102
350 Ga0070698_100065494
351 Ga0070699_100001936
352 Ga0070699_100013705
353 Ga0070684_100178878
354 Ga0070672_100029915
355 Ga0070695_100348929
356 Ga0070696_100020353
357 Ga0070665_100203542
358 Ga0070704_100002927
359 Ga0070664_100028510
360 Ga0070664_100031187
361 Ga0068857_100008371
362 Ga0068859_100006507
363 Ga0068859_100008487
364 Ga0068859_100014717
365 Ga0068859_100038375
366 Ga0068864_100254268
367 Ga0068861_100006147
368 Ga0068861_100130928
369 Ga0068870_10002625
370 Ga0068870_10043131
371 Ga0068863_100256577
372 Ga0068858_100007429
373 Ga0068858_100059535
374 Ga0068858_100212021
375 Ga0068860_100004839
376 Ga0068860_100126302
377 Ga0068860_100401401
378 Ga0068862_100001948
379 Ga0068862_100115143
380 Ga0068862_100262527
381 Ga0075368_10068411
382 Ga0075363_100177446
383 Ga0075367_10015537
384 Ga0097621_100110024
385 Ga0075428_100000004
386 Ga0075428_100001106
387 Ga0075428_100006767
388 Ga0075428_100007999
389 Ga0075428_100042444
390 Ga0075428_100444834
391 Ga0075428_100620440
392 Ga0075431_100016206
393 Ga0075431_100035059
394 Ga0075431_100045930
395 Ga0075431_100068892
396 Ga0075431_100267055
397 Ga0075433_10006978
398 Ga0075433_10021339
399 Ga0075433_10032642
400 Ga0075433_10039950
401 Ga0075434_100000142
402 Ga0075434_100014380
403 Ga0075434_100030819
404 Ga0075434_100043142
405 Ga0075434_100045420
406 Ga0075429_100087761
407 Ga0075429_100102982
408 Ga0075429_100124924
409 Ga0075429_100328592
410 Ga0075436_100404433
411 Ga0097620_100006507
412 Ga0097620_100008487
413 Ga0097620_100014717
414 Ga0097620_100038376
415 Ga0075435_100049180
416 Ga0075435_100072740
417 Ga0075435_100096528
418 Ga0111539_10000005
419 Ga0111539_10003390
420 Ga0111539_10013007
421 Ga0111539_10015041
422 Ga0111539_10047310
423 Ga0111539_10244880
424 Ga0111539_10421511
425 Ga0111539_10509124
426 Ga0105247_10037240
427 Ga0105247_10073478
428 Ga0114129_10001006
429 Ga0114129_10024560
430 Ga0114129_10025489
431 Ga0114129_10040024
432 Ga0114129_10061409
433 Ga0114129_10570155
434 Ga0105243_10019342
435 Ga0105243_10204281
436 Ga0105242_10068374
437 Ga0105242_10144790
438 Ga0105242_10298648
439 Ga0105248_10086089
440 Ga0105248_10333509
441 Ga0105237_10026701
442 Ga0105249_10001862
443 Ga0105249_10113392
444 Ga0105249_10244542
445 Ga0157378_10107128
446 Ga0163162_10086461
447 Ga0163162_10168330
448 Ga0157375_10004691
449 Ga0157375_10018730
450 Ga0163163_10048426
451 Ga0163163_10057384
452 Ga0163163_10368246
453 Ga0157380_10005902
454 Ga0157380_10016463
455 Ga0157380_10041584
456 Ga0157380_10293628
457 Ga0157380_10301167
458 Ga0157380_10348219
459 Ga0157377_10188275
460 Ga0157379_10021829
461 Ga0207710_10041880
462 Ga0207643_10005867
463 Ga0207671_10164570
464 Ga0207681_10001736
465 Ga0207681_10007609
466 Ga0207650_10020970
467 Ga0207650_10033548
468 Ga0207650_10098782
469 Ga0207650_10222155
470 Ga0207644_10105419
471 Ga0207686_10076719
472 Ga0207709_10047741
473 Ga0207670_10059566
474 Ga0207670_10222184
475 Ga0207704_10068551
476 Ga0207691_10072155
477 Ga0207711_10052918
478 Ga0207661_10058508
479 Ga0207679_10024664
480 Ga0207679_10030811
481 Ga0207651_10313646
482 Ga0207712_10010716
483 Ga0207712_10370449
484 Ga0207668_10035280
485 Ga0207703_10005115
486 Ga0207703_10011465
487 Ga0207708_10027938
488 Ga0207708_10067510
489 Ga0207708_10140230
490 Ga0207708_10391909
491 Ga0207648_10004094
492 Ga0207648_10108385
493 Ga0207648_10357091
494 Ga0207676_10046996
495 Ga0207676_10144235
496 Ga0207676_10411643
497 Ga0207674_10010409
498 Ga0207675_100003283
499 Ga0207683_10124114
500 Ga0207428_10000024
501 Ga0207428_10008250
502 Ga0207428_10008766
503 Ga0207428_10031881
504 Ga0207428_10034654
505 Ga0268266_10078732
506 Ga0268266_10126246
507 Ga0268265_10003224
508 Ga0268265_10093485
509 Ga0307408_100139938
510 Ga0307408_100158876
511 Ga0307405_10024798
512 Ga0307405_10100196
513 Ga0307405_10138298
514 Ga0307413_10023584
515 Ga0307413_10097570
516 Ga0307410_10087246
517 Ga0307407_10011275
518 Ga0307412_10330095
519 Ga0307409_100024209
520 Ga0307409_100440422
521 Ga0307416_100005413
522 Ga0307416_100042463
523 Ga0307416_100123332
524 Ga0307414_10303331
525 Ga0307411_10087770
526 Ga0307415_100088558
527 Ga0307415_100274091
528 Ga0373961_0017578
529 Ga0373947_0060898
530 Ga0373937_0120006
531 Ga0439433_0013593
532 Ga0439433_0029758
533 Ga0439462_0013642
534 Ga0439446_0004819
535 Ga0439435_0019839
536 Ga0439464_0017035
537 Ga0439460_0045068
538 Ga0453683_0088162
539 Ga0451576_0017361
540 Ga0451576_0025794
541 Ga0451576_0031439
542 Ga0451576_0284333
543 Ga0495594_0131093
544 Ga0495659_0005042
545 Ga0495659_0042876
546 Ga0495647_0085814
547 Ga0495669_0008795
548 Ga0496106_0043990
549 Ga0496108_0058203
550 Ga0496110_0014712
551 Ga0496110_0131660
552 Ga0496114_0106976
553 Ga0496115_0153073
554 Ga0501031_0311649
555 Ga0501033_0246972
556 Ga0501034_0139155
557 Ga0501038_0239580
558 Ga0501040_0032461
559 Ga0501042_0153410
560 Ga0501048_0395101
561 Ga0501067_0054053
562 Ga0501068_0123933
563 Ga0501071_0007188
564 Ga0501071_0027976
565 Ga0501072_0022859
566 Ga0501075_0011179
567 Ga0501075_0200282
568 Ga0501076_0016750
569 Ga0501076_0028627
570 Ga0501079_0137603
571 Ga0501081_0052276
572 Ga0501081_0100838
573 Ga0501083_0181362
574 Ga0501045_0067410
575 Ga0501045_0254092
576 nmdc:mga04h51_25005_c1
577 nmdc:mga05p37_1077_c1
578 nmdc:mga05p37_210788_c1
579 nmdc:mga05p37_33782_c1
580 nmdc:mga05p37_67884_c1
581 nmdc:mga05p37_77792_c1
582 nmdc:mga09592_137559_c1
583 nmdc:mga09592_141512_c1
584 nmdc:mga09592_22281_c1
585 nmdc:mga09592_352211_c1
586 nmdc:mga09592_39613_c1
587 nmdc:mga09592_44892_c1
588 nmdc:mga06r32_15992_c1
589 nmdc:mga06r32_202648_c1
590 nmdc:mga06r32_281673_c1
591 nmdc:mga06r32_29003_c1
592 nmdc:mga06r32_4731_c1
593 nmdc:mga06r32_500239_c1
594 nmdc:mga08y16_13334_c1
595 nmdc:mga08y16_200585_c1
596 nmdc:mga08y16_2700_c1
597 nmdc:mga08y16_37594_c1
598 nmdc:mga08y16_6_c1
599 nmdc:mga0n895_155866_c1
600 nmdc:mga0n895_29775_c1
601 nmdc:mga0n895_3342_c1
602 nmdc:mga0n895_6977_c1
603 nmdc:mga0rr50_33420_c1
604 nmdc:mga0rr50_56205_c1
605 nmdc:mga0rr50_70042_c1
606 nmdc:mga0a205_217260_c1
607 nmdc:mga0a205_257110_c1
608 nmdc:mga0a205_34076_c2
609 nmdc:mga0a205_39951_c1
610 nmdc:mga0a205_8111_c1
611 Ga0500555_000124
612 Ga0500568_0014344
613 Ga0500616_0000395
614 Ga0500645_000097
615 Ga0501084_0028643
616 Ga0501082_0047672
617 Ga0530510_0057985
618 Ga0530510_0256402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

159

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.835 145 247
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8316 145 247
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8299 145 257
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8271 145 252
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8228 145 252
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8572 152 275 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.835 145 247 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8331 152 275 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8226 143 247 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8044 145 254 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8923 81 319 GO:0005886
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8876 91 319 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8788 81 319 GO:0005886
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8633 91 319 GO:0005886
AF-A0A2D5YZC2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8627 62 319 GO:0005886

Map